2I3CA

Crystal structure of an aspartoacylase from homo sapiens
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
302
structure length
302
Chain Sequence
EHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Aspartoacylase
publication title Structure of aspartoacylase, the brain enzyme impaired in Canavan disease.
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2006-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2i3cA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2i3cA01
2G9DA 4KSIA 2NYQA 3FF3A 2V8HA 5LRKA 1BPNA 1UWYA 5F09A 1OBRA 4A37A 2ZEPA 1CBXA 2PRQA 4P4DA 4ZY1A 2ZENA 3NFZA 4EMEA 3HLPA 4OC1A 2GU2A 2CIJA 4R76A 1Y7EA 4NGTA 4CPAA 4MHYA 1R43A 3D4UA 4EWTA 1DE4C 3S9LA 2AFUA 3NH5A 2PJ1A 4FUUA 3KZWA 2VL1A 2ZOGA 1Z8LA 3CDXA 4UIAA 3SJFA 3IWWA 3H8GA 3PB7X 1YLOA 4A38A 4LQGA 2ABZA 1KWMA 1YW4A 2PIZA 4IK2A 1JQGA 5K8OA 1ZG8A 1FT7A 3PB4X 2BO9A 4UEFA 3B35A 4A39A 1BLLE 4MHPA 4OP4A 1PYTB 3D68A 2PVWA 5D29A 3GUXA 2XEGA 3V38A 1Y0RA 4YU9A 1ZG9A 5LYLA 4OKOA 3V7ZA 4MRIA 2DEAA 3GB0A 3FVLA 2OOTA 1AYEA 4UIBA 1VGYA 1BPMA 2V77A 3CT9A 4A94A 5K8MA 1TF8A 4OMEA 4TWEA 5HVFA 5LYIA 2WZNA 3SI2A 4ZY0A 2Q51A 5DS0A 2PJ6A 4FWUA 4ZX9A 2PCUA 2OR4A 5JM6A 2HB6A 1CP6A 2JBJA 2PIYA 3S9MA 4P10A 2WYRA 1PCAA 4R6TA 4OC3A 2IQ6A 1IY7A 5JGFA 4FAIA 1YW6A 1ELLP 4PXCA 4OC0A 3PRTA 4ZX8A 3D7FA 3B7IA 3ISXA 3L2NA 2QVPA 4ZI6A 3LWUA 4NFRA 2V8VA 1TKFA 4F9VA 2RB7A 2PJ0A 3FEEA 3D67A 3PB8X 4MHZA 4NGPA 2Q4ZA 2HC9A 1XBUA 4MCSA 1VIXA 2QJ8A 3PB6X 3RZAA 3FX6A 3PBBA 2BCOA 3MRUA 2F8HA 3N5FA 3DLJA 4PPZA 2PJ9A 4NGMA 4R8FA 1F57A 3SI0A 4WWVA 2NSMA 4X2TA 3IFEA 1Z5RA 3BI0A 3HUVA 5JH9A 3SI1A 3SJXA 2F7VA 2PJ2A 1ARLA 2CF4A 3PBEA 1ZLIA 4K3NA 5K8PA 1Q7LA 4P44A 4F8ZA 4P4EA 3KASA 1LAMA 3IO1A 2XEIA 2PJ7A 3IJ3A 4DJLA 2PJBA 1ZLHA 4NGNA 3CPXA 3D7GA 3I1UA 4ZYQA 2FVGA 4UEZA 3FJUA 2ZEOA 4R7MA 4FBEA 1LAPA 2ZEHA 1YSJA 1H8LA 2EK9A 5THWA 3LMSA 5HVGA 1F2OA 5J1QA 5CBMA 4NJRA 3JRUA 3KQXA 3GLJA 1NSAA 5HXDA 3TC8A 1QQ9A 3D7DA 4P4FA 5IB9A 1ARMA 4DYOA 1M4LA 7CPAA 3NH4A 2C1CA 1XMBA 3MN8A 2AFOA 5LRJA 2CTBA 2PVVA 3KR5A 5LRGA 4Z65A 1LCPA 2XEJA 4P4JA 4NGQA 3VATA 4MCRA 1BAVA 2ZEFA 3BXMA 1YMEA 2GREA 3ISZA 4DUKA 3CPAA 3VH9A 1VHOA 2PJ5A 4RUHA 2ZEGA 1LANA 4NGSA 1LFWA 1CG2A 3WC7A 2ZEMA 1ZG7A 4OC5A 4OIWA 2Q43A 1EE3P 3VARA 4H2KA 3KGQA 4P45A 5HVHA 4P4BA 3BHXA 3IEHA 2QYVA 1TXRA 2IMOA 3B3WA 4IAVA 3KHXA 5K8NA 3S9NA 4OIDA 1Y0YA 3KR4A 1DTDA 1FNOA 4JYWA 4PXDA 1QMUA 3TX8A 2ANPA 2GLJA 3SJGA 3B3VA 3B2YA 2AFWA 3D66A 2ZEDA 4YWYA 4UF4A 2V8GA 3WC5A 2ZOFA 4MHNA 1VHEA 2XEFA 1XJOA 5LYDA 2PJ8A 2ZEEA 3NH8A 4MMOA 4PXEA 4P6YA 2ZELA 3D7HA 2CTCA 5D8NA 1CPXA 4MCPA 2PJCA 3B3CA 2EK8A 3KQZA 2C6CA 3NA6A 4MCQA 5ELYA 1TKJA 2AFMA 2PJAA 1RTQA 5I4MA 1R3NA 4JZ0A 4PXBA 3B3TA 4NJQA 3FECA 1HEEA 4X8IA 4OC4A 2O53A 1XRYA 1LOKA 1CPSA 2PE3A 6CPAA 3IC1A 4MXUA 4UEEA 4G1PA 3FMCA 4ZY2A 5LYFA 1GYTA 3WT4A 3PFOA 3RBUA 4NGRA 4AXVA 2RFHA 4B6ZA 3KHZA 3SJEA 2PJ3A 3IIBA 4GM5A 3KL9A 1ELMP 2AFSA 3BI1A 3B3SA 4F9UA 2AFZA 4IHMA 4ONWA 3PB9X 8CPAA 4PQAA 1Z2LA 3H8FA 3K2KA 2O4HA 1IGBA 4X3RA 3KI9A 3FH4A 4EFDA 2JBKA 3RAMA 4OC2A 4WJBA 2EWBA 3PEIA 5CPAA 3FEDA 3PFEA 2POKA 2V8DA 2I3CA 1XFOA 2JEWA 1CX8A 3K9TA 2GLFA 4P4IA 3WABA 2AFXA 1HDUA 4W9YA 1TF9A 2J9AA 1F2PA 3QNVA 4O23A 1AMPA 2BOAA 4TNUA 1TKHA 2C6GA 3WC6A 1HDQA 2IJZA 3T8WA 2C6PA 3DGVA 4Q7AA 1CP7A 3H8EA 2PJ4A 4BD9A
chains in the Genus database with same CATH superfamily
2G9DA 4FD5A 2Q4YA 1BPNA 1YIT1 4KOUA 2EUIA 1CBXA 1K4JA 4ZY1A 1YHQZ 3NFZA 1B6BA 4NF1A 3HLPA 1Z03A 4S1TA 3CQZI 1Y7EA 3IX0A 4CPAA 4NCZA 3D4UA 5I0CA 3GTPI 3LD2A 2PSWA 2LFUA 2NMTA 2PQ8A 3KZWA 5AG6A 1Y9WA 3TE4A 5FLXf 1Z8LA 2QR1B 4HPSA 3SJFA 4C7HA 1Z8TA 3GIUA 3H8GA 3PB7X 1YLOA 4LQGA 2PIZA 4IK2A 5KTAA 5CM2M 1N8R2 4UEFA 3B35A 1BLLE 4OP4A 2QA4Z 3D68A 2B4DB 5D29A 3GUXA 1Z4RA 1YUAA 2BSWA 1M901 1Z4EA 1Y0RA 2V8JA 1ZG9A 4OKOA 3SHPA 4MD7A 3IR7A 4MRIA 2DEAA 3GB0A 1A2ZA 1VQ7Z 3FVLA 2F5IA 4A94A 4TWEA 3D2PA 2B4DA 2Q51A 5DS0A 4RVHA 2PJ6A 4ZX9A 1M4DA 2VPWA 1CP6A 2JBJA 2PIYA 1S721 4UFWA 2WUUA 1PCAA 1WJ2A 3CCVZ 4CAXA 2VPXA 3PRTA 4ZX8A 3HKZA 1AUGA 1Z8XA 1Q2CA 4ZI6A 4F9VA 4NH1C 1VQO1 2CXAA 2VUMI 2ZW6A 2RB7A 4A3GI 1I6HI 1M1DA 3G6EZ 4BBHA 3FEEA 5J8FA 3D67A 3CCE1 3PB8X 4MHZA 3J80f 3VMGA 3FX6A 4UWIA 3F0AA 2F8HA 1VQ41 4PPZA 3K7AI 2Z11A 2OU2A 2QREB 1F57A 1FY7A 1S7KA 4X2TA 2YNCA 2OZGA 5JH9A 3SI1A 2PR8A 4E31A 4E2XA 2H5MA 2QLVB 3PBEA 2JUBA 1ZLIA 5BWAB 3CXCZ 2OZUA 4OLLA 5IT9f 4H6UA 3IJ3A 4DJLA 2OTJZ 1K9M2 2GIVA 2Q7BA 4XPDC 3CPXA 3I1UA 1VQK1 2P0WA 1LAPA 2ZEHA 1YR0A 4R87A 4KOVA 5D1OA 4HH4A 4M85A 4NSQA 2P6EA 4MH4A 1I12A 3D2MA 2QRCB 1XMTA 1NSAA 1Y9KA 3TC8A 4P4FA 1ARMA 2DE7A 1M4LA 7CPAA 2C1CA 2JNYA 1Q16A 1XMBA 2QRDB 2JR6A 2AFOA 3S16I 2CTBA 2PVVA 4Z65A 1LCPA 3CC2Z 2XEJA 1VQ5Z 3QAYA 1BAVA 4A3II 3BXMA 1YMEA 2F4OA 4CAEA 2D4OA 2PJ5A 1IYKA 4NGSA 1LFWA 2R8VA 3CCLZ 5IP7I 3MONA 1RLYA 3I56Z 1IIDA 1Y1WI 3VARA 4CS0B 2JLMA 3IF8A 3KGQA 1Q861 2K5RA 4P4BA 3FKII 3BHXA 3IEHA 1TXRA 1TWFI 1KC81 3KHXA 1SFOI 1VQMZ 4OIDA 5ISVA 2R92I 4CGOA 1L1OC 1X3WA 1KRLA 3EEDA 4JYWA 4PXDA 3SXNA 2AYDA 4BXXI 2AFWA 1KD12 4YWYA 4B11A 4MHNA 2XEFA 5LL6f 3H3VJ 3IFUA 2ZEEA 4XNHC 3GTKI 4MMOA 4P6YA 2CTCA 3CXPA 3B3CA 2ARHA 3TTHA 2EK8A 4XX2A 3NA6A 4MCQA 1TKJA 4B13A 4KUAA 4BINA 3S1NI 2F4MA 4MI4A 4CRZB 3FECA 3IWGA 1HEEA 2EVNA 1LOKA 3CCV1 4BBRI 4RVGA 1NSLA 5LYFA 4Y49B 2HQYA 4B6ZA 2OTLZ 3KHZA 2GTHA 2PJ3A 3NDJA 3RYOA 4MJ8A 2DPSA 5EC4A 1S7NA 3BI1A 3G6E1 3B3SA 4IHMA 4ONWA 3PB9X 1J4JA 4QC6A 3JVNA 2K5TA 4FD7A 2X7BA 4UFVA 1M902 2ODFA 5CPAA 5J8CA 4A3DI 4E2ZA 2D4PA 5C88A 2G0BA 1CX8A 3K9TA 3WABA 4AVCA 4MHDA 2HUZA 2CNMA 4KOSA 3CD61 4B5PB 2RIQA 1AMPA 1AA6A 2C6GA 3TOBA 1HDQA 2IJZA 3T8WA 3GTJI 2VF1A 1RXTA 5HMNA 1CP7A 4BD9A 3SXOA 4RVFA 5T64A 1BO4A 4C2ZA 2R93I 4B5PA 3G711 4H6ZA 2NYQA 5LRKA 3I551 3Q87A 4PV6A 3VWDA 2JA5I 4X6AI 2AKLA 4P4DA 4EMEA 3MGDA 4KS9A 2GU2A 4E2AA 1I50I 1VQLZ 1R43A 3TDHB 3R95A 3HOYI 4M6IA 1Q812 1K8A1 3EO4A 4FUUA 4BBSI 4K30A 1YVOA 1ON0A 4A30A 2WPWA 4UIAA 1NP6A 3D6WA 3OW2Z 4A38A 4Y7NI 2RPRA 2DXQA 2WAQA 1VQN1 1IB1E 1FT7A 2BEIA 3PB4X 3FB3A 5F46A 4MHPA 1PYTB 4RS4A 4AYBA 4FD6A 2YGWA 1X3ZA 1QVGZ 2VZZA 2QMLA 5A28A 4R3LA 2GTIA 4UCPA 4YU9A 4A95A 4DQYB 4MD9A 4X5KA 2OOXB 1GHEA 2OOTA 1AYEA 4UIBA 1BPMA 3CT9A 4BY1I 4E8OA 3CCU1 1TF8A 4OMEA 1FDOA 5HVFA 2WZNA 5G21A 4ZY0A 1W2BY 5C4JI 1U6MA 3TT2A 3D8PA 3FIXA 2PCUA 3CC41 4HGYA 3S9MA 1YJN1 2WYRA 2HU9A 4A31A 4OC3A 1NUIA 4KZTA 3G4SZ 4UFXA 1IY7A 1YW6A 5JPHA 4A3KI 4OC0A 2PMZA 3ISXA 2I00A 2QVPA 4NFRA 2V8VA 4R57A 2FXFA 2PJ0A 5A27A 3CXQA 4B12A 4KUBA 4MFPA 3W6SA 4CGPA 2HC9A 2NVQI 2IZ4A 2V8KA 1VIXA 1YJWZ 2QJ8A 3PB6X 3RZAA 2OZHA 3K9UA 3JTKA 2BCOA 3MRUA 2H85A 4C2YA 1XIXA 1Z8WA 3JAMb 4NGMA 3CCSZ 3NE7A 4R8FA 1Q862 3SI0A 4A93I 3H4QA 1B87A 3CXSA 3HUVA 1KC82 1P9NA 1YJ91 2J8RA 4DK1A 3SJXA 4CGNA 4C2XA 1MJ9A 1ARLA 1JWHC 4U9YA 1NMTA 5K8PA 1KUVA 4P44A 4P4EA 4JWPA 3TO7A 2JS4A 1Y1VI 3IO1A 2QKDA 1ZLHA 4CGLA 2LEXA 2JA7I 1SIWA 1Q7Y1 4R7MA 3EY5A 5DWMA 5A2Qb 1YVKA 2O28A 1N71A 2YNCC 1YIJ1 2P6GA 4PK2A 1H8LA 3F5BA 4CAVA 4NJRA 3JRUA 3GLJA 5HXDA 5EBVA 4NB9A 3D7DA 4DYOA 2AE6A 4EVYA 3MN8A 5F49A 5LRJA 4NXYA 3KR5A 1XOVA 4F0XA 4KORA 3CCRZ 2E9HA 3V8IA 4P4JA 4NGQA 3TO6A 5JQ4A 1VQ91 2ZEFA 4NOZA 5F48A 1QSMA 3EERA 3ISZA 4OADA 2V3VA 1NJI1 1XEBA 3KIHA 1VQ6Z 1R57A 4J3GA 4CRYB 3F8KA 4NBEA 1Y1VS 3H5ZA 2BUEA 4H2KA 1I1DA 5HVHA 2IV2X 2B58A 2CNTA 1Q811 3VWEA 2JIQA 1WK4A 2IMOA 5K8NA 1Y0YA 4CYOA 1DTDA 4XPLA 4QBJA 1OZPA 3TX8A 2GLJA 2QECA 1Z9UA 2VPYA 4HNXB 3D66A 4UF4A 2V8GA 2E2HI 1VHEA 1XJOA 5LYDA 3CMA1 2NVXI 2FIAA 2ZELA 4KLWA 4NBHA 4NB8A 4CAFA 4KOWA 1CPXA 2PJCA 1R9TI 3CCM1 4QB9A 4KVOE 2AFMA 4PSWA 1RTQA 5AG4A 4JJXA 1S60A 1VQ81 1VQP1 1R3NA 4PXBA 1W2BZ 3M3YI 4B5OA 5AGEA 5HH1A 2JMOA 2QEX1 2O53A 1K8A2 1XRYA 4UEEA 4ZY2A 3WR7A 3WT4A 4U5YA 4I49A 4M3SA 3RBUA 2JDCA 4PK3A 2RFHA 2M48A 2Q04A 4A3MI 3SJEA 2VUGA 5FLMI 4RN7A 2K3RA 3KL9A 3S1RI 1TWCI 3I07A 5H84A 4FD4A 4F9UA 2YNDA 2J6AA 4M6HA 4PQAA 3H8FA 1V0CA 3K2KA 4MD8A 3FH4A 4NBFA 3HOUI 2EWBA 4ORFA 1YHQ1 3F3PC 1K731 2I3CA 1KUYA 3S1QI 4HKFA 4NBCA 3I4NI 3U50C 3CCQZ 1JWQA 1Q821 3S6GA 1TF9A 4QTUA 2R1IA 3IU2A 3QNVA 4O23A 4TNUA 1S7LA 2FIWA 3HOWI 4NEXA 3CCJZ 1XF8A 3B8GA 4RS2A 4NBBA 3VTNA 1YREA 4PSXA 4XPDB 1X0TA 1UFHA 3GYAA 3GTGI 4JD6A 4KSIA 3GY9A 1UWYA 4C68A 2QA41 1OBRA 2HF1A 4AVBA 2ZEPA 2PRQA 2ZENA 4A3JI 3R1KA 2W03A 3CC7Z 2EO8A 2CIJA 4R76A 4Q38A 1VQ71 3LACA 4EWCA 2VPZA 3RNZA 3S9LA 3PGPA 2AFUA 3I3GA 3NH5A 2PJ1A 1TWAI 3CDXA 4E2YA 4MFQA 2GFQA 4II9A 5K8OA 3JAMf 4NBDA 4A39A 2Q4VA 4E30A 4MFLA 4RV9A 4KVXA 1YITZ 2JIMA 3VMIA 3D2LA 2B3VA 2XEGA 4YFJA 2OH1A 3VB9A 1CJWA 3V7ZA 3S6KA 1Z02A 3BG0B 4OAEA 4UWJA 3KKWA 1PUAA 1Q7Y2 1VGYA 2G2KA 2V77A 1L0CA 5LYIA 3SI2A 4KOYA 3RZDI 5IX3A 4UCNA 4FWUA 2OR4A 1IU8A 5JM6A 1M1K1 4P10A 4YRHA 4XNHB 2OB0A 3N7ZA 2WPXA 1ELLP 2PDOA 4M6GA 3D7FA 3B7IA 2JA8I 3PO2I 3L2NA 4HGZA 3LWUA 1QSNA 1QSRA 2GE3A 3GTQI 3W91A 2OTJ1 2Q4ZA 3HOVI 1NJI2 1YUKA 2J8MA 5IT9b 3PBBA 3N5FA 4MBUA 2PJ9A 3A9LA 4A32A 1S72Z 3GTOI 4WWVA 1QYPA 1Z5RA 4AG9A 3BI0A 4GS4A 3F3FC 1NE9A 4UBRA 4MFJA 2F7VA 3S14I 2ATRA 5E96A 1VQOZ 4AB7A 2P6FA 5KTCA 3GTMI 1VKCA 3CC21 1VQ51 2XEIA 2NVYI 2PJ7A 4LX9A 4MONA 3CCEZ 2PJBA 4A3LI 3G3SA 2Z3MA 3GCFA 2FVGA 2IL4A 5G22A 3S1MI 3FJUA 4LUAA 2ZEOA 3CCL1 1DL6A 4DNCA 2DF5A 5C4XI 1YSJA 3I561 3FBUA 5C44I 4E2WA 3LMSA 1F2OA 2B5GB 1YLEA 5HVGA 2JDDA 1JJ2Y 2M6NA 5J1QA 1TWGI 2ZAEB 3KQXA 1RNIA 2KPIA 2G3TA 1QQ9A 1YI2Z 3R9EA 3NH4A 5AG5A 1VQM1 1VHSA 4C7IA 3M4OI 1Z01A 2B5GA 2EBJA 2J8NA 4QUSA 3VATA 4MCRA 4CYQA 4F0YA 3FNCA 2RC4A 2Q44A 4DUKA 2RHBA 1S3ZA 3VH9A 3CPWY 3CMEZ 2ZEGA 1VLAA 4DGLA 2BL1A 2KCWA 3TOAA 1VQKZ 1CG2A 2ZEMA 1QVFY 1ZG7A 4CL1A 1LRZA 4OIWA 2Z3NA 2Q43A 4KOTA 1EE3P 2I79A 3GTMS 1K732 3J81b 3LODA 3PP9A 1SQHA 2CY2A 1S7FA 4P45A 4XPKA 3FQQA 3TO9A 1Q822 2QYVA 3JUWA 3B3WA 4IAVA 4CGMA 4CAWA 4A33A 3KR4A 3I9SA 4E0AA 2R98A 4F6AA 3SJGA 3B3VA 3IGRA 2VEZA 2OTL1 3S15I 4B10A 2ZEDA 2OOYB 2VI7A 4A3BI 4Q36A 1K83I 3NH8A 3FRMA 3R9GA 1QSTA 2Y0MA 3BG1B 1IOIA 4R3KA 3KQZA 2C6CA 2FSRA 3D9XA 3EFAA 1ML8A 2VQYA 2NVTI 1M44A 2HV2A 3QWUA 3B3TA 3FXTA 3KIFA 4X8IA 1XE4A 2E2II 6CPAA 3IC1A 1P4NA 4MXUA 2B63I 3FMCA 1GYTA 3ZJ0A 1YK3A 2YADA 3RO0A 3IIBA 3OWCA 4L89A 3G8WA 4ONUA 1ELMP 2AFSA 3I4MI 3S2DI 3T4NB 1IGBA 1TWHI 4MFKA 4X3RA 2WB1A 2JBKA 1IOFA 4YGOA 3RAMA 3VMHA 4B14A 3J7A4 3PEIA 3FEDA 3PFEA 2POKA 2BJOA 3DNSA 3NE8A 2JEWA 1VQL1 2GLFA 3DR8A 4P4IA 3S2HI 2IZ3A 3PZJA 4A2ZA 2AFXA 2REFA 1HDUA 4W9YA 1KQSY 3EC4A 2FE7A 2J9AA 4CYPA 4KSFA 2BOAA 1TFIA 1TKHA 1M1K2 2JIPA 2Z3KA 1MJBA 5EMIA 3WC6A 4Q7AA 1I21A 5C3EI 3H8EA 4U9ZA 2PJ4A 1X12A 1QF8A 2RT9A 1RO0A 3FF3A 2V8HA 5F09A 4A37A 4NBAA 2PK7A 4OC1A 3MZKB 4NGTA 4MHYA 4EWTA 4MFZA 3S6FA 1KZFA 5KTDA 5FVJA 1JJ2Z 1DE4C 1YI21 3CD6Z 4RI1A 4JXQA 2VL1A 2ZOGA 3QAHA 1WCMI 3IWWA 1TIQA 3RZOI 2PC1A 3BJ7A 5D1OB 2ABZA 1KWMA 1YW4A 3G4S1 1JQGA 4KVME 1ZG8A 1BOBA 2E7ZA 2BO9A 3G71Z 2R7HA 3I55Z 4MY0A 3CME1 2PVWA 4UCMA 3FQMA 2Z3OA 3CPWZ 3V38A 3DSBA 3TFYA 5LYLA 1RO5A 1QVFZ 3R96A 2LIYA 2G3AA 2FL4A 2P3YA 3T90A 3HOXI 2JEVA 1YJW1 5K8MA 3P5JB 4E33A 5AG7A 4KOXA 3H0GI 1ZO0A 2EGTA 3OW2Y 2HB6A 3GKQA 3CCS1 2ZW4A 3DDDA 1CM0A 3D3SA 4R6TA 3BLNA 2IQ6A 1VQNZ 5JGFA 4FAIA 5G1ZA 4HNWB 4PXCA 1FDIA 1QVGY 4IUSA 2YU9I 4CYNA 2VXKA 2RBLA 4AG7A 1TKFA 2PR1A 5H86A 2Z0ZA 2PRBA 4KSAA 2C27A 4Y49C 4A3EI 5DWNA 2V8IA 4E32A 1YQEA 2Z10A 5FLXb 4NGPA 3GTLI 1XBUA 4MCSA 5G20A 3CCUZ 2QIRA 5T6BA 2DPTA 3PO3I 5D1PA 3DLJA 3CC4Z 3LUSA 5C82A 1ZB8A 1WIIA 3TCVA 1YJNZ 2NSMA 3GKRA 3IFEA 1I3QI 5F47A 2Y0SA 4H89A 1N8R1 4A3FI 4JXRA 2PJ2A 3J81f 2CF4A 3CZXA 2ZW5A 1M4GA 2NAPA 2WSAA 1Q7LA 4K3NA 4ZBGA 1WWZA 3ESWA 3CCR1 2Z3PA 2FT0A 4F8ZA 3KASA 3BJ8A 4A3CI 3T9YA 2B3UA 1LAMA 1RO4A 4RVDA 3EXNA 2A4NA 2JIOA 4NGNA 5IB0A 3D7GA 1KUXA 4ZYQA 4UEZA 1PFTA 4FBEA 1VQ61 1Y7RA 5T67A 2FCKA 4AVAA 5IV0A 2EK9A 2ZPAA 5THWA 2R7ZI 4UA3A 5CBMA 1KQSZ 2Q0YA 2CNSA 3S17I 4GXHA 4QTTA 5IB9A 4JLYA 1YJ9Z 1WW9A 5AN9F 4QVTA 3PO3S 3HOZI 3J80b 3MZLB 5LRGA 3IU1A 3P2HA 2JIRA 1ZH1A 5A2Qf 1Q2DA 5CNPA 1M4IA 2GREA 3CPAA 1Q2YA 1ZB9A 1S5KA 1VHOA 2Z3LA 4RUHA 1LANA 3ZZIA 2P28A 3WC7A 4R9MA 4OC5A 1YX0A 1YIJZ 1S7MA 3TE5B 2Q7SA 3QB8A 4IF5A 3S6HA 2YNEA 2E2JI 4KLVA 3S9NA 5GCNA 4BMHA 1MJAA 1FNOA 1QMUA 1PU9A 2AJ6A 2ANPA 1Y8CA 1YGHA 3B2YA 2GANA 2PM9A 1VQ9Z 3R9FA 1QSOA 3WC5A 2ZOFA 2PJ8A 1LQLA 3W6XA 4PXEA 1K9M1 3D7HA 5D8NA 4MCPA 3C26A 4HNYB 5ELYA 3NDIA 4BY7I 2PJAA 5I4MA 2R6MA 1MK4A 2OZKA 4JZ0A 4NJQA 4OC4A 3CCQ1 2REEA 1USPB 3UY5A 1VQ4Z 1CPSA 2PE3A 4G1PA 3P2FA 3DR6A 1RQFA 3PFOA 1IYLA 2B4BA 4NGRA 4AXVA 4LQ6A 1WZNA 3CCJ1 3IWEA 4Y52I 4GM5A 2DE5A 3CXCY 4L8AA 3CMAZ 2DE6A 1USPA 1X10A 2AFZA 2W04A 8CPAA 1Z2LA 2O4HA 2V45A 3CCMZ 3KI9A 4EFDA 4NBGA 4OC2A 4WJBA 1P0HA 1VQ8Z 1VQPZ 2V8DA 3CC71 1XFOA 2KI7B 4ZGYB 1IICA 2VZYA 2QEXZ 1QXFA 1F2PA 2FS5A 1RO2A 2VBQA 3E0KA 1N2FA 2ZXVA 3DGVA 2C6PA 4MY3A 5IP9I 2JA6I 3FYNA 1KD11 2ZW7A
chains in the Genus database with same CATH topology
3GTGI 1QF8A 2RT9A 2R93I 2G9DA 4KSIA 1RO0A 3G711 2NYQA 3FF3A 2V8HA 5LRKA 3I551 3Q87A 1BPNA 1UWYA 5F09A 2QA41 1YIT1 2JA5I 4X6AI 1OBRA 2AKLA 2HF1A 4A37A 2ZEPA 1CBXA 4NBAA 2PRQA 1YHQZ 4P4DA 4ZY1A 2ZENA 3NFZA 4A3JI 4EMEA 2W03A 2PK7A 3CC7Z 3HLPA 4OC1A 3MZKB 2GU2A 1Z03A 4S1TA 2CIJA 4R76A 1I50I 3CQZI 1Y7EA 3IX0A 4NGTA 4CPAA 1VQLZ 4MHYA 1R43A 3TDHB 3D4UA 3GTPI 3HOYI 4EWTA 1VQ71 1Q812 1JJ2Z 4EWCA 2LFUA 1K8A1 1DE4C 1YI21 3S9LA 3CD6Z 2AFUA 3NH5A 2PJ1A 4FUUA 3KZWA 4BBSI 1TWAI 5FLXf 2VL1A 2ZOGA 1Z8LA 3CDXA 2QR1B 4E2YA 4UIAA 3SJFA 1WCMI 3IWWA 3RZOI 1NP6A 3D6WA 3H8GA 3PB7X 1YLOA 3OW2Z 4A38A 4LQGA 5D1OB 4Y7NI 2ABZA 1KWMA 1YW4A 2RPRA 2PIZA 4IK2A 2WAQA 5CM2M 3G4S1 1N8R2 1VQN1 1JQGA 1ZG8A 5K8OA 3JAMf 1FT7A 4NBDA 3PB4X 2BO9A 3G71Z 4UEFA 3I55Z 3B35A 4A39A 4E30A 4RV9A 1BLLE 3CME1 2QA4Z 1YITZ 4MHPA 4OP4A 1PYTB 3D68A 4RS4A 3VMIA 2PVWA 4AYBA 5D29A 3GUXA 3FQMA 1X3ZA 1QVGZ 1YUAA 2XEGA 3CPWZ 3V38A 1M901 2GTIA 1Y0RA 2V8JA 4YU9A 1ZG9A 3VB9A 5LYLA 4OKOA 1QVFZ 3V7ZA 4DQYB 4MD7A 4MD9A 1Z02A 3BG0B 2LIYA 2OOXB 4MRIA 2DEAA 3GB0A 3FVLA 1VQ7Z 2OOTA 2P3YA 1Q7Y2 3HOXI 1AYEA 4UIBA 1VGYA 1BPMA 2G2KA 1YJW1 4BY1I 2V77A 3CT9A 4A94A 5K8MA 3CCU1 3P5JB 4E33A 1TF8A 4OMEA 4TWEA 5HVFA 5LYIA 2WZNA 3SI2A 4ZY0A 2Q51A 1W2BY 5DS0A 3H0GI 4RVHA 5C4JI 3RZDI 2EGTA 3OW2Y 2PJ6A 4FWUA 4ZX9A 2PCUA 3CC41 2OR4A 5JM6A 2HB6A 3GKQA 3CCS1 4HGYA 1CP6A 2JBJA 2PIYA 1M1K1 3S9MA 1S721 4P10A 1YJN1 2WYRA 2HU9A 1PCAA 4R6TA 4OC3A 1NUIA 2IQ6A 3G4SZ 1VQNZ 1IY7A 5JGFA 4FAIA 3CCVZ 1YW6A 4A3KI 1ELLP 4PXCA 4OC0A 3PRTA 4ZX8A 1QVGY 3HKZA 3D7FA 3B7IA 2JA8I 2YU9I 2RBLA 2PMZA 3PO2I 3ISXA 3L2NA 2QVPA 4ZI6A 4HGZA 3LWUA 4NFRA 2V8VA 4NH1C 1VQO1 1TKFA 4F9VA 2VUMI 3GTQI 2RB7A 2PJ0A 4A3GI 4A3EI 1I6HI 2V8IA 4E32A 3G6EZ 5FLXb 3FEEA 3D67A 3CCE1 3PB8X 4MHZA 4NGPA 2OTJ1 2Q4ZA 2HC9A 3HOVI 3GTLI 1NJI2 2IZ4A 3J80f 3VMGA 2NVQI 1XBUA 1YUKA 2V8KA 1VIXA 4MCSA 1YJWZ 2QJ8A 3CCUZ 3PB6X 3RZAA 3FX6A 5T6BA 5IT9b 3PBBA 2BCOA 3MRUA 2H85A 3PO3I 2F8HA 5D1PA 1VQ41 3JAMb 3N5FA 3DLJA 4PPZA 2PJ9A 3CC4Z 4NGMA 3CCSZ 3K7AI 3LUSA 2QREB 1F57A 4R8FA 1Q862 3SI0A 1ZB8A 1S72Z 1WIIA 4A93I 3GTOI 1YJNZ 4WWVA 1QYPA 2NSMA 4X2TA 3IFEA 1I3QI 1Z5RA 3BI0A 3HUVA 3F3FC 1KC82 5JH9A 3SI1A 1P9NA 2Y0SA 1YJ91 4E31A 4DK1A 3SJXA 1N8R1 3S14I 2F7VA 4A3FI 4E2XA 2PJ2A 3J81f 2QLVB 1ARLA 2CF4A 1JWHC 3PBEA 2JUBA 1ZLIA 4K3NA 5K8PA 1Q7LA 3CXCZ 1VQOZ 3ESWA 3CCR1 4P44A 4F8ZA 3GTMI 4P4EA 3KASA 3CC21 2JS4A 4A3CI 1VQ51 1Y1VI 5IT9f 1LAMA 1RO4A 3IO1A 2XEIA 2NVYI 2PJ7A 2QKDA 4RVDA 4MONA 3CCEZ 3IJ3A 4DJLA 2PJBA 2OTJZ 1ZLHA 1K9M2 4A3LI 4NGNA 3CPXA 3D7GA 3GCFA 3I1UA 4ZYQA 2FVGA 4UEZA 1PFTA 3S1MI 3FJUA 2JA7I 2ZEOA 3CCL1 1VQK1 1Q7Y1 4R7MA 4FBEA 1VQ61 5A2Qb 1DL6A 1LAPA 2ZEHA 5C4XI 5T67A 1YSJA 3I561 1YIJ1 5D1OA 1H8LA 2EK9A 5C44I 4E2WA 4HH4A 1F2OA 3LMSA 5THWA 5HVGA 1JJ2Y 2M6NA 2R7ZI 5J1QA 1TWGI 4MH4A 5CBMA 2ZAEB 1KQSZ 3JRUA 4NJRA 3KQXA 2QRCB 3GLJA 1RNIA 3S17I 1NSAA 2KPIA 4NB9A 5HXDA 3TC8A 1QQ9A 3D7DA 4QTTA 4P4FA 1YI2Z 5IB9A 1ARMA 2DE7A 4DYOA 1YJ9Z 1M4LA 7CPAA 1WW9A 3NH4A 2C1CA 2JNYA 5AN9F 1VQM1 1XMBA 3MN8A 2QRDB 2JR6A 2AFOA 5LRJA 3S16I 2CTBA 3M4OI 3PO3S 3HOZI 2PVVA 3KR5A 3J80b 3MZLB 1Z01A 3CCRZ 2E9HA 5LRGA 4Z65A 1LCPA 3CC2Z 2XEJA 4P4JA 1ZH1A 1VQ5Z 4NGQA 5A2Qf 3VATA 4MCRA 1VQ91 1BAVA 2ZEFA 4A3II 3BXMA 4NOZA 1YMEA 2F4OA 3EERA 2GREA 3ISZA 4DUKA 2RHBA 3CPAA 3VH9A 1ZB9A 3CPWY 1VHOA 2PJ5A 3CMEZ 2ZEGA 4RUHA 1LANA 1VLAA 4DGLA 4NGSA 1NJI1 1LFWA 3CCLZ 3KIHA 1VQKZ 2P28A 1CG2A 5IP7I 3WC7A 2ZEMA 1QVFY 1VQ6Z 1ZG7A 3MONA 4CL1A 4OC5A 1RLYA 4OIWA 3I56Z 1YIJZ 2Q43A 1EE3P 1Y1WI 3GTMS 1K732 4NBEA 3VARA 3J81b 1Y1VS 1S7MA 3TE5B 3IF8A 4H2KA 3KGQA 1Q861 2K5RA 4P45A 5HVHA 4P4BA 3FKII 3FQQA 3BHXA 1Q822 3IEHA 2QYVA 1TXRA 1TWFI 2E2JI 1Q811 2IMOA 3B3WA 4IAVA 1KC81 3KHXA 1SFOI 5K8NA 3S9NA 1VQMZ 1Y0YA 4OIDA 2R92I 1L1OC 1X3WA 1KRLA 3EEDA 3KR4A 1DTDA 1FNOA 4JYWA 4PXDA 1QMUA 3TX8A 2ANPA 4BXXI 2GLJA 3SJGA 3B3VA 3B2YA 2OTL1 2PM9A 2AFWA 1VQ9Z 3S15I 3D66A 2ZEDA 1KD12 4YWYA 2OOYB 2V8GA 4UF4A 3WC5A 2E2HI 2ZOFA 4MHNA 4A3BI 1VHEA 2XEFA 5LL6f 1XJOA 3H3VJ 5LYDA 3IFUA 2PJ8A 3CMA1 2ZEEA 1K83I 2NVXI 1LQLA 3NH8A 3GTKI 4MMOA 4PXEA 1K9M1 2ZELA 4P6YA 3D7HA 4NBHA 2CTCA 4NB8A 5D8NA 1CPXA 4MCPA 2PJCA 3B3CA 3BG1B 1R9TI 2EK8A 3CCM1 3KQZA 4XX2A 2C6CA 3NA6A 4MCQA 5ELYA 3NDIA 4BY7I 1TKJA 2AFMA 2PJAA 1RTQA 3D9XA 1VQ81 5I4MA 1VQP1 3S1NI 1ML8A 2F4MA 2R6MA 1R3NA 2NVTI 2OZKA 3QWUA 4JZ0A 3B3TA 4NJQA 4PXBA 3KIFA 1W2BZ 3FECA 3M3YI 1HEEA 4X8IA 2E2II 4OC4A 2JMOA 2QEX1 2O53A 3CCQ1 1K8A2 1USPB 1XRYA 1VQ4Z 1LOKA 1CPSA 2PE3A 6CPAA 3IC1A 4MXUA 4UEEA 2B63I 3CCV1 4BBRI 3FMCA 4G1PA 4RVGA 4ZY2A 5LYFA 1GYTA 3WT4A 1RQFA 3PFOA 3RBUA 4NGRA 4AXVA 2YADA 2RFHA 4B6ZA 2OTLZ 2M48A 3CCJ1 3KHZA 4A3MI 3SJEA 2GTHA 4Y52I 2VUGA 5FLMI 3NDJA 2PJ3A 3IIBA 4GM5A 2K3RA 2DE5A 3CXCY 3KL9A 3S1RI 1ELMP 2AFSA 3CMAZ 3BI1A 1TWCI 3G6E1 3I07A 2DE6A 1USPA 3I4MI 3B3SA 2AFZA 4IHMA 4F9UA 4ONWA 2J6AA 3S2DI 2W04A 3PB9X 8CPAA 4PQAA 3T4NB 1Z2LA 3H8FA 3K2KA 2O4HA 1TWHI 1IGBA 4MD8A 4X3RA 3CCMZ 3FH4A 3KI9A 2WB1A 4EFDA 4NBFA 2JBKA 3HOUI 1M902 3RAMA 4NBGA 4OC2A 4WJBA 2EWBA 3VMHA 1VQ8Z 1YHQ1 3J7A4 3PEIA 5CPAA 1VQPZ 3FEDA 3F3PC 4A3DI 3PFEA 2POKA 1K731 2BJOA 2V8DA 2I3CA 3CC71 4E2ZA 1XFOA 2KI7B 2JEWA 3S1QI 1VQL1 4NBCA 3I4NI 1CX8A 2GLFA 3U50C 3K9TA 4P4IA 3WABA 2QEXZ 3S2HI 2IZ3A 3CCQZ 1Q821 2AFXA 1HDUA 4W9YA 1KQSY 1TF9A 2J9AA 4QTUA 3CD61 2RIQA 1F2PA 3QNVA 4O23A 1RO2A 1AMPA 2BOAA 4TNUA 1TFIA 1TKHA 1N2FA 1M1K2 2C6GA 3HOWI 3WC6A 3CCJZ 1HDQA 2IJZA 3T8WA 4NBBA 2C6PA 3GTJI 2VF1A 3DGVA 5IP9I 2JA6I 3VTNA 1CP7A 4Q7AA 1X0TA 5C3EI 3H8EA 2PJ4A 1KD11 4BD9A 4RVFA 5T64A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G9D A;  4KSI A;  2NYQ A;  3FF3 A;  2V8H A;  5LRK A;  1BPN A;  1UWY A;  5F09 A;  1OBR A;  4A37 A;  2ZEP A;  1CBX A;  2PRQ A;  4P4D A;  4ZY1 A;  2ZEN A;  3NFZ A;  4EME A;  3HLP A;  4OC1 A;  2GU2 A;  2CIJ A;  4R76 A;  1Y7E A;  4NGT A;  4CPA A;  4MHY A;  1R43 A;  3D4U A;  4EWT A;  1DE4 C;  3S9L A;  2AFU A;  3NH5 A;  2PJ1 A;  4FUU A;  3KZW A;  2VL1 A;  2ZOG A;  1Z8L A;  3CDX A;  4UIA A;  3SJF A;  3IWW A;  3H8G A;  3PB7 X;  1YLO A;  4A38 A;  4LQG A;  2ABZ A;  1KWM A;  1YW4 A;  2PIZ A;  4IK2 A;  1JQG A;  5K8O A;  1ZG8 A;  1FT7 A;  3PB4 X;  2BO9 A;  4UEF A;  3B35 A;  4A39 A;  1BLL E;  4MHP A;  4OP4 A;  1PYT B;  3D68 A;  2PVW A;  5D29 A;  3GUX A;  2XEG A;  3V38 A;  1Y0R A;  4YU9 A;  1ZG9 A;  5LYL A;  4OKO A;  3V7Z A;  4MRI A;  2DEA A;  3GB0 A;  3FVL A;  2OOT A;  1AYE A;  4UIB A;  1VGY A;  1BPM A;  2V77 A;  3CT9 A;  4A94 A;  5K8M A;  1TF8 A;  4OME A;  4TWE A;  5HVF A;  5LYI A;  2WZN A;  3SI2 A;  4ZY0 A;  2Q51 A;  5DS0 A;  2PJ6 A;  4FWU A;  4ZX9 A;  2PCU A;  2OR4 A;  5JM6 A;  2HB6 A;  1CP6 A;  2JBJ A;  2PIY A;  3S9M A;  4P10 A;  2WYR A;  1PCA A;  4R6T A;  4OC3 A;  2IQ6 A;  1IY7 A;  5JGF A;  4FAI A;  1YW6 A;  1ELL P;  4PXC A;  4OC0 A;  3PRT A;  4ZX8 A;  3D7F A;  3B7I A;  3ISX A;  3L2N A;  2QVP A;  4ZI6 A;  3LWU A;  4NFR A;  2V8V A;  1TKF A;  4F9V A;  2RB7 A;  2PJ0 A;  3FEE A;  3D67 A;  3PB8 X;  4MHZ A;  4NGP A;  2Q4Z A;  2HC9 A;  1XBU A;  4MCS A;  1VIX A;  2QJ8 A;  3PB6 X;  3RZA A;  3FX6 A;  3PBB A;  2BCO A;  3MRU A;  2F8H A;  3N5F A;  3DLJ A;  4PPZ A;  2PJ9 A;  4NGM A;  4R8F A;  1F57 A;  3SI0 A;  4WWV A;  2NSM A;  4X2T A;  3IFE A;  1Z5R A;  3BI0 A;  3HUV A;  5JH9 A;  3SI1 A;  3SJX A;  2F7V A;  2PJ2 A;  1ARL A;  2CF4 A;  3PBE A;  1ZLI A;  4K3N A;  5K8P A;  1Q7L A;  4P44 A;  4F8Z A;  4P4E A;  3KAS A;  1LAM A;  3IO1 A;  2XEI A;  2PJ7 A;  3IJ3 A;  4DJL A;  2PJB A;  1ZLH A;  4NGN A;  3CPX A;  3D7G A;  3I1U A;  4ZYQ A;  2FVG A;  4UEZ A;  3FJU A;  2ZEO A;  4R7M A;  4FBE A;  1LAP A;  2ZEH A;  1YSJ A;  1H8L A;  2EK9 A;  5THW A;  3LMS A;  5HVG A;  1F2O A;  5J1Q A;  5CBM A;  4NJR A;  3JRU A;  3KQX A;  3GLJ A;  1NSA A;  5HXD A;  3TC8 A;  1QQ9 A;  3D7D A;  4P4F A;  5IB9 A;  1ARM A;  4DYO A;  1M4L A;  7CPA A;  3NH4 A;  2C1C A;  1XMB A;  3MN8 A;  2AFO A;  5LRJ A;  2CTB A;  2PVV A;  3KR5 A;  5LRG A;  4Z65 A;  1LCP A;  2XEJ A;  4P4J A;  4NGQ A;  3VAT A;  4MCR A;  1BAV A;  2ZEF A;  3BXM A;  1YME A;  2GRE A;  3ISZ A;  4DUK A;  3CPA A;  3VH9 A;  1VHO A;  2PJ5 A;  4RUH A;  2ZEG A;  1LAN A;  4NGS A;  1LFW A;  1CG2 A;  3WC7 A;  2ZEM A;  1ZG7 A;  4OC5 A;  4OIW A;  2Q43 A;  1EE3 P;  3VAR A;  4H2K A;  3KGQ A;  4P45 A;  5HVH A;  4P4B A;  3BHX A;  3IEH A;  2QYV A;  1TXR A;  2IMO A;  3B3W A;  4IAV A;  3KHX A;  5K8N A;  3S9N A;  4OID A;  1Y0Y A;  3KR4 A;  1DTD A;  1FNO A;  4JYW A;  4PXD A;  1QMU A;  3TX8 A;  2ANP A;  2GLJ A;  3SJG A;  3B3V A;  3B2Y A;  2AFW A;  3D66 A;  2ZED A;  4YWY A;  4UF4 A;  2V8G A;  3WC5 A;  2ZOF A;  4MHN A;  1VHE A;  2XEF A;  1XJO A;  5LYD A;  2PJ8 A;  2ZEE A;  3NH8 A;  4MMO A;  4PXE A;  4P6Y A;  2ZEL A;  3D7H A;  2CTC A;  5D8N A;  1CPX A;  4MCP A;  2PJC A;  3B3C A;  2EK8 A;  3KQZ A;  2C6C A;  3NA6 A;  4MCQ A;  5ELY A;  1TKJ A;  2AFM A;  2PJA A;  1RTQ A;  5I4M A;  1R3N A;  4JZ0 A;  4PXB A;  3B3T A;  4NJQ A;  3FEC A;  1HEE A;  4X8I A;  4OC4 A;  2O53 A;  1XRY A;  1LOK A;  1CPS A;  2PE3 A;  6CPA A;  3IC1 A;  4MXU A;  4UEE A;  4G1P A;  3FMC A;  4ZY2 A;  5LYF A;  1GYT A;  3WT4 A;  3PFO A;  3RBU A;  4NGR A;  4AXV A;  2RFH A;  4B6Z A;  3KHZ A;  3SJE A;  2PJ3 A;  3IIB A;  4GM5 A;  3KL9 A;  1ELM P;  2AFS A;  3BI1 A;  3B3S A;  4F9U A;  2AFZ A;  4IHM A;  4ONW A;  3PB9 X;  8CPA A;  4PQA A;  1Z2L A;  3H8F A;  3K2K A;  2O4H A;  1IGB A;  4X3R A;  3KI9 A;  3FH4 A;  4EFD A;  2JBK A;  3RAM A;  4OC2 A;  4WJB A;  2EWB A;  3PEI A;  5CPA A;  3FED A;  3PFE A;  2POK A;  2V8D A;  2I3C A;  1XFO A;  2JEW A;  1CX8 A;  3K9T A;  2GLF A;  4P4I A;  3WAB A;  2AFX A;  1HDU A;  4W9Y A;  1TF9 A;  2J9A A;  1F2P A;  3QNV A;  4O23 A;  1AMP A;  2BOA A;  4TNU A;  1TKH A;  2C6G A;  3WC6 A;  1HDQ A;  2IJZ A;  3T8W A;  2C6P A;  3DGV A;  4Q7A A;  1CP7 A;  3H8E A;  2PJ4 A;  4BD9 A; 
#chains in the Genus database with same CATH topology
 2G9D A;  4FD5 A;  2Q4Y A;  1BPN A;  1YIT 1;  4KOU A;  2EUI A;  1CBX A;  1K4J A;  4ZY1 A;  1YHQ Z;  3NFZ A;  1B6B A;  4NF1 A;  3HLP A;  1Z03 A;  4S1T A;  3CQZ I;  1Y7E A;  3IX0 A;  4CPA A;  4NCZ A;  3D4U A;  5I0C A;  3GTP I;  3LD2 A;  2PSW A;  2LFU A;  2NMT A;  2PQ8 A;  3KZW A;  5AG6 A;  1Y9W A;  3TE4 A;  5FLX f;  1Z8L A;  2QR1 B;  4HPS A;  3SJF A;  4C7H A;  1Z8T A;  3GIU A;  3H8G A;  3PB7 X;  1YLO A;  4LQG A;  2PIZ A;  4IK2 A;  5KTA A;  5CM2 M;  1N8R 2;  4UEF A;  3B35 A;  1BLL E;  4OP4 A;  2QA4 Z;  3D68 A;  2B4D B;  5D29 A;  3GUX A;  1Z4R A;  1YUA A;  2BSW A;  1M90 1;  1Z4E A;  1Y0R A;  2V8J A;  1ZG9 A;  4OKO A;  3SHP A;  4MD7 A;  3IR7 A;  4MRI A;  2DEA A;  3GB0 A;  1A2Z A;  1VQ7 Z;  3FVL A;  2F5I A;  4A94 A;  4TWE A;  3D2P A;  2B4D A;  2Q51 A;  5DS0 A;  4RVH A;  2PJ6 A;  4ZX9 A;  1M4D A;  2VPW A;  1CP6 A;  2JBJ A;  2PIY A;  1S72 1;  4UFW A;  2WUU A;  1PCA A;  1WJ2 A;  3CCV Z;  4CAX A;  2VPX A;  3PRT A;  4ZX8 A;  3HKZ A;  1AUG A;  1Z8X A;  1Q2C A;  4ZI6 A;  4F9V A;  4NH1 C;  1VQO 1;  2CXA A;  2VUM I;  2ZW6 A;  2RB7 A;  4A3G I;  1I6H I;  1M1D A;  3G6E Z;  4BBH A;  3FEE A;  5J8F A;  3D67 A;  3CCE 1;  3PB8 X;  4MHZ A;  3J80 f;  3VMG A;  3FX6 A;  4UWI A;  3F0A A;  2F8H A;  1VQ4 1;  4PPZ A;  3K7A I;  2Z11 A;  2OU2 A;  2QRE B;  1F57 A;  1FY7 A;  1S7K A;  4X2T A;  2YNC A;  2OZG A;  5JH9 A;  3SI1 A;  2PR8 A;  4E31 A;  4E2X A;  2H5M A;  2QLV B;  3PBE A;  2JUB A;  1ZLI A;  5BWA B;  3CXC Z;  2OZU A;  4OLL A;  5IT9 f;  4H6U A;  3IJ3 A;  4DJL A;  2OTJ Z;  1K9M 2;  2GIV A;  2Q7B A;  4XPD C;  3CPX A;  3I1U A;  1VQK 1;  2P0W A;  1LAP A;  2ZEH A;  1YR0 A;  4R87 A;  4KOV A;  5D1O A;  4HH4 A;  4M85 A;  4NSQ A;  2P6E A;  4MH4 A;  1I12 A;  3D2M A;  2QRC B;  1XMT A;  1NSA A;  1Y9K A;  3TC8 A;  4P4F A;  1ARM A;  2DE7 A;  1M4L A;  7CPA A;  2C1C A;  2JNY A;  1Q16 A;  1XMB A;  2QRD B;  2JR6 A;  2AFO A;  3S16 I;  2CTB A;  2PVV A;  4Z65 A;  1LCP A;  3CC2 Z;  2XEJ A;  1VQ5 Z;  3QAY A;  1BAV A;  4A3I I;  3BXM A;  1YME A;  2F4O A;  4CAE A;  2D4O A;  2PJ5 A;  1IYK A;  4NGS A;  1LFW A;  2R8V A;  3CCL Z;  5IP7 I;  3MON A;  1RLY A;  3I56 Z;  1IID A;  1Y1W I;  3VAR A;  4CS0 B;  2JLM A;  3IF8 A;  3KGQ A;  1Q86 1;  2K5R A;  4P4B A;  3FKI I;  3BHX A;  3IEH A;  1TXR A;  1TWF I;  1KC8 1;  3KHX A;  1SFO I;  1VQM Z;  4OID A;  5ISV A;  2R92 I;  4CGO A;  1L1O C;  1X3W A;  1KRL A;  3EED A;  4JYW A;  4PXD A;  3SXN A;  2AYD A;  4BXX I;  2AFW A;  1KD1 2;  4YWY A;  4B11 A;  4MHN A;  2XEF A;  5LL6 f;  3H3V J;  3IFU A;  2ZEE A;  4XNH C;  3GTK I;  4MMO A;  4P6Y A;  2CTC A;  3CXP A;  3B3C A;  2ARH A;  3TTH A;  2EK8 A;  4XX2 A;  3NA6 A;  4MCQ A;  1TKJ A;  4B13 A;  4KUA A;  4BIN A;  3S1N I;  2F4M A;  4MI4 A;  4CRZ B;  3FEC A;  3IWG A;  1HEE A;  2EVN A;  1LOK A;  3CCV 1;  4BBR I;  4RVG A;  1NSL A;  5LYF A;  4Y49 B;  2HQY A;  4B6Z A;  2OTL Z;  3KHZ A;  2GTH A;  2PJ3 A;  3NDJ A;  3RYO A;  4MJ8 A;  2DPS A;  5EC4 A;  1S7N A;  3BI1 A;  3G6E 1;  3B3S A;  4IHM A;  4ONW A;  3PB9 X;  1J4J A;  4QC6 A;  3JVN A;  2K5T A;  4FD7 A;  2X7B A;  4UFV A;  1M90 2;  2ODF A;  5CPA A;  5J8C A;  4A3D I;  4E2Z A;  2D4P A;  5C88 A;  2G0B A;  1CX8 A;  3K9T A;  3WAB A;  4AVC A;  4MHD A;  2HUZ A;  2CNM A;  4KOS A;  3CD6 1;  4B5P B;  2RIQ A;  1AMP A;  1AA6 A;  2C6G A;  3TOB A;  1HDQ A;  2IJZ A;  3T8W A;  3GTJ I;  2VF1 A;  1RXT A;  5HMN A;  1CP7 A;  4BD9 A;  3SXO A;  4RVF A;  5T64 A;  1BO4 A;  4C2Z A;  2R93 I;  4B5P A;  3G71 1;  4H6Z A;  2NYQ A;  5LRK A;  3I55 1;  3Q87 A;  4PV6 A;  3VWD A;  2JA5 I;  4X6A I;  2AKL A;  4P4D A;  4EME A;  3MGD A;  4KS9 A;  2GU2 A;  4E2A A;  1I50 I;  1VQL Z;  1R43 A;  3TDH B;  3R95 A;  3HOY I;  4M6I A;  1Q81 2;  1K8A 1;  3EO4 A;  4FUU A;  4BBS I;  4K30 A;  1YVO A;  1ON0 A;  4A30 A;  2WPW A;  4UIA A;  1NP6 A;  3D6W A;  3OW2 Z;  4A38 A;  4Y7N I;  2RPR A;  2DXQ A;  2WAQ A;  1VQN 1;  1IB1 E;  1FT7 A;  2BEI A;  3PB4 X;  3FB3 A;  5F46 A;  4MHP A;  1PYT B;  4RS4 A;  4AYB A;  4FD6 A;  2YGW A;  1X3Z A;  1QVG Z;  2VZZ A;  2QML A;  5A28 A;  4R3L A;  2GTI A;  4UCP A;  4YU9 A;  4A95 A;  4DQY B;  4MD9 A;  4X5K A;  2OOX B;  1GHE A;  2OOT A;  1AYE A;  4UIB A;  1BPM A;  3CT9 A;  4BY1 I;  4E8O A;  3CCU 1;  1TF8 A;  4OME A;  1FDO A;  5HVF A;  2WZN A;  5G21 A;  4ZY0 A;  1W2B Y;  5C4J I;  1U6M A;  3TT2 A;  3D8P A;  3FIX A;  2PCU A;  3CC4 1;  4HGY A;  3S9M A;  1YJN 1;  2WYR A;  2HU9 A;  4A31 A;  4OC3 A;  1NUI A;  4KZT A;  3G4S Z;  4UFX A;  1IY7 A;  1YW6 A;  5JPH A;  4A3K I;  4OC0 A;  2PMZ A;  3ISX A;  2I00 A;  2QVP A;  4NFR A;  2V8V A;  4R57 A;  2FXF A;  2PJ0 A;  5A27 A;  3CXQ A;  4B12 A;  4KUB A;  4MFP A;  3W6S A;  4CGP A;  2HC9 A;  2NVQ I;  2IZ4 A;  2V8K A;  1VIX A;  1YJW Z;  2QJ8 A;  3PB6 X;  3RZA A;  2OZH A;  3K9U A;  3JTK A;  2BCO A;  3MRU A;  2H85 A;  4C2Y A;  1XIX A;  1Z8W A;  3JAM b;  4NGM A;  3CCS Z;  3NE7 A;  4R8F A;  1Q86 2;  3SI0 A;  4A93 I;  3H4Q A;  1B87 A;  3CXS A;  3HUV A;  1KC8 2;  1P9N A;  1YJ9 1;  2J8R A;  4DK1 A;  3SJX A;  4CGN A;  4C2X A;  1MJ9 A;  1ARL A;  1JWH C;  4U9Y A;  1NMT A;  5K8P A;  1KUV A;  4P44 A;  4P4E A;  4JWP A;  3TO7 A;  2JS4 A;  1Y1V I;  3IO1 A;  2QKD A;  1ZLH A;  4CGL A;  2LEX A;  2JA7 I;  1SIW A;  1Q7Y 1;  4R7M A;  3EY5 A;  5DWM A;  5A2Q b;  1YVK A;  2O28 A;  1N71 A;  2YNC C;  1YIJ 1;  2P6G A;  4PK2 A;  1H8L A;  3F5B A;  4CAV A;  4NJR A;  3JRU A;  3GLJ A;  5HXD A;  5EBV A;  4NB9 A;  3D7D A;  4DYO A;  2AE6 A;  4EVY A;  3MN8 A;  5F49 A;  5LRJ A;  4NXY A;  3KR5 A;  1XOV A;  4F0X A;  4KOR A;  3CCR Z;  2E9H A;  3V8I A;  4P4J A;  4NGQ A;  3TO6 A;  5JQ4 A;  1VQ9 1;  2ZEF A;  4NOZ A;  5F48 A;  1QSM A;  3EER A;  3ISZ A;  4OAD A;  2V3V A;  1NJI 1;  1XEB A;  3KIH A;  1VQ6 Z;  1R57 A;  4J3G A;  4CRY B;  3F8K A;  4NBE A;  1Y1V S;  3H5Z A;  2BUE A;  4H2K A;  1I1D A;  5HVH A;  2IV2 X;  2B58 A;  2CNT A;  1Q81 1;  3VWE A;  2JIQ A;  1WK4 A;  2IMO A;  5K8N A;  1Y0Y A;  4CYO A;  1DTD A;  4XPL A;  4QBJ A;  1OZP A;  3TX8 A;  2GLJ A;  2QEC A;  1Z9U A;  2VPY A;  4HNX B;  3D66 A;  4UF4 A;  2V8G A;  2E2H I;  1VHE A;  1XJO A;  5LYD A;  3CMA 1;  2NVX I;  2FIA A;  2ZEL A;  4KLW A;  4NBH A;  4NB8 A;  4CAF A;  4KOW A;  1CPX A;  2PJC A;  1R9T I;  3CCM 1;  4QB9 A;  4KVO E;  2AFM A;  4PSW A;  1RTQ A;  5AG4 A;  4JJX A;  1S60 A;  1VQ8 1;  1VQP 1;  1R3N A;  4PXB A;  1W2B Z;  3M3Y I;  4B5O A;  5AGE A;  5HH1 A;  2JMO A;  2QEX 1;  2O53 A;  1K8A 2;  1XRY A;  4UEE A;  4ZY2 A;  3WR7 A;  3WT4 A;  4U5Y A;  4I49 A;  4M3S A;  3RBU A;  2JDC A;  4PK3 A;  2RFH A;  2M48 A;  2Q04 A;  4A3M I;  3SJE A;  2VUG A;  5FLM I;  4RN7 A;  2K3R A;  3KL9 A;  3S1R I;  1TWC I;  3I07 A;  5H84 A;  4FD4 A;  4F9U A;  2YND A;  2J6A A;  4M6H A;  4PQA A;  3H8F A;  1V0C A;  3K2K A;  4MD8 A;  3FH4 A;  4NBF A;  3HOU I;  2EWB A;  4ORF A;  1YHQ 1;  3F3P C;  1K73 1;  2I3C A;  1KUY A;  3S1Q I;  4HKF A;  4NBC A;  3I4N I;  3U50 C;  3CCQ Z;  1JWQ A;  1Q82 1;  3S6G A;  1TF9 A;  4QTU A;  2R1I A;  3IU2 A;  3QNV A;  4O23 A;  4TNU A;  1S7L A;  2FIW A;  3HOW I;  4NEX A;  3CCJ Z;  1XF8 A;  3B8G A;  4RS2 A;  4NBB A;  3VTN A;  1YRE A;  4PSX A;  4XPD B;  1X0T A;  1UFH A;  3GYA A;  3GTG I;  4JD6 A;  4KSI A;  3GY9 A;  1UWY A;  4C68 A;  2QA4 1;  1OBR A;  2HF1 A;  4AVB A;  2ZEP A;  2PRQ A;  2ZEN A;  4A3J I;  3R1K A;  2W03 A;  3CC7 Z;  2EO8 A;  2CIJ A;  4R76 A;  4Q38 A;  1VQ7 1;  3LAC A;  4EWC A;  2VPZ A;  3RNZ A;  3S9L A;  3PGP A;  2AFU A;  3I3G A;  3NH5 A;  2PJ1 A;  1TWA I;  3CDX A;  4E2Y A;  4MFQ A;  2GFQ A;  4II9 A;  5K8O A;  3JAM f;  4NBD A;  4A39 A;  2Q4V A;  4E30 A;  4MFL A;  4RV9 A;  4KVX A;  1YIT Z;  2JIM A;  3VMI A;  3D2L A;  2B3V A;  2XEG A;  4YFJ A;  2OH1 A;  3VB9 A;  1CJW A;  3V7Z A;  3S6K A;  1Z02 A;  3BG0 B;  4OAE A;  4UWJ A;  3KKW A;  1PUA A;  1Q7Y 2;  1VGY A;  2G2K A;  2V77 A;  1L0C A;  5LYI A;  3SI2 A;  4KOY A;  3RZD I;  5IX3 A;  4UCN A;  4FWU A;  2OR4 A;  1IU8 A;  5JM6 A;  1M1K 1;  4P10 A;  4YRH A;  4XNH B;  2OB0 A;  3N7Z A;  2WPX A;  1ELL P;  2PDO A;  4M6G A;  3D7F A;  3B7I A;  2JA8 I;  3PO2 I;  3L2N A;  4HGZ A;  3LWU A;  1QSN A;  1QSR A;  2GE3 A;  3GTQ I;  3W91 A;  2OTJ 1;  2Q4Z A;  3HOV I;  1NJI 2;  1YUK A;  2J8M A;  5IT9 b;  3PBB A;  3N5F A;  4MBU A;  2PJ9 A;  3A9L A;  4A32 A;  1S72 Z;  3GTO I;  4WWV A;  1QYP A;  1Z5R A;  4AG9 A;  3BI0 A;  4GS4 A;  3F3F C;  1NE9 A;  4UBR A;  4MFJ A;  2F7V A;  3S14 I;  2ATR A;  5E96 A;  1VQO Z;  4AB7 A;  2P6F A;  5KTC A;  3GTM I;  1VKC A;  3CC2 1;  1VQ5 1;  2XEI A;  2NVY I;  2PJ7 A;  4LX9 A;  4MON A;  3CCE Z;  2PJB A;  4A3L I;  3G3S A;  2Z3M A;  3GCF A;  2FVG A;  2IL4 A;  5G22 A;  3S1M I;  3FJU A;  4LUA A;  2ZEO A;  3CCL 1;  1DL6 A;  4DNC A;  2DF5 A;  5C4X I;  1YSJ A;  3I56 1;  3FBU A;  5C44 I;  4E2W A;  3LMS A;  1F2O A;  2B5G B;  1YLE A;  5HVG A;  2JDD A;  1JJ2 Y;  2M6N A;  5J1Q A;  1TWG I;  2ZAE B;  3KQX A;  1RNI A;  2KPI A;  2G3T A;  1QQ9 A;  1YI2 Z;  3R9E A;  3NH4 A;  5AG5 A;  1VQM 1;  1VHS A;  4C7I A;  3M4O I;  1Z01 A;  2B5G A;  2EBJ A;  2J8N A;  4QUS A;  3VAT A;  4MCR A;  4CYQ A;  4F0Y A;  3FNC A;  2RC4 A;  2Q44 A;  4DUK A;  2RHB A;  1S3Z A;  3VH9 A;  3CPW Y;  3CME Z;  2ZEG A;  1VLA A;  4DGL A;  2BL1 A;  2KCW A;  3TOA A;  1VQK Z;  1CG2 A;  2ZEM A;  1QVF Y;  1ZG7 A;  4CL1 A;  1LRZ A;  4OIW A;  2Z3N A;  2Q43 A;  4KOT A;  1EE3 P;  2I79 A;  3GTM S;  1K73 2;  3J81 b;  3LOD A;  3PP9 A;  1SQH A;  2CY2 A;  1S7F A;  4P45 A;  4XPK A;  3FQQ A;  3TO9 A;  1Q82 2;  2QYV A;  3JUW A;  3B3W A;  4IAV A;  4CGM A;  4CAW A;  4A33 A;  3KR4 A;  3I9S A;  4E0A A;  2R98 A;  4F6A A;  3SJG A;  3B3V A;  3IGR A;  2VEZ A;  2OTL 1;  3S15 I;  4B10 A;  2ZED A;  2OOY B;  2VI7 A;  4A3B I;  4Q36 A;  1K83 I;  3NH8 A;  3FRM A;  3R9G A;  1QST A;  2Y0M A;  3BG1 B;  1IOI A;  4R3K A;  3KQZ A;  2C6C A;  2FSR A;  3D9X A;  3EFA A;  1ML8 A;  2VQY A;  2NVT I;  1M44 A;  2HV2 A;  3QWU A;  3B3T A;  3FXT A;  3KIF A;  4X8I A;  1XE4 A;  2E2I I;  6CPA A;  3IC1 A;  1P4N A;  4MXU A;  2B63 I;  3FMC A;  1GYT A;  3ZJ0 A;  1YK3 A;  2YAD A;  3RO0 A;  3IIB A;  3OWC A;  4L89 A;  3G8W A;  4ONU A;  1ELM P;  2AFS A;  3I4M I;  3S2D I;  3T4N B;  1IGB A;  1TWH I;  4MFK A;  4X3R A;  2WB1 A;  2JBK A;  1IOF A;  4YGO A;  3RAM A;  3VMH A;  4B14 A;  3J7A 4;  3PEI A;  3FED A;  3PFE A;  2POK A;  2BJO A;  3DNS A;  3NE8 A;  2JEW A;  1VQL 1;  2GLF A;  3DR8 A;  4P4I A;  3S2H I;  2IZ3 A;  3PZJ A;  4A2Z A;  2AFX A;  2REF A;  1HDU A;  4W9Y A;  1KQS Y;  3EC4 A;  2FE7 A;  2J9A A;  4CYP A;  4KSF A;  2BOA A;  1TFI A;  1TKH A;  1M1K 2;  2JIP A;  2Z3K A;  1MJB A;  5EMI A;  3WC6 A;  4Q7A A;  1I21 A;  5C3E I;  3H8E A;  4U9Z A;  2PJ4 A;  1X12 A;  1QF8 A;  2RT9 A;  1RO0 A;  3FF3 A;  2V8H A;  5F09 A;  4A37 A;  4NBA A;  2PK7 A;  4OC1 A;  3MZK B;  4NGT A;  4MHY A;  4EWT A;  4MFZ A;  3S6F A;  1KZF A;  5KTD A;  5FVJ A;  1JJ2 Z;  1DE4 C;  1YI2 1;  3CD6 Z;  4RI1 A;  4JXQ A;  2VL1 A;  2ZOG A;  3QAH A;  1WCM I;  3IWW A;  1TIQ A;  3RZO I;  2PC1 A;  3BJ7 A;  5D1O B;  2ABZ A;  1KWM A;  1YW4 A;  3G4S 1;  1JQG A;  4KVM E;  1ZG8 A;  1BOB A;  2E7Z A;  2BO9 A;  3G71 Z;  2R7H A;  3I55 Z;  4MY0 A;  3CME 1;  2PVW A;  4UCM A;  3FQM A;  2Z3O A;  3CPW Z;  3V38 A;  3DSB A;  3TFY A;  5LYL A;  1RO5 A;  1QVF Z;  3R96 A;  2LIY A;  2G3A A;  2FL4 A;  2P3Y A;  3T90 A;  3HOX I;  2JEV A;  1YJW 1;  5K8M A;  3P5J B;  4E33 A;  5AG7 A;  4KOX A;  3H0G I;  1ZO0 A;  2EGT A;  3OW2 Y;  2HB6 A;  3GKQ A;  3CCS 1;  2ZW4 A;  3DDD A;  1CM0 A;  3D3S A;  4R6T A;  3BLN A;  2IQ6 A;  1VQN Z;  5JGF A;  4FAI A;  5G1Z A;  4HNW B;  4PXC A;  1FDI A;  1QVG Y;  4IUS A;  2YU9 I;  4CYN A;  2VXK A;  2RBL A;  4AG7 A;  1TKF A;  2PR1 A;  5H86 A;  2Z0Z A;  2PRB A;  4KSA A;  2C27 A;  4Y49 C;  4A3E I;  5DWN A;  2V8I A;  4E32 A;  1YQE A;  2Z10 A;  5FLX b;  4NGP A;  3GTL I;  1XBU A;  4MCS A;  5G20 A;  3CCU Z;  2QIR A;  5T6B A;  2DPT A;  3PO3 I;  5D1P A;  3DLJ A;  3CC4 Z;  3LUS A;  5C82 A;  1ZB8 A;  1WII A;  3TCV A;  1YJN Z;  2NSM A;  3GKR A;  3IFE A;  1I3Q I;  5F47 A;  2Y0S A;  4H89 A;  1N8R 1;  4A3F I;  4JXR A;  2PJ2 A;  3J81 f;  2CF4 A;  3CZX A;  2ZW5 A;  1M4G A;  2NAP A;  2WSA A;  1Q7L A;  4K3N A;  4ZBG A;  1WWZ A;  3ESW A;  3CCR 1;  2Z3P A;  2FT0 A;  4F8Z A;  3KAS A;  3BJ8 A;  4A3C I;  3T9Y A;  2B3U A;  1LAM A;  1RO4 A;  4RVD A;  3EXN A;  2A4N A;  2JIO A;  4NGN A;  5IB0 A;  3D7G A;  1KUX A;  4ZYQ A;  4UEZ A;  1PFT A;  4FBE A;  1VQ6 1;  1Y7R A;  5T67 A;  2FCK A;  4AVA A;  5IV0 A;  2EK9 A;  2ZPA A;  5THW A;  2R7Z I;  4UA3 A;  5CBM A;  1KQS Z;  2Q0Y A;  2CNS A;  3S17 I;  4GXH A;  4QTT A;  5IB9 A;  4JLY A;  1YJ9 Z;  1WW9 A;  5AN9 F;  4QVT A;  3PO3 S;  3HOZ I;  3J80 b;  3MZL B;  5LRG A;  3IU1 A;  3P2H A;  2JIR A;  1ZH1 A;  5A2Q f;  1Q2D A;  5CNP A;  1M4I A;  2GRE A;  3CPA A;  1Q2Y A;  1ZB9 A;  1S5K A;  1VHO A;  2Z3L A;  4RUH A;  1LAN A;  3ZZI A;  2P28 A;  3WC7 A;  4R9M A;  4OC5 A;  1YX0 A;  1YIJ Z;  1S7M A;  3TE5 B;  2Q7S A;  3QB8 A;  4IF5 A;  3S6H A;  2YNE A;  2E2J I;  4KLV A;  3S9N A;  5GCN A;  4BMH A;  1MJA A;  1FNO A;  1QMU A;  1PU9 A;  2AJ6 A;  2ANP A;  1Y8C A;  1YGH A;  3B2Y A;  2GAN A;  2PM9 A;  1VQ9 Z;  3R9F A;  1QSO A;  3WC5 A;  2ZOF A;  2PJ8 A;  1LQL A;  3W6X A;  4PXE A;  1K9M 1;  3D7H A;  5D8N A;  4MCP A;  3C26 A;  4HNY B;  5ELY A;  3NDI A;  4BY7 I;  2PJA A;  5I4M A;  2R6M A;  1MK4 A;  2OZK A;  4JZ0 A;  4NJQ A;  4OC4 A;  3CCQ 1;  2REE A;  1USP B;  3UY5 A;  1VQ4 Z;  1CPS A;  2PE3 A;  4G1P A;  3P2F A;  3DR6 A;  1RQF A;  3PFO A;  1IYL A;  2B4B A;  4NGR A;  4AXV A;  4LQ6 A;  1WZN A;  3CCJ 1;  3IWE A;  4Y52 I;  4GM5 A;  2DE5 A;  3CXC Y;  4L8A A;  3CMA Z;  2DE6 A;  1USP A;  1X10 A;  2AFZ A;  2W04 A;  8CPA A;  1Z2L A;  2O4H A;  2V45 A;  3CCM Z;  3KI9 A;  4EFD A;  4NBG A;  4OC2 A;  4WJB A;  1P0H A;  1VQ8 Z;  1VQP Z;  2V8D A;  3CC7 1;  1XFO A;  2KI7 B;  4ZGY B;  1IIC A;  2VZY A;  2QEX Z;  1QXF A;  1F2P A;  2FS5 A;  1RO2 A;  2VBQ A;  3E0K A;  1N2F A;  2ZXV A;  3DGV A;  2C6P A;  4MY3 A;  5IP9 I;  2JA6 I;  3FYN A;  1KD1 1;  2ZW7 A; 
#chains in the Genus database with same CATH homology
 3GTG I;  1QF8 A;  2RT9 A;  2R93 I;  2G9D A;  4KSI A;  1RO0 A;  3G71 1;  2NYQ A;  3FF3 A;  2V8H A;  5LRK A;  3I55 1;  3Q87 A;  1BPN A;  1UWY A;  5F09 A;  2QA4 1;  1YIT 1;  2JA5 I;  4X6A I;  1OBR A;  2AKL A;  2HF1 A;  4A37 A;  2ZEP A;  1CBX A;  4NBA A;  2PRQ A;  1YHQ Z;  4P4D A;  4ZY1 A;  2ZEN A;  3NFZ A;  4A3J I;  4EME A;  2W03 A;  2PK7 A;  3CC7 Z;  3HLP A;  4OC1 A;  3MZK B;  2GU2 A;  1Z03 A;  4S1T A;  2CIJ A;  4R76 A;  1I50 I;  3CQZ I;  1Y7E A;  3IX0 A;  4NGT A;  4CPA A;  1VQL Z;  4MHY A;  1R43 A;  3TDH B;  3D4U A;  3GTP I;  3HOY I;  4EWT A;  1VQ7 1;  1Q81 2;  1JJ2 Z;  4EWC A;  2LFU A;  1K8A 1;  1DE4 C;  1YI2 1;  3S9L A;  3CD6 Z;  2AFU A;  3NH5 A;  2PJ1 A;  4FUU A;  3KZW A;  4BBS I;  1TWA I;  5FLX f;  2VL1 A;  2ZOG A;  1Z8L A;  3CDX A;  2QR1 B;  4E2Y A;  4UIA A;  3SJF A;  1WCM I;  3IWW A;  3RZO I;  1NP6 A;  3D6W A;  3H8G A;  3PB7 X;  1YLO A;  3OW2 Z;  4A38 A;  4LQG A;  5D1O B;  4Y7N I;  2ABZ A;  1KWM A;  1YW4 A;  2RPR A;  2PIZ A;  4IK2 A;  2WAQ A;  5CM2 M;  3G4S 1;  1N8R 2;  1VQN 1;  1JQG A;  1ZG8 A;  5K8O A;  3JAM f;  1FT7 A;  4NBD A;  3PB4 X;  2BO9 A;  3G71 Z;  4UEF A;  3I55 Z;  3B35 A;  4A39 A;  4E30 A;  4RV9 A;  1BLL E;  3CME 1;  2QA4 Z;  1YIT Z;  4MHP A;  4OP4 A;  1PYT B;  3D68 A;  4RS4 A;  3VMI A;  2PVW A;  4AYB A;  5D29 A;  3GUX A;  3FQM A;  1X3Z A;  1QVG Z;  1YUA A;  2XEG A;  3CPW Z;  3V38 A;  1M90 1;  2GTI A;  1Y0R A;  2V8J A;  4YU9 A;  1ZG9 A;  3VB9 A;  5LYL A;  4OKO A;  1QVF Z;  3V7Z A;  4DQY B;  4MD7 A;  4MD9 A;  1Z02 A;  3BG0 B;  2LIY A;  2OOX B;  4MRI A;  2DEA A;  3GB0 A;  3FVL A;  1VQ7 Z;  2OOT A;  2P3Y A;  1Q7Y 2;  3HOX I;  1AYE A;  4UIB A;  1VGY A;  1BPM A;  2G2K A;  1YJW 1;  4BY1 I;  2V77 A;  3CT9 A;  4A94 A;  5K8M A;  3CCU 1;  3P5J B;  4E33 A;  1TF8 A;  4OME A;  4TWE A;  5HVF A;  5LYI A;  2WZN A;  3SI2 A;  4ZY0 A;  2Q51 A;  1W2B Y;  5DS0 A;  3H0G I;  4RVH A;  5C4J I;  3RZD I;  2EGT A;  3OW2 Y;  2PJ6 A;  4FWU A;  4ZX9 A;  2PCU A;  3CC4 1;  2OR4 A;  5JM6 A;  2HB6 A;  3GKQ A;  3CCS 1;  4HGY A;  1CP6 A;  2JBJ A;  2PIY A;  1M1K 1;  3S9M A;  1S72 1;  4P10 A;  1YJN 1;  2WYR A;  2HU9 A;  1PCA A;  4R6T A;  4OC3 A;  1NUI A;  2IQ6 A;  3G4S Z;  1VQN Z;  1IY7 A;  5JGF A;  4FAI A;  3CCV Z;  1YW6 A;  4A3K I;  1ELL P;  4PXC A;  4OC0 A;  3PRT A;  4ZX8 A;  1QVG Y;  3HKZ A;  3D7F A;  3B7I A;  2JA8 I;  2YU9 I;  2RBL A;  2PMZ A;  3PO2 I;  3ISX A;  3L2N A;  2QVP A;  4ZI6 A;  4HGZ A;  3LWU A;  4NFR A;  2V8V A;  4NH1 C;  1VQO 1;  1TKF A;  4F9V A;  2VUM I;  3GTQ I;  2RB7 A;  2PJ0 A;  4A3G I;  4A3E I;  1I6H I;  2V8I A;  4E32 A;  3G6E Z;  5FLX b;  3FEE A;  3D67 A;  3CCE 1;  3PB8 X;  4MHZ A;  4NGP A;  2OTJ 1;  2Q4Z A;  2HC9 A;  3HOV I;  3GTL I;  1NJI 2;  2IZ4 A;  3J80 f;  3VMG A;  2NVQ I;  1XBU A;  1YUK A;  2V8K A;  1VIX A;  4MCS A;  1YJW Z;  2QJ8 A;  3CCU Z;  3PB6 X;  3RZA A;  3FX6 A;  5T6B A;  5IT9 b;  3PBB A;  2BCO A;  3MRU A;  2H85 A;  3PO3 I;  2F8H A;  5D1P A;  1VQ4 1;  3JAM b;  3N5F A;  3DLJ A;  4PPZ A;  2PJ9 A;  3CC4 Z;  4NGM A;  3CCS Z;  3K7A I;  3LUS A;  2QRE B;  1F57 A;  4R8F A;  1Q86 2;  3SI0 A;  1ZB8 A;  1S72 Z;  1WII A;  4A93 I;  3GTO I;  1YJN Z;  4WWV A;  1QYP A;  2NSM A;  4X2T A;  3IFE A;  1I3Q I;  1Z5R A;  3BI0 A;  3HUV A;  3F3F C;  1KC8 2;  5JH9 A;  3SI1 A;  1P9N A;  2Y0S A;  1YJ9 1;  4E31 A;  4DK1 A;  3SJX A;  1N8R 1;  3S14 I;  2F7V A;  4A3F I;  4E2X A;  2PJ2 A;  3J81 f;  2QLV B;  1ARL A;  2CF4 A;  1JWH C;  3PBE A;  2JUB A;  1ZLI A;  4K3N A;  5K8P A;  1Q7L A;  3CXC Z;  1VQO Z;  3ESW A;  3CCR 1;  4P44 A;  4F8Z A;  3GTM I;  4P4E A;  3KAS A;  3CC2 1;  2JS4 A;  4A3C I;  1VQ5 1;  1Y1V I;  5IT9 f;  1LAM A;  1RO4 A;  3IO1 A;  2XEI A;  2NVY I;  2PJ7 A;  2QKD A;  4RVD A;  4MON A;  3CCE Z;  3IJ3 A;  4DJL A;  2PJB A;  2OTJ Z;  1ZLH A;  1K9M 2;  4A3L I;  4NGN A;  3CPX A;  3D7G A;  3GCF A;  3I1U A;  4ZYQ A;  2FVG A;  4UEZ A;  1PFT A;  3S1M I;  3FJU A;  2JA7 I;  2ZEO A;  3CCL 1;  1VQK 1;  1Q7Y 1;  4R7M A;  4FBE A;  1VQ6 1;  5A2Q b;  1DL6 A;  1LAP A;  2ZEH A;  5C4X I;  5T67 A;  1YSJ A;  3I56 1;  1YIJ 1;  5D1O A;  1H8L A;  2EK9 A;  5C44 I;  4E2W A;  4HH4 A;  1F2O A;  3LMS A;  5THW A;  5HVG A;  1JJ2 Y;  2M6N A;  2R7Z I;  5J1Q A;  1TWG I;  4MH4 A;  5CBM A;  2ZAE B;  1KQS Z;  3JRU A;  4NJR A;  3KQX A;  2QRC B;  3GLJ A;  1RNI A;  3S17 I;  1NSA A;  2KPI A;  4NB9 A;  5HXD A;  3TC8 A;  1QQ9 A;  3D7D A;  4QTT A;  4P4F A;  1YI2 Z;  5IB9 A;  1ARM A;  2DE7 A;  4DYO A;  1YJ9 Z;  1M4L A;  7CPA A;  1WW9 A;  3NH4 A;  2C1C A;  2JNY A;  5AN9 F;  1VQM 1;  1XMB A;  3MN8 A;  2QRD B;  2JR6 A;  2AFO A;  5LRJ A;  3S16 I;  2CTB A;  3M4O I;  3PO3 S;  3HOZ I;  2PVV A;  3KR5 A;  3J80 b;  3MZL B;  1Z01 A;  3CCR Z;  2E9H A;  5LRG A;  4Z65 A;  1LCP A;  3CC2 Z;  2XEJ A;  4P4J A;  1ZH1 A;  1VQ5 Z;  4NGQ A;  5A2Q f;  3VAT A;  4MCR A;  1VQ9 1;  1BAV A;  2ZEF A;  4A3I I;  3BXM A;  4NOZ A;  1YME A;  2F4O A;  3EER A;  2GRE A;  3ISZ A;  4DUK A;  2RHB A;  3CPA A;  3VH9 A;  1ZB9 A;  3CPW Y;  1VHO A;  2PJ5 A;  3CME Z;  2ZEG A;  4RUH A;  1LAN A;  1VLA A;  4DGL A;  4NGS A;  1NJI 1;  1LFW A;  3CCL Z;  3KIH A;  1VQK Z;  2P28 A;  1CG2 A;  5IP7 I;  3WC7 A;  2ZEM A;  1QVF Y;  1VQ6 Z;  1ZG7 A;  3MON A;  4CL1 A;  4OC5 A;  1RLY A;  4OIW A;  3I56 Z;  1YIJ Z;  2Q43 A;  1EE3 P;  1Y1W I;  3GTM S;  1K73 2;  4NBE A;  3VAR A;  3J81 b;  1Y1V S;  1S7M A;  3TE5 B;  3IF8 A;  4H2K A;  3KGQ A;  1Q86 1;  2K5R A;  4P45 A;  5HVH A;  4P4B A;  3FKI I;  3FQQ A;  3BHX A;  1Q82 2;  3IEH A;  2QYV A;  1TXR A;  1TWF I;  2E2J I;  1Q81 1;  2IMO A;  3B3W A;  4IAV A;  1KC8 1;  3KHX A;  1SFO I;  5K8N A;  3S9N A;  1VQM Z;  1Y0Y A;  4OID A;  2R92 I;  1L1O C;  1X3W A;  1KRL A;  3EED A;  3KR4 A;  1DTD A;  1FNO A;  4JYW A;  4PXD A;  1QMU A;  3TX8 A;  2ANP A;  4BXX I;  2GLJ A;  3SJG A;  3B3V A;  3B2Y A;  2OTL 1;  2PM9 A;  2AFW A;  1VQ9 Z;  3S15 I;  3D66 A;  2ZED A;  1KD1 2;  4YWY A;  2OOY B;  2V8G A;  4UF4 A;  3WC5 A;  2E2H I;  2ZOF A;  4MHN A;  4A3B I;  1VHE A;  2XEF A;  5LL6 f;  1XJO A;  3H3V J;  5LYD A;  3IFU A;  2PJ8 A;  3CMA 1;  2ZEE A;  1K83 I;  2NVX I;  1LQL A;  3NH8 A;  3GTK I;  4MMO A;  4PXE A;  1K9M 1;  2ZEL A;  4P6Y A;  3D7H A;  4NBH A;  2CTC A;  4NB8 A;  5D8N A;  1CPX A;  4MCP A;  2PJC A;  3B3C A;  3BG1 B;  1R9T I;  2EK8 A;  3CCM 1;  3KQZ A;  4XX2 A;  2C6C A;  3NA6 A;  4MCQ A;  5ELY A;  3NDI A;  4BY7 I;  1TKJ A;  2AFM A;  2PJA A;  1RTQ A;  3D9X A;  1VQ8 1;  5I4M A;  1VQP 1;  3S1N I;  1ML8 A;  2F4M A;  2R6M A;  1R3N A;  2NVT I;  2OZK A;  3QWU A;  4JZ0 A;  3B3T A;  4NJQ A;  4PXB A;  3KIF A;  1W2B Z;  3FEC A;  3M3Y I;  1HEE A;  4X8I A;  2E2I I;  4OC4 A;  2JMO A;  2QEX 1;  2O53 A;  3CCQ 1;  1K8A 2;  1USP B;  1XRY A;  1VQ4 Z;  1LOK A;  1CPS A;  2PE3 A;  6CPA A;  3IC1 A;  4MXU A;  4UEE A;  2B63 I;  3CCV 1;  4BBR I;  3FMC A;  4G1P A;  4RVG A;  4ZY2 A;  5LYF A;  1GYT A;  3WT4 A;  1RQF A;  3PFO A;  3RBU A;  4NGR A;  4AXV A;  2YAD A;  2RFH A;  4B6Z A;  2OTL Z;  2M48 A;  3CCJ 1;  3KHZ A;  4A3M I;  3SJE A;  2GTH A;  4Y52 I;  2VUG A;  5FLM I;  3NDJ A;  2PJ3 A;  3IIB A;  4GM5 A;  2K3R A;  2DE5 A;  3CXC Y;  3KL9 A;  3S1R I;  1ELM P;  2AFS A;  3CMA Z;  3BI1 A;  1TWC I;  3G6E 1;  3I07 A;  2DE6 A;  1USP A;  3I4M I;  3B3S A;  2AFZ A;  4IHM A;  4F9U A;  4ONW A;  2J6A A;  3S2D I;  2W04 A;  3PB9 X;  8CPA A;  4PQA A;  3T4N B;  1Z2L A;  3H8F A;  3K2K A;  2O4H A;  1TWH I;  1IGB A;  4MD8 A;  4X3R A;  3CCM Z;  3FH4 A;  3KI9 A;  2WB1 A;  4EFD A;  4NBF A;  2JBK A;  3HOU I;  1M90 2;  3RAM A;  4NBG A;  4OC2 A;  4WJB A;  2EWB A;  3VMH A;  1VQ8 Z;  1YHQ 1;  3J7A 4;  3PEI A;  5CPA A;  1VQP Z;  3FED A;  3F3P C;  4A3D I;  3PFE A;  2POK A;  1K73 1;  2BJO A;  2V8D A;  2I3C A;  3CC7 1;  4E2Z A;  1XFO A;  2KI7 B;  2JEW A;  3S1Q I;  1VQL 1;  4NBC A;  3I4N I;  1CX8 A;  2GLF A;  3U50 C;  3K9T A;  4P4I A;  3WAB A;  2QEX Z;  3S2H I;  2IZ3 A;  3CCQ Z;  1Q82 1;  2AFX A;  1HDU A;  4W9Y A;  1KQS Y;  1TF9 A;  2J9A A;  4QTU A;  3CD6 1;  2RIQ A;  1F2P A;  3QNV A;  4O23 A;  1RO2 A;  1AMP A;  2BOA A;  4TNU A;  1TFI A;  1TKH A;  1N2F A;  1M1K 2;  2C6G A;  3HOW I;  3WC6 A;  3CCJ Z;  1HDQ A;  2IJZ A;  3T8W A;  4NBB A;  2C6P A;  3GTJ I;  2VF1 A;  3DGV A;  5IP9 I;  2JA6 I;  3VTN A;  1CP7 A;  4Q7A A;  1X0T A;  5C3E I;  3H8E A;  2PJ4 A;  1KD1 1;  4BD9 A;  4RVF A;  5T64 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...