2I3CA

Crystal structure of an aspartoacylase from homo sapiens
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
302
structure length
302
Chain Sequence
b'EHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartoacylase
molecule tags Hydrolase
source organism Homo sapiens
publication title Structure of aspartoacylase, the brain enzyme impaired in Canavan disease.
pubmed doi rcsb
total genus 83
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2006-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2i3cA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2i3cA01
5J1QA 2CTCA 5LYLA 1IY7A 4F9VA 4Z65A 1ZG9A 2XEIA 4OMEA 3BI0A 2NSMA 1VHEA 3KR4A 1QQ9A 2PJ4A 3NFZA 4OP4A 1XBUA 1TXRA 5K8PA 3BXMA 3B3TA 4ZY1A 3D4UA 5HVHA 2I3CA 4WWVA 1FT7A 4A39A 3PB6X 5F09A 4UEFA 5LYDA 1ZG7A 4PQAA 2G9DA 2PJ5A 4MHNA 1HDUA 5DS0A 4FUUA 3IC1A 1TF8A 1AYEA 4WJBA 5THWA 3KR5A 3LMSA 1ARMA 2O4HA 3SI2A 4P44A 4P4EA 3L2NA 1BPMA 4F8ZA 4MHPA 4DJLA 1XRYA 3B3WA 4MXUA 1RTQA 1CP7A 5JM6A 2ZEOA 2ZEDA 5D8NA 3B35A 3TC8A 2CF4A 4JYWA 3V38A 2EK8A 2DEAA 3MRUA 1JQGA 1Z2LA 4ONWA 4FWUA 4PXEA 5LYIA 6CPAA 5K8OA 3HUVA 3PEIA 1TF9A 3PBBA 1AMPA 1LAPA 4MCRA 3WC7A 1DTDA 4G1PA 3FF3A 4X8IA 1CPSA 1YSJA 4OC4A 3DLJA 1LANA 4MHYA 1ZLHA 3VARA 2F8HA 1H8LA 4OC2A 7CPAA 2XEJA 3GLJA 3SJFA 3KHXA 2AFMA 3IFEA 1M4LA 3FH4A 3KZWA 3K9TA 3KQZA 4NGNA 4MMOA 3I1UA 3T8WA 1BLLE 3B3SA 2PJ9A 1CBXA 2ZEMA 3PRTA 3N5FA 3H8GA 4GM5A 4YWYA 1Z5RA 2PJ8A 2ZOGA 4OC5A 2JEWA 5CBMA 3D66A 4OC3A 2IQ6A 2GREA 1XFOA 1TKFA 5LYFA 3ISXA 1YW6A 3MN8A 3D7DA 1YLOA 2PJ7A 4EWTA 2C6GA 8CPAA 4P4FA 4ZI6A 4P4DA 3DGVA 1KWMA 3WC5A 1R3NA 4OIWA 2AFOA 5IB9A 4UEZA 2Q4ZA 1VIXA 2ZEGA 2PJCA 4UEEA 3SJEA 3SJXA 2GU2A 4A94A 3IEHA 1YMEA 3D7GA 1ZG8A 3VH9A 3RAMA 4LQGA 3IIBA 4ZX8A 1F2PA 3KI9A 2C1CA 1GYTA 4W9YA 4IK2A 2CIJA 4TNUA 1LOKA 2Q51A 4ZYQA 2PVWA 4B6ZA 1HEEA 3S9NA 4IHMA 1DE4C 3HLPA 3WC6A 4MCQA 1CX8A 4KSIA 2PRQA 2ZENA 3FECA 2V8GA 3KL9A 2EWBA 2JBJA 3NH4A 2HC9A 2XEFA 1LAMA 4NJQA 2PJ0A 2WYRA 3FEDA 4R6TA 3PB8X 4PXCA 4EFDA 4PXBA 3FVLA 4OIDA 2PIZA 4P10A 3SJGA 3B7IA 4Q7AA 2ZEPA 2FVGA 3FMCA 2PE3A 2O53A 2IJZA 1ARLA 4MCSA 2RB7A 1ELMP 4RUHA 3IO1A 1Q7LA 3SI1A 4FBEA 2ABZA 2POKA 4ZY2A 1YW4A 3JRUA 4ZY0A 3ISZA 2VL1A 1TKJA 1CG2A 2OOTA 2ZEFA 1FNOA 4X2TA 3BHXA 2HB6A 1BAVA 2QJ8A 1EE3P 2BOAA 4P4IA 3PFEA 1BPNA 3K2KA 3S9LA 2QYVA 4IAVA 2CTBA 2ZELA 4JZ0A 1R43A 3D67A 4H2KA 4P4BA 1QMUA 2C6CA 3B3VA 3D7HA 4CPAA 5K8NA 2V77A 1TKHA 1XJOA 1LFWA 3WT4A 4R8FA 3H8FA 2PJ3A 3KASA 3CPXA 5JGFA 4NGTA 2PJ2A 4A38A 2AFXA 4MCPA 4TWEA 1PCAA 4F9UA 2XEGA 1Z8LA 4K3NA 4OKOA 1F2OA 2J9AA 3S9MA 4DYOA 2V8DA 2AFUA 4R76A 2PVVA 1VGYA 2IMOA 1LCPA 4NGRA 4P4JA 4BD9A 3FJUA 4P6YA 2PJ6A 3FEEA 2PJBA 4YU9A 3D7FA 4R7MA 2F7VA 5LRJA 2PJ1A 2Q43A 1F57A 3D68A 5I4MA 2AFZA 5CPAA 2QVPA 4FAIA 2C6PA 2ZEEA 5ELYA 2ZOFA 5LRKA 4NJRA 2AFWA 4A37A 3CDXA 2NYQA 2ANPA 3IWWA 3PFOA 1UWYA 3KGQA 4NGMA 3PB4X 3H8EA 1ELLP 3NA6A 3CPAA 4UF4A 2PIYA 4PXDA 4MHZA 5D29A 3PB7X 2JBKA 4OC0A 4MRIA 3GUXA 3CT9A 3BI1A 3IJ3A 1Y0RA 3TX8A 5K8MA 4AXVA 2V8VA 2PCUA 3SI0A 5HVFA 1ZLIA 3B2YA 3PB9X 3WABA 1CPXA 4NFRA 1HDQA 4ZX9A 3LWUA 2WZNA 3KQXA 3PBEA 4UIBA 2EK9A 3GB0A 1Y0YA 1CP6A 4OC1A 2GLJA 2ZEHA 2BO9A 4NGSA 2PJAA 4P45A 4UIAA 4NGPA 2OR4A 1IGBA 1NSAA 3RBUA 4PPZA 3NH8A 4X3RA 1Y7EA 2BCOA 3FX6A 3KHZA 3QNVA 5HXDA 3NH5A 3VATA 3B3CA 2V8HA 1XMBA 4O23A 3V7ZA 5JH9A 2RFHA 4DUKA 4NGQA 2GLFA 5LRGA 3RZAA 5HVGA 2AFSA 1PYTB 1VHOA 4EMEA 1OBRA
chains in the Genus database with same CATH superfamily
2CTCA 1XE4A 1ZG9A 5EBVA 3FBUA 2BUEA 4KVXA 3BI0A 2NSMA 4UA3A 4CS0B 2IZ3A 3NFZA 3MGDA 4OP4A 2AKLA 1X3WA 1TXRA 2Q04A 2FT0A 4PK3A 3BXMA 2Z3LA 3EC4A 4A39A 1M4DA 1QVFZ 1S7NA 3VMGA 4FUUA 3IC1A 2I00A 3TE5B 4CYOA 4CRZB 4PSWA 2JA8I 5DWNA 3KR5A 5G22A 5IX3A 2O4HA 4S1TA 1FDIA 3L2NA 4F8ZA 4MHPA 4DJLA 3B3WA 4B14A 2JDCA 1USPA 4MXUA 2F4OA 4A3FI 1RTQA 5JM6A 2OTL1 4M85A 5D8NA 3TC8A 3CXPA 2PC1A 3CXCY 1Y1WI 3S17I 4ONWA 1YHQZ 2V8JA 2G3TA 3ZZIA 3VTNA 1M4GA 3W6XA 4OAEA 1DTDA 4B13A 1RXTA 2M6NA 3D2LA 1CJWA 2PRBA 4OC4A 1USPB 1LANA 1ZLHA 1Q7Y1 3TOAA 5A27A 4YGOA 5F47A 3CMAZ 2EO8A 5T64A 3KQZA 4NGNA 4EVYA 3NE8A 1N8R2 3H8GA 4YWYA 3OW2Y 2PJ8A 2PK7A 3DR6A 2VUGA 5CBMA 3D66A 2VPXA 2IQ6A 1IYKA 1KC81 3IU1A 4HNXB 1K8A1 2YNCA 4MFZA 2PJ7A 4EWTA 1QF8A 8CPAA 4X5KA 2DPSA 1R3NA 2VEZA 3RO0A 3SJXA 4YFJA 2PJCA 5A2Qb 1K8A2 3S2HI 2BL1A 2GU2A 3CCS1 4PV6A 1VQ81 4A33A 2GTIA 3D7GA 1ON0A 4A3BI 4CGLA 3I561 3KI9A 1GYTA 2EUIA 4W9YA 4IK2A 2JIRA 2ARHA 4Y7NI 3NE7A 3KIHA 4CGOA 4BINA 3CCU1 1HEEA 4M3SA 4XNHB 1DE4C 4A3KI 1VQP1 3WC6A 1RO5A 4KSIA 2EWBA 2JBJA 2X7BA 2W04A 3KIFA 2XEFA 4NJQA 3CCEZ 2J8RA 4AVBA 3B7IA 3S1NI 2PE3A 4BY7I 4CAVA 1U6MA 3GTMS 1ARLA 2JEVA 3IGRA 2JA7I 2A4NA 1ELMP 2CNMA 3SI1A 3JAMf 3VWEA 3JAMb 3IF8A 1YQEA 5KTCA 4CRYB 3ISZA 3CXCZ 1TKJA 1YK3A 2ZEFA 4X2TA 3BHXA 2WUUA 1Q812 1Z4EA 2R7HA 1YJN1 2YNDA 2Q7BA 3F3FC 3JVNA 1BPNA 3D67A 1KD11 1TWAI 3B8GA 5J8FA 1OZPA 3B3VA 3IFUA 1X10A 1QSNA 3CCMZ 3HOWI 1Q822 4BBHA 1XJOA 2B63I 3WT4A 2PJ3A 3KASA 4C2XA 5JGFA 3KKWA 4MD8A 4MFJA 3P2HA 1M4IA 1AA6A 3DDDA 1P4NA 1Z8LA 2G0BA 4H6UA 4NBCA 4Y49B 1PFTA 2KI7B 4AB7A 2K3RA 2DXQA 3IU2A 3H5ZA 4LUAA 1S72Z 4R76A 3FRMA 2P3YA 4P4JA 2F5IA 1UFHA 3CC21 3BJ7A 1RLYA 4R7MA 3S1QI 2F7VA 2PR1A 1XF8A 1F57A 5LL6f 2GANA 4HPSA 5I4MA 2AFZA 3S6HA 5G1ZA 2ZOFA 1YVOA 5HH1A 4KLVA 4NJRA 1SFOI 4NSQA 4MONA 1R57A 3KGQA 2P0WA 4LQ6A 4KOXA 3CCUZ 1VQ5Z 4HH4A 1ELLP 1N2FA 5T6BA 2WPXA 2PIYA 3F3PC 4NB8A 4MHZA 2HV2A 4XX2A 1YX0A 1NSLA 4R3KA 3CMEZ 4E31A 3WR7A 3CT9A 3BI1A 4R57A 1M44A 4A3DI 1VQ9Z 3GTKI 1ZLIA 5D1PA 3B2YA 4FD6A 2E9HA 3D2PA 2JIPA 3LWUA 3T9YA 3G3SA 2JS4A 4UIBA 1CP6A 2ZEHA 4UIAA 2NAPA 2R93I 1IGBA 1NSAA 2B3VA 1B6BA 2VI7A 3LD2A 3F0AA 3KHZA 3NH5A 3B3CA 1J4JA 3CME1 3V7ZA 3GY9A 3HOYI 1M1DA 1Z03A 4A3CI 1TWHI 4DK1A 4BXXI 1VHOA 3MONA 3GKQA 1IY7A 4E2AA 2XEIA 4KOVA 3K9UA 2OTJZ 3KR4A 1I21A 4MBUA 5J8CA 1Q2YA 2EBJA 2GE3A 1TFIA 4MD9A 2LIYA 1TWFI 3DSBA 2Z10A 1WK4A 4ZY1A 3G6E1 5JPHA 5HVHA 2W03A 4WWVA 5H86A 2PM9A 1ZO0A 2PJ5A 1QVGZ 1HDUA 5DS0A 1TF8A 2LEXA 2OU2A 4HGYA 4LX9A 4WJBA 5THWA 1ARMA 1Z9UA 4JXQA 4P4EA 3A9LA 3BLNA 1XRYA 4AVCA 1K732 1MJAA 5C88A 3I9SA 4JYWA 2EK8A 3MRUA 3J7A4 1JQGA 5C4JI 1X0TA 1Z2LA 4MI4A 1L0CA 4E0AA 2OB0A 2Z11A 5LYIA 6CPAA 2G3AA 4CAXA 3HUVA 4HNWB 3PEIA 3FF3A 3TO9A 1ZB9A 4NBGA 1W2BZ 4X8IA 1M901 3CCM1 3DLJA 4MHYA 1YJ9Z 1DL6A 3S6GA 3PZJA 2Q4VA 2PQ8A 3SJFA 4UFVA 1M4LA 1S5KA 3K9TA 4MMOA 4M6GA 1KUVA 4GXHA 3N5FA 2ZOGA 4OC5A 1FY7A 5H84A 4DGLA 2HF1A 1VLAA 4A3JI 3CCJZ 4MY0A 5LYFA 3ISXA 1I12A 2QA41 1YW6A 4ZGYB 3D7DA 3J81f 1X12A 1Q2CA 3LACA 3DR8A 4P4DA 1GHEA 5G21A 3FNCA 3DGVA 1IU8A 4OIWA 4F0YA 4CAWA 1VQOZ 1YUAA 2R6MA 5IB9A 3CC7Z 4AG9A 2Q4ZA 1VIXA 2ZEGA 4UEEA 3SJEA 2EGTA 1YUKA 2FL4A 2GFQA 5C3EI 3FKII 3VH9A 3RAMA 1XOVA 3IIBA 4CGPA 3JUWA 1IIDA 2C1CA 2IL4A 2CIJA 2E2II 4F0XA 4ZYQA 2YNEA 4B5OA 4IHMA 4E2WA 4A95A 3HLPA 3N7ZA 4MCQA 3C26A 2PRQA 2FIAA 3FECA 2Q7SA 3KL9A 3FQMA 4CYNA 3CXQA 2WYRA 1XMTA 4NBFA 4KSAA 4R6TA 4BY1I 3GIUA 4P10A 4Q7AA 1VQ7Z 2FVGA 3I07A 1S7LA 3R1KA 2H85A 4U5YA 4NCZA 4MCSA 3S6FA 3RZDI 5IV0A 4UFWA 4R9MA 3IO1A 4FBEA 3J81b 2VPWA 2YADA 4E2ZA 3PO2I 2POKA 1YW4A 4KS9A 4MJ8A 5EMIA 1CG2A 5T67A 4NH1C 2HB6A 2QJ8A 2BSWA 4NBEA 2K5RA 2M48A 4P4IA 3S1MI 4XPKA 3RYOA 1KRLA 1Q7Y2 4DNCA 3S9LA 2QR1B 4IAVA 2CTBA 3D9XA 1VQL1 4DQYB 3CMA1 4H2KA 3CD61 2C6CA 4FD4A 1QVGY 3H0GI 2JIOA 3CCR1 4CPAA 5K8NA 2V77A 4JXRA 2E2HI 2QMLA 5HMNA 1LFWA 4ORFA 1XEBA 4NGTA 3QWUA 2Y0SA 2PJ2A 2QIRA 4L89A 4II9A 4MCPA 3R9EA 4F9UA 1WJ2A 3VMIA 1LRZA 2Q0YA 3S9MA 5AG7A 3BG0B 5KTAA 4C7HA 3EFAA 2PR8A 2Z3OA 1S60A 2IMOA 3TOBA 4BD9A 4P6YA 2PJ6A 4QB9A 1VQ71 4YU9A 5AG4A 2PJ1A 2REFA 2E2JI 1JWQA 4BBSI 1V0CA 2QVPA 1MJBA 4FAIA 2VUMI 2ZEEA 4RVFA 5F48A 1Z8TA 5LRKA 3S14I 5AG6A 2NYQA 1YJ91 2ANPA 2VQYA 1VQ6Z 3TDHB 4NGMA 3PB4X 2B4BA 2FXFA 3GYAA 4CGMA 2Z3PA 3CC41 3EEDA 4EWCA 3GUXA 3QB8A 5ISVA 5K8MA 3D3SA 2CNSA 2KCWA 5IP9I 3GTQI 4AXVA 2CNTA 1VQ8Z 5HVFA 4FD7A 2B4DA 1QYPA 4NFRA 3I3GA 1HDQA 4ZX9A 1N8R1 4PK2A 4M6HA 1ZH1A 5D1OA 2P28A 2EK9A 3SXOA 3GTGI 5IT9b 2QEX1 4KOUA 2HUZA 4NGSA 4HKFA 5E96A 1NUIA 1Z8XA 3PP9A 3F5BA 4H89A 4PPZA 3FX6A 2P6FA 2OZGA 5HXDA 3TE4A 3VATA 2JIMA 4O23A 4A3LI 4A2ZA 1YREA 4KOYA 3S16I 4NGQA 4U9ZA 2AFSA 1Y1VS 1OBRA 4CAEA 5J1QA 3NDIA 5LYLA 3G4S1 4Z65A 4F9VA 2ODFA 3EO4A 2R92I 4OMEA 2DF5A 1WW9A 4XNHC 1YIJZ 1IYLA 3S15I 3GTPI 2QRDB 1RQFA 1QQ9A 1ZB8A 2ZW7A 3DNSA 1XBUA 2JMOA 4CYPA 1QXFA 3P2FA 1VQK1 1LQLA 3B3TA 3D4UA 5AG5A 2VZYA 4MFKA 5F09A 4UEFA 5LYDA 1ZG7A 4MHNA 2RPRA 4JWPA 4NBAA 1AYEA 3CCL1 4NF1A 4P44A 2RT9A 3HOVI 2CF4A 2WB1A 2FS5A 3H3VJ 1X3ZA 4CAFA 4FWUA 5JQ4A 4PXEA 3CCV1 2ZPAA 5BWAB 5KTDA 3WC7A 3PO3S 2DE7A 4E33A 3CXSA 5GCNA 4MH4A 4R3LA 2BEIA 2Q4YA 2NVQI 3VARA 2F8HA 3I55Z 7CPAA 3GLJA 3KHXA 2AFMA 4XPLA 1YHQ1 3FH4A 1S7FA 3I551 2DPTA 3NDJA 3KZWA 4KORA 2WAQA 3G4SZ 4L8AA 3I1UA 1IOFA 1WWZA 3T8WA 1BLLE 3ESWA 2BJOA 3B3SA 4KUBA 2PJ9A 1Y9KA 2ZEMA 1TWGI 5FVJA 1KD12 2OTLZ 3SXNA 2JEWA 4HGZA 3TO7A 3IX0A 1XFOA 1TKFA 1Y8CA 3U50C 5CNPA 4H6ZA 3CCLZ 2R98A 2REEA 2JIQA 3CCQZ 4UWJA 3IWGA 2HQYA 2V3VA 2V45A 5FLMI 3WC5A 1L1OC 1Z8WA 4E2XA 4UEZA 3R9GA 1S7KA 2JR6A 4NOZA 1BO4A 5F46A 1ZG8A 1YIJ1 4B5PA 4LQGA 2CY2A 2B5GB 3P5JB 1F2PA 4U9YA 4ZBGA 4TNUA 2Q51A 4B6ZA 2FSRA 2YNCC 3GTOI 2F4MA 2VBQA 1R9TI 4NBBA 1YJW1 2V8GA 1FDOA 3QAHA 3VB9A 3GKRA 1Z01A 3RNZA 1S7MA 4UFXA 3FB3A 5IP7I 2PJ0A 2QA4Z 2VF1A 1BOBA 1K83I 3E0KA 3PB8X 4EFDA 3FVLA 4OIDA 2HU9A 3TO6A 3SJGA 1KZFA 2ZEPA 3FMCA 3R9FA 3IR7A 3CPWZ 2B3UA 1P0HA 1IB1E 4NBDA 3LUSA 2QEXZ 2OOYB 1S3ZA 3T4NB 4RUHA 4KVME 2ABZA 3BG1B 3JRUA 2D4OA 2OOTA 1FNOA 4E32A 1BAVA 1EE3P 5C4XI 2BOAA 3TTHA 3IWEA 4A31A 2JLMA 1CM0A 3V8IA 1VQ61 3CD6Z 3K2KA 2PMZA 2QYVA 2ZELA 1Y1VI 5FLXf 1R43A 5EC4A 4JJXA 1M902 2RC4A 2QLVB 4C2ZA 1YJNZ 1TKHA 2OZUA 4R8FA 3H8FA 3CPXA 4QVTA 4BMHA 4MD7A 2EVNA 1K9M2 4R87A 4UCMA 3EERA 1NE9A 2AFXA 1PCAA 2C27A 2XEGA 1VQ41 2J9AA 3FQQA 4AVAA 4DYOA 2AFUA 3R96A 2PVVA 1K731 4KZTA 2O28A 3G6EZ 3FEEA 2PJBA 1KQSY 3TT2A 2RHBA 5LRJA 5C44I 2Q43A 1PU9A 3D68A 1KQSZ 4J3GA 4KOTA 4KOWA 2C6PA 3CZXA 5IB0A 1JJ2Z 1NP6A 4QC6A 3S1RI 1QVFY 3I4NI 2AFWA 1VQ4Z 2Q44A 1VQMZ 2GTHA 3CPWY 4CGNA 4K30A 3H8EA 1QSRA 3F8KA 1NJI2 4UF4A 1SIWA 1K9M1 4PXDA 3D6WA 5D29A 3PB7X 2R7ZI 4A3EI 3VMHA 3IJ3A 4X6AI 2J6AA 1Q811 1B87A 3TX8A 4C2YA 1A2ZA 4MY3A 3EY5A 1VQLZ 4Y49C 4CYQA 4IF5A 2OZHA 2OTJ1 1Q862 3SI0A 1WIIA 1W2BY 3KQXA 4CL1A 1Y0YA 1VQNZ 4KLWA 3JTKA 2PJAA 1XIXA 4A3MI 4E8OA 3OW2Z 3J80b 4RN7A 3RBUA 1RO2A 3NH8A 4ONUA 4X3RA 1Y7EA 4M6IA 4E30A 3EXNA 2K5TA 1QSOA 4RS2A 4YRHA 2V8HA 2LFUA 5JH9A 2RFHA 4DUKA 4B12A 2JNYA 1RO0A 5LRGA 3FIXA 5HVGA 2AJ6A 2NVTI 4EMEA 1Q861 3R95A 2ATRA 2ZAEB 2PDOA 2QECA 3GTJI 5AGEA 4HNYB 1VHEA 1KUYA 2PJ4A 4QBJA 2R8VA 4B10A 4OADA 4I49A 5K8PA 3S6KA 1I50I 5DWMA 2VZZA 2I3CA 2RIQA 2R1IA 2ZW4A 1FT7A 1QSTA 3PB6X 1YIT1 4NXYA 4PQAA 3I56Z 4A3GI 2G9DA 4MHDA 1M1K1 3I4MI 2J8NA 2RBLA 4JLYA 3HOXI 1JWHC 3LMSA 5C82A 3GCFA 3SI2A 2OOXB 1BPMA 3ZJ0A 4QTUA 1AUGA 2QKDA 3BJ8A 5A28A 1CP7A 2DE5A 2ZEOA 2ZEDA 2YGWA 3B35A 2ZW5A 2WPWA 3V38A 2DEAA 1I1DA 4NB9A 2D4PA 2FIWA 1KC82 1Y7RA 5K8OA 1YI2Z 3G71Z 2Z0ZA 1TF9A 5AN9F 3CC4Z 3PBBA 1AMPA 1LAPA 4MCRA 2VXKA 4G1PA 1CPSA 1VQ51 1YSJA 4RI1A 1YGHA 1SQHA 2B58A 3CCVZ 3PO3I 4KVOE 1H8LA 4OC2A 1PUAA 2XEJA 4A93I 5A2Qf 5FLXb 3IFEA 5I0CA 1Q2DA 2VPZA 2GIVA 1CBXA 3PRTA 2QRCB 1IICA 4GM5A 2FE7A 1Z5RA 2VPYA 4NEXA 2Z3MA 4OC3A 2GREA 3D2MA 3G711 4QUSA 1I3QI 1JJ2Y 4PSXA 3CCE1 3UY5A 4C68A 3MN8A 1YLOA 3RZOI 2C6GA 2ZW6A 2CXAA 4P4FA 4ZI6A 2AE6A 3HKZA 3W91A 1KWMA 1VQN1 2P6GA 2AFOA 4JD6A 4A30A 2V8KA 3FYNA 3TCVA 3QAYA 4A94A 1N71A 3IEHA 1TIQA 1YMEA 3K7AI 4IUSA 4FD5A 4ZX8A 4NBHA 4MFLA 1YJWZ 1LOKA 2Y0MA 3SHPA 2PVWA 3VWDA 2JDDA 1VQO1 3S9NA 4RVDA 1VQKZ 2ZXVA 4RS4A 2JA5I 2B5GA 4QTTA 1CX8A 4RVGA 3LODA 2JA6I 2ZENA 3TFYA 4UCPA 3NH4A 4AG7A 2HC9A 3GTMI 1LAMA 1Z4RA 4B5PB 3Q87A 3FEDA 3CCSZ 4PXCA 2G2KA 4PXBA 2PIZA 3CC71 1Q16A 4MFPA 1M1K2 3M4OI 2PSWA 2J8MA 2O53A 1Y9WA 2IJZA 4XPDC 2DE6A 1RO4A 2RB7A 4KSFA 3CCQ1 1MK4A 1S721 2IV2X 4AYBA 1Q7LA 4XPDB 1NJI1 3D8PA 4ZY2A 4ZY0A 4RVHA 5F49A 2VL1A 1WZNA 3CCJ1 1Q821 2IZ4A 3MZKB 3CCRZ 1VKCA 1VQM1 3PFEA 1NMTA 4A3II 3HOUI 1KUXA 5D1OB 4JZ0A 1RNIA 1VQ91 4P4BA 2AYDA 1QMUA 1P9NA 3D7HA 3GTLI 4KOSA 3MZLB 1YI21 3CQZI 2Z3KA 4A38A 4TWEA 3FXTA 1I6HI 4K3NA 4OKOA 1F2OA 2OH1A 3J80f 2V8DA 3OWCA 1WCMI 4RV9A 4OLLA 1VGYA 1LCPA 4C7IA 4NGRA 3PGPA 3FJUA 2WSAA 4UBRA 3H4QA 3D7FA 3G8WA 3CC2Z 4MFQA 3S2DI 5CPAA 4KUAA 2E7ZA 5IT9f 5ELYA 4GS4A 2B4DB 4A32A 2V8IA 1IOIA 2OZKA 4A37A 3CDXA 4B11A 2YU9I 2NVXI 3IWWA 3PFOA 1UWYA 2Z3NA 2I79A 2KPIA 3NA6A 2FCKA 3CPAA 1ML8A 1VHSA 1YR0A 4Y52I 2JUBA 2JBKA 4OC0A 4MRIA 3T90A 1Y0RA 1K4JA 2V8VA 2PCUA 3PB9X 3WABA 1CPXA 2WZNA 3PBEA 3GB0A 4Q38A 4OC1A 2GLJA 2BO9A 4P45A 2P6EA 2H5MA 1YLEA 3W6SA 4NGPA 4BBRI 2OR4A 4UWIA 4F6AA 2NVYI 1QSMA 2QREB 2BCOA 3QNVA 5CM2M 1XMBA 3M3YI 3HOZI 1YITZ 2GLFA 1VQPZ 4E2YA 4UCNA 1Z02A 3RZAA 2NMTA 1TWCI 1YVKA 1PYTB 4Q36A 1MJ9A 5G20A
chains in the Genus database with same CATH topology
5J1QA 2CTCA 3NDIA 5LYLA 3G4S1 3GKQA 1IY7A 4F9VA 4Z65A 1ZG9A 2R92I 3GTJI 2XEIA 4OMEA 3BI0A 2OTJZ 2NSMA 1WW9A 1VHEA 1YIJZ 2IZ3A 3S15I 3GTPI 3KR4A 2QRDB 1RQFA 1QQ9A 2PJ4A 3NFZA 1ZB8A 4OP4A 2AKLA 1XBUA 1X3WA 2JMOA 1TXRA 5K8PA 1TFIA 4MD9A 2LIYA 1TWFI 1VQK1 1LQLA 3BXMA 1I50I 3B3TA 4ZY1A 3D4UA 3G6E1 5HVHA 2I3CA 2W03A 2RIQA 4WWVA 1FT7A 4A39A 3PB6X 1YIT1 5F09A 4UEFA 5LYDA 1ZG7A 4PQAA 2PM9A 3I56Z 4A3GI 2G9DA 1QVFZ 1M1K1 2PJ5A 3I4MI 3VMGA 4MHNA 1QVGZ 1HDUA 5DS0A 4FUUA 2RBLA 2RPRA 1TF8A 3IC1A 3TE5B 4NBAA 1AYEA 3CCL1 3HOXI 4HGYA 4WJBA 5THWA 2JA8I 1JWHC 3KR5A 3LMSA 1ARMA 3GCFA 2O4HA 4S1TA 3SI2A 4P44A 4P4EA 2OOXB 3L2NA 1BPMA 4F8ZA 4MHPA 2RT9A 4DJLA 4QTUA 1XRYA 3B3WA 3HOVI 1K732 2QKDA 1USPA 4MXUA 2F4OA 4A3FI 1RTQA 1CP7A 2DE5A 2OTL1 2ZEDA 2ZEOA 5D8NA 5JM6A 3B35A 3TC8A 2CF4A 2WB1A 3CXCY 3H3VJ 4JYWA 3V38A 2EK8A 2DEAA 3MRUA 1Y1WI 3J7A4 4NB9A 1JQGA 3S17I 5C4JI 1X0TA 1X3ZA 1Z2LA 4ONWA 1YHQZ 4FWUA 2V8JA 1KC82 4PXEA 5LYIA 3CCV1 6CPAA 3VTNA 5K8OA 1YI2Z 3G71Z 3HUVA 3PEIA 1TF9A 5AN9F 3CC4Z 3PBBA 1AMPA 1LAPA 4MCRA 3WC7A 3PO3S 2DE7A 1DTDA 4E33A 3FF3A 4G1PA 1ZB9A 4MH4A 4NBGA 1W2BZ 1CPSA 2M6NA 1VQ51 1M901 1YSJA 4X8IA 3CCM1 4OC4A 3DLJA 1USPB 1LANA 2NVQI 4MHYA 1ZLHA 3VARA 3CCVZ 3PO3I 2F8HA 1H8LA 4OC2A 1YJ9Z 1Q7Y1 3I55Z 7CPAA 1DL6A 2XEJA 4A93I 3GLJA 5A2Qf 3SJFA 3KHXA 5FLXb 2AFMA 3CMAZ 3IFEA 1M4LA 1YHQ1 3FH4A 5T64A 3I551 3KZWA 3NDJA 3K9TA 3KQZA 2WAQA 3G4SZ 4NGNA 4MMOA 3I1UA 3T8WA 1BLLE 3ESWA 2BJOA 3B3SA 2PJ9A 1N8R2 1CBXA 2ZEMA 1TWGI 3PRTA 2QRCB 3N5FA 3H8GA 4GM5A 4YWYA 3OW2Y 1Z5RA 1KD12 2PJ8A 2OTLZ 2PK7A 2ZOGA 4OC5A 2JEWA 2VUGA 5CBMA 3D66A 4HGZA 4OC3A 2IQ6A 3IX0A 1KC81 2GREA 4DGLA 2HF1A 3G711 1VLAA 4A3JI 1I3QI 3CCJZ 1JJ2Y 1TKFA 1XFOA 5LYFA 3U50C 3ISXA 1K8A1 3CCE1 2QA41 1YW6A 3CCLZ 3MN8A 3D7DA 1YLOA 3CCQZ 3J81f 3RZOI 2PJ7A 4EWTA 1QF8A 2C6GA 8CPAA 4P4FA 4ZI6A 4P4DA 3HKZA 3DGVA 1KWMA 5FLMI 1VQN1 3WC5A 1L1OC 1R3NA 4OIWA 1VQOZ 1YUAA 2AFOA 2R6MA 4E2XA 5IB9A 4UEZA 3CC7Z 2V8KA 2Q4ZA 1VIXA 2ZEGA 2PJCA 4UEEA 3SJEA 2EGTA 5A2Qb 3SJXA 1K8A2 3S2HI 1YUKA 2GU2A 3CCS1 2JR6A 4NOZA 5C3EI 1VQ81 2GTIA 4A94A 3IEHA 1YMEA 3FKII 3D7GA 1ZG8A 1YIJ1 3K7AI 3VH9A 3RAMA 4LQGA 4A3BI 3IIBA 3P5JB 4ZX8A 1F2PA 3I561 3KI9A 2C1CA 4NBHA 1GYTA 1YJWZ 4W9YA 4IK2A 2CIJA 4TNUA 4Y7NI 2E2II 3KIHA 1LOKA 2Q51A 4ZYQA 3CCU1 2PVWA 4B6ZA 1HEEA 1VQO1 3S9NA 3GTOI 4RVDA 1VQKZ 4IHMA 2F4MA 4E2WA 1DE4C 4RS4A 4A3KI 1VQP1 3HLPA 2JA5I 3WC6A 4QTTA 1R9TI 1CX8A 4KSIA 4RVGA 4NBBA 1YJW1 2PRQA 4MCQA 2JA6I 2ZENA 3FECA 2V8GA 3VB9A 3KL9A 2EWBA 2JBJA 1Z01A 3FQMA 3NH4A 1S7MA 2W04A 3KIFA 2HC9A 3GTMI 2XEFA 1LAMA 5IP7I 2PJ0A 2WYRA 4NJQA 2QA4Z 3CCEZ 4NBFA 3Q87A 3FEDA 2VF1A 4R6TA 1K83I 3CCSZ 3PB8X 4PXCA 4BY1I 2G2KA 4EFDA 4PXBA 3FVLA 4OIDA 2HU9A 2PIZA 4P10A 3SJGA 3CC71 3B7IA 4Q7AA 1VQ7Z 3S1NI 2FVGA 2ZEPA 1M1K2 3FMCA 3I07A 2PE3A 4BY7I 3CPWZ 3M4OI 2H85A 4NBDA 2O53A 3LUSA 2QEXZ 3GTMS 1ARLA 2IJZA 4MCSA 2DE6A 1RO4A 2RB7A 2OOYB 3CCQ1 3RZDI 2JA7I 1S721 4AYBA 3T4NB 1ELMP 4RUHA 3IO1A 1Q7LA 3SI1A 3JAMf 4FBEA 2ABZA 1NJI1 3J81b 2YADA 3BG1B 4E2ZA 3JAMb 3PO2I 2POKA 4ZY2A 1YW4A 3IF8A 3JRUA 4ZY0A 4RVHA 3ISZA 2VL1A 3CXCZ 1TKJA 1CG2A 2OOTA 5T67A 3CCJ1 2ZEFA 1FNOA 4X2TA 4NH1C 4E32A 1Q821 3BHXA 2HB6A 1Q812 1BAVA 2QJ8A 1EE3P 2IZ4A 5C4XI 2BOAA 4NBEA 2K5RA 2M48A 4P4IA 3MZKB 3CCRZ 1YJN1 3S1MI 1VQM1 3PFEA 4A3II 3F3FC 1VQ61 3CD6Z 3HOUI 5D1OB 1KRLA 1BPNA 1Q7Y2 3K2KA 2PMZA 2QR1B 2QYVA 4IAVA 2CTBA 3S9LA 3D9XA 2ZELA 1Y1VI 5FLXf 1R43A 1RNIA 3D67A 4JZ0A 1KD11 1VQ91 1TWAI 1VQL1 4DQYB 3CMA1 4H2KA 4P4BA 1M902 1QMUA 1P9NA 2QLVB 3CD61 2C6CA 1QVGY 3H0GI 3B3VA 3IFUA 3CCMZ 3HOWI 3D7HA 1Q822 3CCR1 1YJNZ 4CPAA 5K8NA 2V77A 1TKHA 1XJOA 2E2HI 2B63I 1LFWA 3WT4A 4R8FA 3H8FA 2PJ3A 3KASA 3CPXA 5JGFA 4MD7A 4NGTA 3GTLI 3QWUA 2Y0SA 3MZLB 4MD8A 1K9M2 1YI21 2PJ2A 3EERA 3CQZI 4A38A 2AFXA 4MCPA 4TWEA 1PCAA 4F9UA 2XEGA 1I6HI 1Z8LA 4K3NA 3VMIA 1VQ41 4OKOA 4NBCA 1F2OA 1PFTA 2KI7B 2J9AA 2K3RA 3S9MA 3FQQA 3BG0B 3J80f 4DYOA 1S72Z 2V8DA 2AFUA 1WCMI 4RV9A 4R76A 2PVVA 1K731 2P3YA 1VGYA 2IMOA 1LCPA 4NGRA 4P4JA 4BD9A 3FJUA 3CC21 4P6YA 3G6EZ 2PJ6A 3FEEA 1VQ71 2PJBA 1KQSY 4YU9A 3D7FA 1RLYA 4R7MA 3S1QI 2F7VA 2RHBA 5LRJA 2PJ1A 5C44I 2Q43A 1F57A 5LL6f 3D68A 3CC2Z 2E2JI 3S2DI 4BBSI 1KQSZ 5I4MA 2AFZA 5CPAA 2QVPA 4FAIA 2C6PA 2VUMI 2ZEEA 4RVFA 5ELYA 5IT9f 2ZOFA 1JJ2Z 1NP6A 4NJRA 5LRKA 2V8IA 3S1RI 3S14I 1QVFY 2OZKA 3I4NI 4UIBA 2AFWA 1SFOI 1VQ4Z 4A37A 3CDXA 1VQMZ 4MONA 2YU9I 2NYQA 1YJ91 2NVXI 2ANPA 2GTHA 1VQ6Z 3IWWA 3PFOA 3TDHB 3CPWY 1UWYA 3KGQA 4NGMA 3PB4X 3CCUZ 1VQ5Z 4HH4A 3H8EA 2KPIA 1N2FA 1ELLP 3NA6A 5T6BA 3CPAA 1NJI2 4UF4A 2PIYA 3F3PC 1K9M1 4PXDA 3D6WA 4NB8A 3CC41 4MHZA 5D29A 4XX2A 1ML8A 3EEDA 3PB7X 2R7ZI 2JUBA 4EWCA 4Y52I 3CMEZ 2JBKA 4A3EI 4E31A 4MRIA 3VMHA 3CT9A 3GUXA 4OC0A 3BI1A 3IJ3A 4X6AI 2J6AA 1Q811 1Y0RA 3TX8A 5K8MA 4A3DI 5IP9I 3GTQI 2V8VA 1VQ9Z 1VQLZ 4AXVA 3GTKI 2PCUA 1VQ8Z 2OTJ1 1Q862 5HVFA 3SI0A 1WIIA 1ZLIA 5D1PA 3B2YA 1QYPA 2E9HA 3PB9X 3WABA 1CPXA 4NFRA 1HDQA 4ZX9A 1N8R1 3LWUA 1W2BY 2WZNA 3KQXA 2JS4A 4CL1A 1ZH1A 5D1OA 3PBEA 2P28A 2EK9A 3GTGI 5IT9b 2QEX1 1CP6A 1VQNZ 1Y0YA 3GB0A 4OC1A 2GLJA 2ZEHA 2BO9A 4NGSA 2PJAA 4P45A 4UIAA 4A3MI 1NUIA 3OW2Z 3J80b 4NGPA 4BBRI 2R93I 2OR4A 1IGBA 2NVYI 1NSAA 1RO2A 4PPZA 3RBUA 2QREB 3NH8A 4X3RA 1Y7EA 2BCOA 4E30A 3FX6A 3KHZA 3QNVA 5HXDA 5CM2M 3NH5A 3VATA 3B3CA 2V8HA 3CME1 2LFUA 4A3LI 1XMBA 4O23A 3V7ZA 5JH9A 2RFHA 3M3YI 4DUKA 3S16I 2JNYA 4NGQA 3HOYI 1YITZ 3HOZI 1VQPZ 2GLFA 1Z03A 4E2YA 1RO0A 4A3CI 5LRGA 1Z02A 3RZAA 5HVGA 2AFSA 1TWCI 1TWHI 4DK1A 2NVTI 4BXXI 1PYTB 1VHOA 1Y1VS 4EMEA 1Q861 1OBRA 2ZAEB 3MONA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J1Q A;  2CTC A;  5LYL A;  1IY7 A;  4F9V A;  4Z65 A;  1ZG9 A;  2XEI A;  4OME A;  3BI0 A;  2NSM A;  1VHE A;  3KR4 A;  1QQ9 A;  2PJ4 A;  3NFZ A;  4OP4 A;  1XBU A;  1TXR A;  5K8P A;  3BXM A;  3B3T A;  4ZY1 A;  3D4U A;  5HVH A;  2I3C A;  4WWV A;  1FT7 A;  4A39 A;  3PB6 X;  5F09 A;  4UEF A;  5LYD A;  1ZG7 A;  4PQA A;  2G9D A;  2PJ5 A;  4MHN A;  1HDU A;  5DS0 A;  4FUU A;  3IC1 A;  1TF8 A;  1AYE A;  4WJB A;  5THW A;  3KR5 A;  3LMS A;  1ARM A;  2O4H A;  3SI2 A;  4P44 A;  4P4E A;  3L2N A;  1BPM A;  4F8Z A;  4MHP A;  4DJL A;  1XRY A;  3B3W A;  4MXU A;  1RTQ A;  1CP7 A;  5JM6 A;  2ZEO A;  2ZED A;  5D8N A;  3B35 A;  3TC8 A;  2CF4 A;  4JYW A;  3V38 A;  2EK8 A;  2DEA A;  3MRU A;  1JQG A;  1Z2L A;  4ONW A;  4FWU A;  4PXE A;  5LYI A;  6CPA A;  5K8O A;  3HUV A;  3PEI A;  1TF9 A;  3PBB A;  1AMP A;  1LAP A;  4MCR A;  3WC7 A;  1DTD A;  4G1P A;  3FF3 A;  4X8I A;  1CPS A;  1YSJ A;  4OC4 A;  3DLJ A;  1LAN A;  4MHY A;  1ZLH A;  3VAR A;  2F8H A;  1H8L A;  4OC2 A;  7CPA A;  2XEJ A;  3GLJ A;  3SJF A;  3KHX A;  2AFM A;  3IFE A;  1M4L A;  3FH4 A;  3KZW A;  3K9T A;  3KQZ A;  4NGN A;  4MMO A;  3I1U A;  3T8W A;  1BLL E;  3B3S A;  2PJ9 A;  1CBX A;  2ZEM A;  3PRT A;  3N5F A;  3H8G A;  4GM5 A;  4YWY A;  1Z5R A;  2PJ8 A;  2ZOG A;  4OC5 A;  2JEW A;  5CBM A;  3D66 A;  4OC3 A;  2IQ6 A;  2GRE A;  1XFO A;  1TKF A;  5LYF A;  3ISX A;  1YW6 A;  3MN8 A;  3D7D A;  1YLO A;  2PJ7 A;  4EWT A;  2C6G A;  8CPA A;  4P4F A;  4ZI6 A;  4P4D A;  3DGV A;  1KWM A;  3WC5 A;  1R3N A;  4OIW A;  2AFO A;  5IB9 A;  4UEZ A;  2Q4Z A;  1VIX A;  2ZEG A;  2PJC A;  4UEE A;  3SJE A;  3SJX A;  2GU2 A;  4A94 A;  3IEH A;  1YME A;  3D7G A;  1ZG8 A;  3VH9 A;  3RAM A;  4LQG A;  3IIB A;  4ZX8 A;  1F2P A;  3KI9 A;  2C1C A;  1GYT A;  4W9Y A;  4IK2 A;  2CIJ A;  4TNU A;  1LOK A;  2Q51 A;  4ZYQ A;  2PVW A;  4B6Z A;  1HEE A;  3S9N A;  4IHM A;  1DE4 C;  3HLP A;  3WC6 A;  4MCQ A;  1CX8 A;  4KSI A;  2PRQ A;  2ZEN A;  3FEC A;  2V8G A;  3KL9 A;  2EWB A;  2JBJ A;  3NH4 A;  2HC9 A;  2XEF A;  1LAM A;  4NJQ A;  2PJ0 A;  2WYR A;  3FED A;  4R6T A;  3PB8 X;  4PXC A;  4EFD A;  4PXB A;  3FVL A;  4OID A;  2PIZ A;  4P10 A;  3SJG A;  3B7I A;  4Q7A A;  2ZEP A;  2FVG A;  3FMC A;  2PE3 A;  2O53 A;  2IJZ A;  1ARL A;  4MCS A;  2RB7 A;  1ELM P;  4RUH A;  3IO1 A;  1Q7L A;  3SI1 A;  4FBE A;  2ABZ A;  2POK A;  4ZY2 A;  1YW4 A;  3JRU A;  4ZY0 A;  3ISZ A;  2VL1 A;  1TKJ A;  1CG2 A;  2OOT A;  2ZEF A;  1FNO A;  4X2T A;  3BHX A;  2HB6 A;  1BAV A;  2QJ8 A;  1EE3 P;  2BOA A;  4P4I A;  3PFE A;  1BPN A;  3K2K A;  3S9L A;  2QYV A;  4IAV A;  2CTB A;  2ZEL A;  4JZ0 A;  1R43 A;  3D67 A;  4H2K A;  4P4B A;  1QMU A;  2C6C A;  3B3V A;  3D7H A;  4CPA A;  5K8N A;  2V77 A;  1TKH A;  1XJO A;  1LFW A;  3WT4 A;  4R8F A;  3H8F A;  2PJ3 A;  3KAS A;  3CPX A;  5JGF A;  4NGT A;  2PJ2 A;  4A38 A;  2AFX A;  4MCP A;  4TWE A;  1PCA A;  4F9U A;  2XEG A;  1Z8L A;  4K3N A;  4OKO A;  1F2O A;  2J9A A;  3S9M A;  4DYO A;  2V8D A;  2AFU A;  4R76 A;  2PVV A;  1VGY A;  2IMO A;  1LCP A;  4NGR A;  4P4J A;  4BD9 A;  3FJU A;  4P6Y A;  2PJ6 A;  3FEE A;  2PJB A;  4YU9 A;  3D7F A;  4R7M A;  2F7V A;  5LRJ A;  2PJ1 A;  2Q43 A;  1F57 A;  3D68 A;  5I4M A;  2AFZ A;  5CPA A;  2QVP A;  4FAI A;  2C6P A;  2ZEE A;  5ELY A;  2ZOF A;  5LRK A;  4NJR A;  2AFW A;  4A37 A;  3CDX A;  2NYQ A;  2ANP A;  3IWW A;  3PFO A;  1UWY A;  3KGQ A;  4NGM A;  3PB4 X;  3H8E A;  1ELL P;  3NA6 A;  3CPA A;  4UF4 A;  2PIY A;  4PXD A;  4MHZ A;  5D29 A;  3PB7 X;  2JBK A;  4OC0 A;  4MRI A;  3GUX A;  3CT9 A;  3BI1 A;  3IJ3 A;  1Y0R A;  3TX8 A;  5K8M A;  4AXV A;  2V8V A;  2PCU A;  3SI0 A;  5HVF A;  1ZLI A;  3B2Y A;  3PB9 X;  3WAB A;  1CPX A;  4NFR A;  1HDQ A;  4ZX9 A;  3LWU A;  2WZN A;  3KQX A;  3PBE A;  4UIB A;  2EK9 A;  3GB0 A;  1Y0Y A;  1CP6 A;  4OC1 A;  2GLJ A;  2ZEH A;  2BO9 A;  4NGS A;  2PJA A;  4P45 A;  4UIA A;  4NGP A;  2OR4 A;  1IGB A;  1NSA A;  3RBU A;  4PPZ A;  3NH8 A;  4X3R A;  1Y7E A;  2BCO A;  3FX6 A;  3KHZ A;  3QNV A;  5HXD A;  3NH5 A;  3VAT A;  3B3C A;  2V8H A;  1XMB A;  4O23 A;  3V7Z A;  5JH9 A;  2RFH A;  4DUK A;  4NGQ A;  2GLF A;  5LRG A;  3RZA A;  5HVG A;  2AFS A;  1PYT B;  1VHO A;  4EME A;  1OBR A; 
#chains in the Genus database with same CATH topology
 2CTC A;  1XE4 A;  1ZG9 A;  5EBV A;  3FBU A;  2BUE A;  4KVX A;  3BI0 A;  2NSM A;  4UA3 A;  4CS0 B;  2IZ3 A;  3NFZ A;  3MGD A;  4OP4 A;  2AKL A;  1X3W A;  1TXR A;  2Q04 A;  2FT0 A;  4PK3 A;  3BXM A;  2Z3L A;  3EC4 A;  4A39 A;  1M4D A;  1QVF Z;  1S7N A;  3VMG A;  4FUU A;  3IC1 A;  2I00 A;  3TE5 B;  4CYO A;  4CRZ B;  4PSW A;  2JA8 I;  5DWN A;  3KR5 A;  5G22 A;  5IX3 A;  2O4H A;  4S1T A;  1FDI A;  3L2N A;  4F8Z A;  4MHP A;  4DJL A;  3B3W A;  4B14 A;  2JDC A;  1USP A;  4MXU A;  2F4O A;  4A3F I;  1RTQ A;  5JM6 A;  2OTL 1;  4M85 A;  5D8N A;  3TC8 A;  3CXP A;  2PC1 A;  3CXC Y;  1Y1W I;  3S17 I;  4ONW A;  1YHQ Z;  2V8J A;  2G3T A;  3ZZI A;  3VTN A;  1M4G A;  3W6X A;  4OAE A;  1DTD A;  4B13 A;  1RXT A;  2M6N A;  3D2L A;  1CJW A;  2PRB A;  4OC4 A;  1USP B;  1LAN A;  1ZLH A;  1Q7Y 1;  3TOA A;  5A27 A;  4YGO A;  5F47 A;  3CMA Z;  2EO8 A;  5T64 A;  3KQZ A;  4NGN A;  4EVY A;  3NE8 A;  1N8R 2;  3H8G A;  4YWY A;  3OW2 Y;  2PJ8 A;  2PK7 A;  3DR6 A;  2VUG A;  5CBM A;  3D66 A;  2VPX A;  2IQ6 A;  1IYK A;  1KC8 1;  3IU1 A;  4HNX B;  1K8A 1;  2YNC A;  4MFZ A;  2PJ7 A;  4EWT A;  1QF8 A;  8CPA A;  4X5K A;  2DPS A;  1R3N A;  2VEZ A;  3RO0 A;  3SJX A;  4YFJ A;  2PJC A;  5A2Q b;  1K8A 2;  3S2H I;  2BL1 A;  2GU2 A;  3CCS 1;  4PV6 A;  1VQ8 1;  4A33 A;  2GTI A;  3D7G A;  1ON0 A;  4A3B I;  4CGL A;  3I56 1;  3KI9 A;  1GYT A;  2EUI A;  4W9Y A;  4IK2 A;  2JIR A;  2ARH A;  4Y7N I;  3NE7 A;  3KIH A;  4CGO A;  4BIN A;  3CCU 1;  1HEE A;  4M3S A;  4XNH B;  1DE4 C;  4A3K I;  1VQP 1;  3WC6 A;  1RO5 A;  4KSI A;  2EWB A;  2JBJ A;  2X7B A;  2W04 A;  3KIF A;  2XEF A;  4NJQ A;  3CCE Z;  2J8R A;  4AVB A;  3B7I A;  3S1N I;  2PE3 A;  4BY7 I;  4CAV A;  1U6M A;  3GTM S;  1ARL A;  2JEV A;  3IGR A;  2JA7 I;  2A4N A;  1ELM P;  2CNM A;  3SI1 A;  3JAM f;  3VWE A;  3JAM b;  3IF8 A;  1YQE A;  5KTC A;  4CRY B;  3ISZ A;  3CXC Z;  1TKJ A;  1YK3 A;  2ZEF A;  4X2T A;  3BHX A;  2WUU A;  1Q81 2;  1Z4E A;  2R7H A;  1YJN 1;  2YND A;  2Q7B A;  3F3F C;  3JVN A;  1BPN A;  3D67 A;  1KD1 1;  1TWA I;  3B8G A;  5J8F A;  1OZP A;  3B3V A;  3IFU A;  1X10 A;  1QSN A;  3CCM Z;  3HOW I;  1Q82 2;  4BBH A;  1XJO A;  2B63 I;  3WT4 A;  2PJ3 A;  3KAS A;  4C2X A;  5JGF A;  3KKW A;  4MD8 A;  4MFJ A;  3P2H A;  1M4I A;  1AA6 A;  3DDD A;  1P4N A;  1Z8L A;  2G0B A;  4H6U A;  4NBC A;  4Y49 B;  1PFT A;  2KI7 B;  4AB7 A;  2K3R A;  2DXQ A;  3IU2 A;  3H5Z A;  4LUA A;  1S72 Z;  4R76 A;  3FRM A;  2P3Y A;  4P4J A;  2F5I A;  1UFH A;  3CC2 1;  3BJ7 A;  1RLY A;  4R7M A;  3S1Q I;  2F7V A;  2PR1 A;  1XF8 A;  1F57 A;  5LL6 f;  2GAN A;  4HPS A;  5I4M A;  2AFZ A;  3S6H A;  5G1Z A;  2ZOF A;  1YVO A;  5HH1 A;  4KLV A;  4NJR A;  1SFO I;  4NSQ A;  4MON A;  1R57 A;  3KGQ A;  2P0W A;  4LQ6 A;  4KOX A;  3CCU Z;  1VQ5 Z;  4HH4 A;  1ELL P;  1N2F A;  5T6B A;  2WPX A;  2PIY A;  3F3P C;  4NB8 A;  4MHZ A;  2HV2 A;  4XX2 A;  1YX0 A;  1NSL A;  4R3K A;  3CME Z;  4E31 A;  3WR7 A;  3CT9 A;  3BI1 A;  4R57 A;  1M44 A;  4A3D I;  1VQ9 Z;  3GTK I;  1ZLI A;  5D1P A;  3B2Y A;  4FD6 A;  2E9H A;  3D2P A;  2JIP A;  3LWU A;  3T9Y A;  3G3S A;  2JS4 A;  4UIB A;  1CP6 A;  2ZEH A;  4UIA A;  2NAP A;  2R93 I;  1IGB A;  1NSA A;  2B3V A;  1B6B A;  2VI7 A;  3LD2 A;  3F0A A;  3KHZ A;  3NH5 A;  3B3C A;  1J4J A;  3CME 1;  3V7Z A;  3GY9 A;  3HOY I;  1M1D A;  1Z03 A;  4A3C I;  1TWH I;  4DK1 A;  4BXX I;  1VHO A;  3MON A;  3GKQ A;  1IY7 A;  4E2A A;  2XEI A;  4KOV A;  3K9U A;  2OTJ Z;  3KR4 A;  1I21 A;  4MBU A;  5J8C A;  1Q2Y A;  2EBJ A;  2GE3 A;  1TFI A;  4MD9 A;  2LIY A;  1TWF I;  3DSB A;  2Z10 A;  1WK4 A;  4ZY1 A;  3G6E 1;  5JPH A;  5HVH A;  2W03 A;  4WWV A;  5H86 A;  2PM9 A;  1ZO0 A;  2PJ5 A;  1QVG Z;  1HDU A;  5DS0 A;  1TF8 A;  2LEX A;  2OU2 A;  4HGY A;  4LX9 A;  4WJB A;  5THW A;  1ARM A;  1Z9U A;  4JXQ A;  4P4E A;  3A9L A;  3BLN A;  1XRY A;  4AVC A;  1K73 2;  1MJA A;  5C88 A;  3I9S A;  4JYW A;  2EK8 A;  3MRU A;  3J7A 4;  1JQG A;  5C4J I;  1X0T A;  1Z2L A;  4MI4 A;  1L0C A;  4E0A A;  2OB0 A;  2Z11 A;  5LYI A;  6CPA A;  2G3A A;  4CAX A;  3HUV A;  4HNW B;  3PEI A;  3FF3 A;  3TO9 A;  1ZB9 A;  4NBG A;  1W2B Z;  4X8I A;  1M90 1;  3CCM 1;  3DLJ A;  4MHY A;  1YJ9 Z;  1DL6 A;  3S6G A;  3PZJ A;  2Q4V A;  2PQ8 A;  3SJF A;  4UFV A;  1M4L A;  1S5K A;  3K9T A;  4MMO A;  4M6G A;  1KUV A;  4GXH A;  3N5F A;  2ZOG A;  4OC5 A;  1FY7 A;  5H84 A;  4DGL A;  2HF1 A;  1VLA A;  4A3J I;  3CCJ Z;  4MY0 A;  5LYF A;  3ISX A;  1I12 A;  2QA4 1;  1YW6 A;  4ZGY B;  3D7D A;  3J81 f;  1X12 A;  1Q2C A;  3LAC A;  3DR8 A;  4P4D A;  1GHE A;  5G21 A;  3FNC A;  3DGV A;  1IU8 A;  4OIW A;  4F0Y A;  4CAW A;  1VQO Z;  1YUA A;  2R6M A;  5IB9 A;  3CC7 Z;  4AG9 A;  2Q4Z A;  1VIX A;  2ZEG A;  4UEE A;  3SJE A;  2EGT A;  1YUK A;  2FL4 A;  2GFQ A;  5C3E I;  3FKI I;  3VH9 A;  3RAM A;  1XOV A;  3IIB A;  4CGP A;  3JUW A;  1IID A;  2C1C A;  2IL4 A;  2CIJ A;  2E2I I;  4F0X A;  4ZYQ A;  2YNE A;  4B5O A;  4IHM A;  4E2W A;  4A95 A;  3HLP A;  3N7Z A;  4MCQ A;  3C26 A;  2PRQ A;  2FIA A;  3FEC A;  2Q7S A;  3KL9 A;  3FQM A;  4CYN A;  3CXQ A;  2WYR A;  1XMT A;  4NBF A;  4KSA A;  4R6T A;  4BY1 I;  3GIU A;  4P10 A;  4Q7A A;  1VQ7 Z;  2FVG A;  3I07 A;  1S7L A;  3R1K A;  2H85 A;  4U5Y A;  4NCZ A;  4MCS A;  3S6F A;  3RZD I;  5IV0 A;  4UFW A;  4R9M A;  3IO1 A;  4FBE A;  3J81 b;  2VPW A;  2YAD A;  4E2Z A;  3PO2 I;  2POK A;  1YW4 A;  4KS9 A;  4MJ8 A;  5EMI A;  1CG2 A;  5T67 A;  4NH1 C;  2HB6 A;  2QJ8 A;  2BSW A;  4NBE A;  2K5R A;  2M48 A;  4P4I A;  3S1M I;  4XPK A;  3RYO A;  1KRL A;  1Q7Y 2;  4DNC A;  3S9L A;  2QR1 B;  4IAV A;  2CTB A;  3D9X A;  1VQL 1;  4DQY B;  3CMA 1;  4H2K A;  3CD6 1;  2C6C A;  4FD4 A;  1QVG Y;  3H0G I;  2JIO A;  3CCR 1;  4CPA A;  5K8N A;  2V77 A;  4JXR A;  2E2H I;  2QML A;  5HMN A;  1LFW A;  4ORF A;  1XEB A;  4NGT A;  3QWU A;  2Y0S A;  2PJ2 A;  2QIR A;  4L89 A;  4II9 A;  4MCP A;  3R9E A;  4F9U A;  1WJ2 A;  3VMI A;  1LRZ A;  2Q0Y A;  3S9M A;  5AG7 A;  3BG0 B;  5KTA A;  4C7H A;  3EFA A;  2PR8 A;  2Z3O A;  1S60 A;  2IMO A;  3TOB A;  4BD9 A;  4P6Y A;  2PJ6 A;  4QB9 A;  1VQ7 1;  4YU9 A;  5AG4 A;  2PJ1 A;  2REF A;  2E2J I;  1JWQ A;  4BBS I;  1V0C A;  2QVP A;  1MJB A;  4FAI A;  2VUM I;  2ZEE A;  4RVF A;  5F48 A;  1Z8T A;  5LRK A;  3S14 I;  5AG6 A;  2NYQ A;  1YJ9 1;  2ANP A;  2VQY A;  1VQ6 Z;  3TDH B;  4NGM A;  3PB4 X;  2B4B A;  2FXF A;  3GYA A;  4CGM A;  2Z3P A;  3CC4 1;  3EED A;  4EWC A;  3GUX A;  3QB8 A;  5ISV A;  5K8M A;  3D3S A;  2CNS A;  2KCW A;  5IP9 I;  3GTQ I;  4AXV A;  2CNT A;  1VQ8 Z;  5HVF A;  4FD7 A;  2B4D A;  1QYP A;  4NFR A;  3I3G A;  1HDQ A;  4ZX9 A;  1N8R 1;  4PK2 A;  4M6H A;  1ZH1 A;  5D1O A;  2P28 A;  2EK9 A;  3SXO A;  3GTG I;  5IT9 b;  2QEX 1;  4KOU A;  2HUZ A;  4NGS A;  4HKF A;  5E96 A;  1NUI A;  1Z8X A;  3PP9 A;  3F5B A;  4H89 A;  4PPZ A;  3FX6 A;  2P6F A;  2OZG A;  5HXD A;  3TE4 A;  3VAT A;  2JIM A;  4O23 A;  4A3L I;  4A2Z A;  1YRE A;  4KOY A;  3S16 I;  4NGQ A;  4U9Z A;  2AFS A;  1Y1V S;  1OBR A;  4CAE A;  5J1Q A;  3NDI A;  5LYL A;  3G4S 1;  4Z65 A;  4F9V A;  2ODF A;  3EO4 A;  2R92 I;  4OME A;  2DF5 A;  1WW9 A;  4XNH C;  1YIJ Z;  1IYL A;  3S15 I;  3GTP I;  2QRD B;  1RQF A;  1QQ9 A;  1ZB8 A;  2ZW7 A;  3DNS A;  1XBU A;  2JMO A;  4CYP A;  1QXF A;  3P2F A;  1VQK 1;  1LQL A;  3B3T A;  3D4U A;  5AG5 A;  2VZY A;  4MFK A;  5F09 A;  4UEF A;  5LYD A;  1ZG7 A;  4MHN A;  2RPR A;  4JWP A;  4NBA A;  1AYE A;  3CCL 1;  4NF1 A;  4P44 A;  2RT9 A;  3HOV I;  2CF4 A;  2WB1 A;  2FS5 A;  3H3V J;  1X3Z A;  4CAF A;  4FWU A;  5JQ4 A;  4PXE A;  3CCV 1;  2ZPA A;  5BWA B;  5KTD A;  3WC7 A;  3PO3 S;  2DE7 A;  4E33 A;  3CXS A;  5GCN A;  4MH4 A;  4R3L A;  2BEI A;  2Q4Y A;  2NVQ I;  3VAR A;  2F8H A;  3I55 Z;  7CPA A;  3GLJ A;  3KHX A;  2AFM A;  4XPL A;  1YHQ 1;  3FH4 A;  1S7F A;  3I55 1;  2DPT A;  3NDJ A;  3KZW A;  4KOR A;  2WAQ A;  3G4S Z;  4L8A A;  3I1U A;  1IOF A;  1WWZ A;  3T8W A;  1BLL E;  3ESW A;  2BJO A;  3B3S A;  4KUB A;  2PJ9 A;  1Y9K A;  2ZEM A;  1TWG I;  5FVJ A;  1KD1 2;  2OTL Z;  3SXN A;  2JEW A;  4HGZ A;  3TO7 A;  3IX0 A;  1XFO A;  1TKF A;  1Y8C A;  3U50 C;  5CNP A;  4H6Z A;  3CCL Z;  2R98 A;  2REE A;  2JIQ A;  3CCQ Z;  4UWJ A;  3IWG A;  2HQY A;  2V3V A;  2V45 A;  5FLM I;  3WC5 A;  1L1O C;  1Z8W A;  4E2X A;  4UEZ A;  3R9G A;  1S7K A;  2JR6 A;  4NOZ A;  1BO4 A;  5F46 A;  1ZG8 A;  1YIJ 1;  4B5P A;  4LQG A;  2CY2 A;  2B5G B;  3P5J B;  1F2P A;  4U9Y A;  4ZBG A;  4TNU A;  2Q51 A;  4B6Z A;  2FSR A;  2YNC C;  3GTO I;  2F4M A;  2VBQ A;  1R9T I;  4NBB A;  1YJW 1;  2V8G A;  1FDO A;  3QAH A;  3VB9 A;  3GKR A;  1Z01 A;  3RNZ A;  1S7M A;  4UFX A;  3FB3 A;  5IP7 I;  2PJ0 A;  2QA4 Z;  2VF1 A;  1BOB A;  1K83 I;  3E0K A;  3PB8 X;  4EFD A;  3FVL A;  4OID A;  2HU9 A;  3TO6 A;  3SJG A;  1KZF A;  2ZEP A;  3FMC A;  3R9F A;  3IR7 A;  3CPW Z;  2B3U A;  1P0H A;  1IB1 E;  4NBD A;  3LUS A;  2QEX Z;  2OOY B;  1S3Z A;  3T4N B;  4RUH A;  4KVM E;  2ABZ A;  3BG1 B;  3JRU A;  2D4O A;  2OOT A;  1FNO A;  4E32 A;  1BAV A;  1EE3 P;  5C4X I;  2BOA A;  3TTH A;  3IWE A;  4A31 A;  2JLM A;  1CM0 A;  3V8I A;  1VQ6 1;  3CD6 Z;  3K2K A;  2PMZ A;  2QYV A;  2ZEL A;  1Y1V I;  5FLX f;  1R43 A;  5EC4 A;  4JJX A;  1M90 2;  2RC4 A;  2QLV B;  4C2Z A;  1YJN Z;  1TKH A;  2OZU A;  4R8F A;  3H8F A;  3CPX A;  4QVT A;  4BMH A;  4MD7 A;  2EVN A;  1K9M 2;  4R87 A;  4UCM A;  3EER A;  1NE9 A;  2AFX A;  1PCA A;  2C27 A;  2XEG A;  1VQ4 1;  2J9A A;  3FQQ A;  4AVA A;  4DYO A;  2AFU A;  3R96 A;  2PVV A;  1K73 1;  4KZT A;  2O28 A;  3G6E Z;  3FEE A;  2PJB A;  1KQS Y;  3TT2 A;  2RHB A;  5LRJ A;  5C44 I;  2Q43 A;  1PU9 A;  3D68 A;  1KQS Z;  4J3G A;  4KOT A;  4KOW A;  2C6P A;  3CZX A;  5IB0 A;  1JJ2 Z;  1NP6 A;  4QC6 A;  3S1R I;  1QVF Y;  3I4N I;  2AFW A;  1VQ4 Z;  2Q44 A;  1VQM Z;  2GTH A;  3CPW Y;  4CGN A;  4K30 A;  3H8E A;  1QSR A;  3F8K A;  1NJI 2;  4UF4 A;  1SIW A;  1K9M 1;  4PXD A;  3D6W A;  5D29 A;  3PB7 X;  2R7Z I;  4A3E I;  3VMH A;  3IJ3 A;  4X6A I;  2J6A A;  1Q81 1;  1B87 A;  3TX8 A;  4C2Y A;  1A2Z A;  4MY3 A;  3EY5 A;  1VQL Z;  4Y49 C;  4CYQ A;  4IF5 A;  2OZH A;  2OTJ 1;  1Q86 2;  3SI0 A;  1WII A;  1W2B Y;  3KQX A;  4CL1 A;  1Y0Y A;  1VQN Z;  4KLW A;  3JTK A;  2PJA A;  1XIX A;  4A3M I;  4E8O A;  3OW2 Z;  3J80 b;  4RN7 A;  3RBU A;  1RO2 A;  3NH8 A;  4ONU A;  4X3R A;  1Y7E A;  4M6I A;  4E30 A;  3EXN A;  2K5T A;  1QSO A;  4RS2 A;  4YRH A;  2V8H A;  2LFU A;  5JH9 A;  2RFH A;  4DUK A;  4B12 A;  2JNY A;  1RO0 A;  5LRG A;  3FIX A;  5HVG A;  2AJ6 A;  2NVT I;  4EME A;  1Q86 1;  3R95 A;  2ATR A;  2ZAE B;  2PDO A;  2QEC A;  3GTJ I;  5AGE A;  4HNY B;  1VHE A;  1KUY A;  2PJ4 A;  4QBJ A;  2R8V A;  4B10 A;  4OAD A;  4I49 A;  5K8P A;  3S6K A;  1I50 I;  5DWM A;  2VZZ A;  2I3C A;  2RIQ A;  2R1I A;  2ZW4 A;  1FT7 A;  1QST A;  3PB6 X;  1YIT 1;  4NXY A;  4PQA A;  3I56 Z;  4A3G I;  2G9D A;  4MHD A;  1M1K 1;  3I4M I;  2J8N A;  2RBL A;  4JLY A;  3HOX I;  1JWH C;  3LMS A;  5C82 A;  3GCF A;  3SI2 A;  2OOX B;  1BPM A;  3ZJ0 A;  4QTU A;  1AUG A;  2QKD A;  3BJ8 A;  5A28 A;  1CP7 A;  2DE5 A;  2ZEO A;  2ZED A;  2YGW A;  3B35 A;  2ZW5 A;  2WPW A;  3V38 A;  2DEA A;  1I1D A;  4NB9 A;  2D4P A;  2FIW A;  1KC8 2;  1Y7R A;  5K8O A;  1YI2 Z;  3G71 Z;  2Z0Z A;  1TF9 A;  5AN9 F;  3CC4 Z;  3PBB A;  1AMP A;  1LAP A;  4MCR A;  2VXK A;  4G1P A;  1CPS A;  1VQ5 1;  1YSJ A;  4RI1 A;  1YGH A;  1SQH A;  2B58 A;  3CCV Z;  3PO3 I;  4KVO E;  1H8L A;  4OC2 A;  1PUA A;  2XEJ A;  4A93 I;  5A2Q f;  5FLX b;  3IFE A;  5I0C A;  1Q2D A;  2VPZ A;  2GIV A;  1CBX A;  3PRT A;  2QRC B;  1IIC A;  4GM5 A;  2FE7 A;  1Z5R A;  2VPY A;  4NEX A;  2Z3M A;  4OC3 A;  2GRE A;  3D2M A;  3G71 1;  4QUS A;  1I3Q I;  1JJ2 Y;  4PSX A;  3CCE 1;  3UY5 A;  4C68 A;  3MN8 A;  1YLO A;  3RZO I;  2C6G A;  2ZW6 A;  2CXA A;  4P4F A;  4ZI6 A;  2AE6 A;  3HKZ A;  3W91 A;  1KWM A;  1VQN 1;  2P6G A;  2AFO A;  4JD6 A;  4A30 A;  2V8K A;  3FYN A;  3TCV A;  3QAY A;  4A94 A;  1N71 A;  3IEH A;  1TIQ A;  1YME A;  3K7A I;  4IUS A;  4FD5 A;  4ZX8 A;  4NBH A;  4MFL A;  1YJW Z;  1LOK A;  2Y0M A;  3SHP A;  2PVW A;  3VWD A;  2JDD A;  1VQO 1;  3S9N A;  4RVD A;  1VQK Z;  2ZXV A;  4RS4 A;  2JA5 I;  2B5G A;  4QTT A;  1CX8 A;  4RVG A;  3LOD A;  2JA6 I;  2ZEN A;  3TFY A;  4UCP A;  3NH4 A;  4AG7 A;  2HC9 A;  3GTM I;  1LAM A;  1Z4R A;  4B5P B;  3Q87 A;  3FED A;  3CCS Z;  4PXC A;  2G2K A;  4PXB A;  2PIZ A;  3CC7 1;  1Q16 A;  4MFP A;  1M1K 2;  3M4O I;  2PSW A;  2J8M A;  2O53 A;  1Y9W A;  2IJZ A;  4XPD C;  2DE6 A;  1RO4 A;  2RB7 A;  4KSF A;  3CCQ 1;  1MK4 A;  1S72 1;  2IV2 X;  4AYB A;  1Q7L A;  4XPD B;  1NJI 1;  3D8P A;  4ZY2 A;  4ZY0 A;  4RVH A;  5F49 A;  2VL1 A;  1WZN A;  3CCJ 1;  1Q82 1;  2IZ4 A;  3MZK B;  3CCR Z;  1VKC A;  1VQM 1;  3PFE A;  1NMT A;  4A3I I;  3HOU I;  1KUX A;  5D1O B;  4JZ0 A;  1RNI A;  1VQ9 1;  4P4B A;  2AYD A;  1QMU A;  1P9N A;  3D7H A;  3GTL I;  4KOS A;  3MZL B;  1YI2 1;  3CQZ I;  2Z3K A;  4A38 A;  4TWE A;  3FXT A;  1I6H I;  4K3N A;  4OKO A;  1F2O A;  2OH1 A;  3J80 f;  2V8D A;  3OWC A;  1WCM I;  4RV9 A;  4OLL A;  1VGY A;  1LCP A;  4C7I A;  4NGR A;  3PGP A;  3FJU A;  2WSA A;  4UBR A;  3H4Q A;  3D7F A;  3G8W A;  3CC2 Z;  4MFQ A;  3S2D I;  5CPA A;  4KUA A;  2E7Z A;  5IT9 f;  5ELY A;  4GS4 A;  2B4D B;  4A32 A;  2V8I A;  1IOI A;  2OZK A;  4A37 A;  3CDX A;  4B11 A;  2YU9 I;  2NVX I;  3IWW A;  3PFO A;  1UWY A;  2Z3N A;  2I79 A;  2KPI A;  3NA6 A;  2FCK A;  3CPA A;  1ML8 A;  1VHS A;  1YR0 A;  4Y52 I;  2JUB A;  2JBK A;  4OC0 A;  4MRI A;  3T90 A;  1Y0R A;  1K4J A;  2V8V A;  2PCU A;  3PB9 X;  3WAB A;  1CPX A;  2WZN A;  3PBE A;  3GB0 A;  4Q38 A;  4OC1 A;  2GLJ A;  2BO9 A;  4P45 A;  2P6E A;  2H5M A;  1YLE A;  3W6S A;  4NGP A;  4BBR I;  2OR4 A;  4UWI A;  4F6A A;  2NVY I;  1QSM A;  2QRE B;  2BCO A;  3QNV A;  5CM2 M;  1XMB A;  3M3Y I;  3HOZ I;  1YIT Z;  2GLF A;  1VQP Z;  4E2Y A;  4UCN A;  1Z02 A;  3RZA A;  2NMT A;  1TWC I;  1YVK A;  1PYT B;  4Q36 A;  1MJ9 A;  5G20 A; 
#chains in the Genus database with same CATH homology
 5J1Q A;  2CTC A;  3NDI A;  5LYL A;  3G4S 1;  3GKQ A;  1IY7 A;  4F9V A;  4Z65 A;  1ZG9 A;  2R92 I;  3GTJ I;  2XEI A;  4OME A;  3BI0 A;  2OTJ Z;  2NSM A;  1WW9 A;  1VHE A;  1YIJ Z;  2IZ3 A;  3S15 I;  3GTP I;  3KR4 A;  2QRD B;  1RQF A;  1QQ9 A;  2PJ4 A;  3NFZ A;  1ZB8 A;  4OP4 A;  2AKL A;  1XBU A;  1X3W A;  2JMO A;  1TXR A;  5K8P A;  1TFI A;  4MD9 A;  2LIY A;  1TWF I;  1VQK 1;  1LQL A;  3BXM A;  1I50 I;  3B3T A;  4ZY1 A;  3D4U A;  3G6E 1;  5HVH A;  2I3C A;  2W03 A;  2RIQ A;  4WWV A;  1FT7 A;  4A39 A;  3PB6 X;  1YIT 1;  5F09 A;  4UEF A;  5LYD A;  1ZG7 A;  4PQA A;  2PM9 A;  3I56 Z;  4A3G I;  2G9D A;  1QVF Z;  1M1K 1;  2PJ5 A;  3I4M I;  3VMG A;  4MHN A;  1QVG Z;  1HDU A;  5DS0 A;  4FUU A;  2RBL A;  2RPR A;  1TF8 A;  3IC1 A;  3TE5 B;  4NBA A;  1AYE A;  3CCL 1;  3HOX I;  4HGY A;  4WJB A;  5THW A;  2JA8 I;  1JWH C;  3KR5 A;  3LMS A;  1ARM A;  3GCF A;  2O4H A;  4S1T A;  3SI2 A;  4P44 A;  4P4E A;  2OOX B;  3L2N A;  1BPM A;  4F8Z A;  4MHP A;  2RT9 A;  4DJL A;  4QTU A;  1XRY A;  3B3W A;  3HOV I;  1K73 2;  2QKD A;  1USP A;  4MXU A;  2F4O A;  4A3F I;  1RTQ A;  1CP7 A;  2DE5 A;  2OTL 1;  2ZED A;  2ZEO A;  5D8N A;  5JM6 A;  3B35 A;  3TC8 A;  2CF4 A;  2WB1 A;  3CXC Y;  3H3V J;  4JYW A;  3V38 A;  2EK8 A;  2DEA A;  3MRU A;  1Y1W I;  3J7A 4;  4NB9 A;  1JQG A;  3S17 I;  5C4J I;  1X0T A;  1X3Z A;  1Z2L A;  4ONW A;  1YHQ Z;  4FWU A;  2V8J A;  1KC8 2;  4PXE A;  5LYI A;  3CCV 1;  6CPA A;  3VTN A;  5K8O A;  1YI2 Z;  3G71 Z;  3HUV A;  3PEI A;  1TF9 A;  5AN9 F;  3CC4 Z;  3PBB A;  1AMP A;  1LAP A;  4MCR A;  3WC7 A;  3PO3 S;  2DE7 A;  1DTD A;  4E33 A;  3FF3 A;  4G1P A;  1ZB9 A;  4MH4 A;  4NBG A;  1W2B Z;  1CPS A;  2M6N A;  1VQ5 1;  1M90 1;  1YSJ A;  4X8I A;  3CCM 1;  4OC4 A;  3DLJ A;  1USP B;  1LAN A;  2NVQ I;  4MHY A;  1ZLH A;  3VAR A;  3CCV Z;  3PO3 I;  2F8H A;  1H8L A;  4OC2 A;  1YJ9 Z;  1Q7Y 1;  3I55 Z;  7CPA A;  1DL6 A;  2XEJ A;  4A93 I;  3GLJ A;  5A2Q f;  3SJF A;  3KHX A;  5FLX b;  2AFM A;  3CMA Z;  3IFE A;  1M4L A;  1YHQ 1;  3FH4 A;  5T64 A;  3I55 1;  3KZW A;  3NDJ A;  3K9T A;  3KQZ A;  2WAQ A;  3G4S Z;  4NGN A;  4MMO A;  3I1U A;  3T8W A;  1BLL E;  3ESW A;  2BJO A;  3B3S A;  2PJ9 A;  1N8R 2;  1CBX A;  2ZEM A;  1TWG I;  3PRT A;  2QRC B;  3N5F A;  3H8G A;  4GM5 A;  4YWY A;  3OW2 Y;  1Z5R A;  1KD1 2;  2PJ8 A;  2OTL Z;  2PK7 A;  2ZOG A;  4OC5 A;  2JEW A;  2VUG A;  5CBM A;  3D66 A;  4HGZ A;  4OC3 A;  2IQ6 A;  3IX0 A;  1KC8 1;  2GRE A;  4DGL A;  2HF1 A;  3G71 1;  1VLA A;  4A3J I;  1I3Q I;  3CCJ Z;  1JJ2 Y;  1TKF A;  1XFO A;  5LYF A;  3U50 C;  3ISX A;  1K8A 1;  3CCE 1;  2QA4 1;  1YW6 A;  3CCL Z;  3MN8 A;  3D7D A;  1YLO A;  3CCQ Z;  3J81 f;  3RZO I;  2PJ7 A;  4EWT A;  1QF8 A;  2C6G A;  8CPA A;  4P4F A;  4ZI6 A;  4P4D A;  3HKZ A;  3DGV A;  1KWM A;  5FLM I;  1VQN 1;  3WC5 A;  1L1O C;  1R3N A;  4OIW A;  1VQO Z;  1YUA A;  2AFO A;  2R6M A;  4E2X A;  5IB9 A;  4UEZ A;  3CC7 Z;  2V8K A;  2Q4Z A;  1VIX A;  2ZEG A;  2PJC A;  4UEE A;  3SJE A;  2EGT A;  5A2Q b;  3SJX A;  1K8A 2;  3S2H I;  1YUK A;  2GU2 A;  3CCS 1;  2JR6 A;  4NOZ A;  5C3E I;  1VQ8 1;  2GTI A;  4A94 A;  3IEH A;  1YME A;  3FKI I;  3D7G A;  1ZG8 A;  1YIJ 1;  3K7A I;  3VH9 A;  3RAM A;  4LQG A;  4A3B I;  3IIB A;  3P5J B;  4ZX8 A;  1F2P A;  3I56 1;  3KI9 A;  2C1C A;  4NBH A;  1GYT A;  1YJW Z;  4W9Y A;  4IK2 A;  2CIJ A;  4TNU A;  4Y7N I;  2E2I I;  3KIH A;  1LOK A;  2Q51 A;  4ZYQ A;  3CCU 1;  2PVW A;  4B6Z A;  1HEE A;  1VQO 1;  3S9N A;  3GTO I;  4RVD A;  1VQK Z;  4IHM A;  2F4M A;  4E2W A;  1DE4 C;  4RS4 A;  4A3K I;  1VQP 1;  3HLP A;  2JA5 I;  3WC6 A;  4QTT A;  1R9T I;  1CX8 A;  4KSI A;  4RVG A;  4NBB A;  1YJW 1;  2PRQ A;  4MCQ A;  2JA6 I;  2ZEN A;  3FEC A;  2V8G A;  3VB9 A;  3KL9 A;  2EWB A;  2JBJ A;  1Z01 A;  3FQM A;  3NH4 A;  1S7M A;  2W04 A;  3KIF A;  2HC9 A;  3GTM I;  2XEF A;  1LAM A;  5IP7 I;  2PJ0 A;  2WYR A;  4NJQ A;  2QA4 Z;  3CCE Z;  4NBF A;  3Q87 A;  3FED A;  2VF1 A;  4R6T A;  1K83 I;  3CCS Z;  3PB8 X;  4PXC A;  4BY1 I;  2G2K A;  4EFD A;  4PXB A;  3FVL A;  4OID A;  2HU9 A;  2PIZ A;  4P10 A;  3SJG A;  3CC7 1;  3B7I A;  4Q7A A;  1VQ7 Z;  3S1N I;  2FVG A;  2ZEP A;  1M1K 2;  3FMC A;  3I07 A;  2PE3 A;  4BY7 I;  3CPW Z;  3M4O I;  2H85 A;  4NBD A;  2O53 A;  3LUS A;  2QEX Z;  3GTM S;  1ARL A;  2IJZ A;  4MCS A;  2DE6 A;  1RO4 A;  2RB7 A;  2OOY B;  3CCQ 1;  3RZD I;  2JA7 I;  1S72 1;  4AYB A;  3T4N B;  1ELM P;  4RUH A;  3IO1 A;  1Q7L A;  3SI1 A;  3JAM f;  4FBE A;  2ABZ A;  1NJI 1;  3J81 b;  2YAD A;  3BG1 B;  4E2Z A;  3JAM b;  3PO2 I;  2POK A;  4ZY2 A;  1YW4 A;  3IF8 A;  3JRU A;  4ZY0 A;  4RVH A;  3ISZ A;  2VL1 A;  3CXC Z;  1TKJ A;  1CG2 A;  2OOT A;  5T67 A;  3CCJ 1;  2ZEF A;  1FNO A;  4X2T A;  4NH1 C;  4E32 A;  1Q82 1;  3BHX A;  2HB6 A;  1Q81 2;  1BAV A;  2QJ8 A;  1EE3 P;  2IZ4 A;  5C4X I;  2BOA A;  4NBE A;  2K5R A;  2M48 A;  4P4I A;  3MZK B;  3CCR Z;  1YJN 1;  3S1M I;  1VQM 1;  3PFE A;  4A3I I;  3F3F C;  1VQ6 1;  3CD6 Z;  3HOU I;  5D1O B;  1KRL A;  1BPN A;  1Q7Y 2;  3K2K A;  2PMZ A;  2QR1 B;  2QYV A;  4IAV A;  2CTB A;  3S9L A;  3D9X A;  2ZEL A;  1Y1V I;  5FLX f;  1R43 A;  1RNI A;  3D67 A;  4JZ0 A;  1KD1 1;  1VQ9 1;  1TWA I;  1VQL 1;  4DQY B;  3CMA 1;  4H2K A;  4P4B A;  1M90 2;  1QMU A;  1P9N A;  2QLV B;  3CD6 1;  2C6C A;  1QVG Y;  3H0G I;  3B3V A;  3IFU A;  3CCM Z;  3HOW I;  3D7H A;  1Q82 2;  3CCR 1;  1YJN Z;  4CPA A;  5K8N A;  2V77 A;  1TKH A;  1XJO A;  2E2H I;  2B63 I;  1LFW A;  3WT4 A;  4R8F A;  3H8F A;  2PJ3 A;  3KAS A;  3CPX A;  5JGF A;  4MD7 A;  4NGT A;  3GTL I;  3QWU A;  2Y0S A;  3MZL B;  4MD8 A;  1K9M 2;  1YI2 1;  2PJ2 A;  3EER A;  3CQZ I;  4A38 A;  2AFX A;  4MCP A;  4TWE A;  1PCA A;  4F9U A;  2XEG A;  1I6H I;  1Z8L A;  4K3N A;  3VMI A;  1VQ4 1;  4OKO A;  4NBC A;  1F2O A;  1PFT A;  2KI7 B;  2J9A A;  2K3R A;  3S9M A;  3FQQ A;  3BG0 B;  3J80 f;  4DYO A;  1S72 Z;  2V8D A;  2AFU A;  1WCM I;  4RV9 A;  4R76 A;  2PVV A;  1K73 1;  2P3Y A;  1VGY A;  2IMO A;  1LCP A;  4NGR A;  4P4J A;  4BD9 A;  3FJU A;  3CC2 1;  4P6Y A;  3G6E Z;  2PJ6 A;  3FEE A;  1VQ7 1;  2PJB A;  1KQS Y;  4YU9 A;  3D7F A;  1RLY A;  4R7M A;  3S1Q I;  2F7V A;  2RHB A;  5LRJ A;  2PJ1 A;  5C44 I;  2Q43 A;  1F57 A;  5LL6 f;  3D68 A;  3CC2 Z;  2E2J I;  3S2D I;  4BBS I;  1KQS Z;  5I4M A;  2AFZ A;  5CPA A;  2QVP A;  4FAI A;  2C6P A;  2VUM I;  2ZEE A;  4RVF A;  5ELY A;  5IT9 f;  2ZOF A;  1JJ2 Z;  1NP6 A;  4NJR A;  5LRK A;  2V8I A;  3S1R I;  3S14 I;  1QVF Y;  2OZK A;  3I4N I;  4UIB A;  2AFW A;  1SFO I;  1VQ4 Z;  4A37 A;  3CDX A;  1VQM Z;  4MON A;  2YU9 I;  2NYQ A;  1YJ9 1;  2NVX I;  2ANP A;  2GTH A;  1VQ6 Z;  3IWW A;  3PFO A;  3TDH B;  3CPW Y;  1UWY A;  3KGQ A;  4NGM A;  3PB4 X;  3CCU Z;  1VQ5 Z;  4HH4 A;  3H8E A;  2KPI A;  1N2F A;  1ELL P;  3NA6 A;  5T6B A;  3CPA A;  1NJI 2;  4UF4 A;  2PIY A;  3F3P C;  1K9M 1;  4PXD A;  3D6W A;  4NB8 A;  3CC4 1;  4MHZ A;  5D29 A;  4XX2 A;  1ML8 A;  3EED A;  3PB7 X;  2R7Z I;  2JUB A;  4EWC A;  4Y52 I;  3CME Z;  2JBK A;  4A3E I;  4E31 A;  4MRI A;  3VMH A;  3CT9 A;  3GUX A;  4OC0 A;  3BI1 A;  3IJ3 A;  4X6A I;  2J6A A;  1Q81 1;  1Y0R A;  3TX8 A;  5K8M A;  4A3D I;  5IP9 I;  3GTQ I;  2V8V A;  1VQ9 Z;  1VQL Z;  4AXV A;  3GTK I;  2PCU A;  1VQ8 Z;  2OTJ 1;  1Q86 2;  5HVF A;  3SI0 A;  1WII A;  1ZLI A;  5D1P A;  3B2Y A;  1QYP A;  2E9H A;  3PB9 X;  3WAB A;  1CPX A;  4NFR A;  1HDQ A;  4ZX9 A;  1N8R 1;  3LWU A;  1W2B Y;  2WZN A;  3KQX A;  2JS4 A;  4CL1 A;  1ZH1 A;  5D1O A;  3PBE A;  2P28 A;  2EK9 A;  3GTG I;  5IT9 b;  2QEX 1;  1CP6 A;  1VQN Z;  1Y0Y A;  3GB0 A;  4OC1 A;  2GLJ A;  2ZEH A;  2BO9 A;  4NGS A;  2PJA A;  4P45 A;  4UIA A;  4A3M I;  1NUI A;  3OW2 Z;  3J80 b;  4NGP A;  4BBR I;  2R93 I;  2OR4 A;  1IGB A;  2NVY I;  1NSA A;  1RO2 A;  4PPZ A;  3RBU A;  2QRE B;  3NH8 A;  4X3R A;  1Y7E A;  2BCO A;  4E30 A;  3FX6 A;  3KHZ A;  3QNV A;  5HXD A;  5CM2 M;  3NH5 A;  3VAT A;  3B3C A;  2V8H A;  3CME 1;  2LFU A;  4A3L I;  1XMB A;  4O23 A;  3V7Z A;  5JH9 A;  2RFH A;  3M3Y I;  4DUK A;  3S16 I;  2JNY A;  4NGQ A;  3HOY I;  1YIT Z;  3HOZ I;  1VQP Z;  2GLF A;  1Z03 A;  4E2Y A;  1RO0 A;  4A3C I;  5LRG A;  1Z02 A;  3RZA A;  5HVG A;  2AFS A;  1TWC I;  1TWH I;  4DK1 A;  2NVT I;  4BXX I;  1PYT B;  1VHO A;  1Y1V S;  4EME A;  1Q86 1;  1OBR A;  2ZAE B;  3MON A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...