2I3CA

Crystal structure of an aspartoacylase from homo sapiens
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
302
structure length
302
Chain Sequence
EHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartoacylase
publication title Structure of aspartoacylase, the brain enzyme impaired in Canavan disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 83
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2006-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2i3cA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2i3cA01
2CF4A 4P4EA 2I3CA 4P4BA 1FT7A 1TF8A 1EE3P 2GLJA 2RB7A 1ZG8A 2PVVA 3H8EA 5LRGA 1TKHA 4R8FA 2V8GA 4UF4A 4W9YA 4DYOA 3CDXA 3TC8A 4F8ZA 2PE3A 3PFEA 5D8NA 2AFXA 3D7HA 5K8PA 3KI9A 1LCPA 4JZ0A 5JM6A 4Z65A 1NSAA 2XEIA 3BI1A 4X3RA 1AYEA 2PJ3A 2NYQA 3FF3A 4OMEA 5HVHA 1RTQA 4O23A 2V8HA 4A39A 3MRUA 2PIZA 4ZYQA 3B3TA 4JYWA 2ZEPA 4FAIA 3MN8A 1ELLP 2V8DA 4PXCA 3I1UA 5HVFA 1VIXA 3FJUA 4P4DA 5IB9A 3PB4X 1IGBA 4ONWA 3CT9A 4ZI6A 7CPAA 5HVGA 4UIAA 3SJEA 1Y0YA 4KSIA 4OC3A 4NGTA 4OC0A 3LMSA 4R6TA 2PJ4A 1CPSA 2WZNA 3BHXA 3KQZA 1LAPA 4MHYA 2XEGA 4UEFA 4ZY2A 1AMPA 3KZWA 3IFEA 1Z5RA 3FEEA 2HB6A 4K3NA 2ZOFA 1F2OA 3B3CA 3T8WA 4IHMA 2AFUA 1PCAA 3BI0A 3JRUA 4X8IA 4MHNA 4IAVA 3KR4A 4MCRA 4NGSA 1QQ9A 3VH9A 2QYVA 3N5FA 4FBEA 5CBMA 2O53A 4ZX9A 3B7IA 5K8OA 2EK9A 2PJAA 4OC2A 1ELMP 5J1QA 3V7ZA 3NH4A 5D29A 2PVWA 4MMOA 4FWUA 5LRKA 5LYFA 4NGNA 2IMOA 4OIDA 2JEWA 2ZEGA 2PJCA 2F7VA 2WYRA 2ANPA 3K9TA 1CBXA 4NFRA 2F8HA 1YLOA 3NH8A 2ZEHA 4NGQA 3RAMA 4P44A 3KGQA 2QJ8A 1TKJA 3KASA 3NFZA 3CPXA 2IJZA 4PXEA 2ZEDA 4NGRA 1YMEA 3S9LA 4TNUA 4PQAA 1CX8A 2PCUA 3SJGA 1Y0RA 2J9AA 4ZY0A 5LYLA 2DEAA 2C6PA 1CG2A 1XBUA 2XEFA 4CPAA 3SI2A 1UWYA 2IQ6A 5JH9A 1CP6A 2PJBA 3PB6X 5F09A 1GYTA 3SJXA 2OOTA 2CIJA 3PB9X 2ZEMA 1Z2LA 4A38A 4YWYA 4TWEA 2PJ6A 1CP7A 3IJ3A 3NH5A 4OP4A 2ZELA 2ZEFA 1BPMA 5HXDA 3GUXA 4BD9A 1LANA 2EWBA 2ZENA 3S9MA 5K8NA 3PFOA 2AFMA 5LYDA 4R76A 1LOKA 4MHZA 4OC1A 2VL1A 4OC4A 3PB7X 3B3VA 2POKA 1LAMA 4PXBA 3ISZA 4MHPA 2V77A 3WABA 3GLJA 4WWVA 3RBUA 3SI1A 4F9UA 3FH4A 4PXDA 1F2PA 1Z8LA 4MRIA 3CPAA 3VARA 3FVLA 4P6YA 1HDQA 2O4HA 3KR5A 3S9NA 4G1PA 2PRQA 1XRYA 3D4UA 2XEJA 2BCOA 2Q51A 1ARLA 5K8MA 4EWTA 3D7DA 4IK2A 3VATA 4DJLA 1VHOA 1XMBA 3D66A 1YW6A 4AXVA 4X2TA 5I4MA 2JBJA 1YW4A 3QNVA 3K2KA 5DS0A 4YU9A 3BXMA 3KHXA 3IO1A 3HUVA 2AFWA 4F9VA 2BOAA 2C1CA 3FX6A 1M4LA 4NGPA 4P4IA 2CTBA 4FUUA 3TX8A 2Q4ZA 3D68A 3IWWA 3DGVA 1IY7A 4P45A 3FECA 3V38A 4A37A 4LQGA 4R7MA 2OR4A 2ABZA 3SJFA 1H8LA 3FMCA 5ELYA 4MCQA 5LRJA 2PJ9A 1F57A 3SI0A 2PJ0A 2ZOGA 4RUHA 3B35A 4UEEA 2FVGA 4NGMA 2BO9A 2V8VA 1ZLHA 3PBBA 3B2YA 4ZX8A 3KL9A 2GU2A 1HDUA 1CPXA 2PIYA 1DTDA 1ZG7A 2GREA 4OC5A 3KHZA 3WC6A 3IC1A 1BAVA 4NJQA 2PJ8A 3D67A 2CTCA 4GM5A 3H8GA 1VGYA 4OKOA 3PRTA 1ZG9A 1OBRA 1YSJA 5JGFA 1QMUA 3WC5A 2C6CA 2JBKA 4H2KA 1JQGA 8CPAA 4EMEA 1XJOA 4ZY1A 3D7FA 4MCPA 3B3WA 4WJBA 1PYTB 3WT4A 3H8FA 3ISXA 1FNOA 1Y7EA 2AFSA 4Q7AA 2EK8A 2AFOA 1TKFA 3RZAA 5THWA 2HC9A 4OIWA 2ZEOA 3HLPA 2PJ1A 1TXRA 4EFDA 3L2NA 3NA6A 6CPAA 3IEHA 3PEIA 2PJ7A 3DLJA 1KWMA 1LFWA 1XFOA 1R3NA 2QVPA 1BLLE 3KQXA 4MCSA 4P4JA 3WC7A 4B6ZA 4NJRA 1ARMA 3B3SA 1TF9A 4PPZA 2ZEEA 2GLFA 2NSMA 2Q43A 3PBEA 4DUKA 3D7GA 3GB0A 4P10A 1BPNA 4MXUA 1DE4C 2C6GA 3LWUA 1R43A 4P4FA 2PJ2A 4A94A 1HEEA 2AFZA 1VHEA 1ZLIA 2RFHA 2PJ5A 4UIBA 3PB8X 2G9DA 5LYIA 5CPAA 3IIBA 1Q7LA 3FEDA 4UEZA
chains in the Genus database with same CATH superfamily
2FIAA 1JJ2Y 4KLVA 4CGLA 1FT7A 1TF8A 3CCMZ 2Z3LA 3S2DI 2Q4VA 3CXQA 3H8EA 1K732 2NAPA 4E2WA 3T90A 1YLEA 2K3RA 4UF4A 4MD8A 2Y0MA 4DYOA 4DGLA 4C7IA 4R87A 3CDXA 2ARHA 1Q821 2ZAEB 1S721 2PE3A 4NBCA 3D2MA 2Q44A 3R9EA 4AYBA 2YU9I 1Y9KA 1NSAA 4X3RA 2PJ3A 4RS2A 5EC4A 3I561 4L8AA 1Q2DA 4HKFA 4O23A 3B3TA 5A2Qb 4E32A 3MN8A 2HQYA 1GHEA 2QKDA 3CCJZ 2PR8A 1VQ91 1MJAA 5IB9A 1KC82 2REFA 3FKII 4ZI6A 2PM9A 3BLNA 1ZO0A 3SXNA 4JD6A 2VPZA 4UIAA 1Z01A 2PQ8A 1V0CA 3IWEA 2X7BA 4MFKA 2WZNA 3BHXA 2F4OA 2OZKA 2V3VA 3FNCA 4E2AA 4MHYA 2Z3NA 4MH4A 1UFHA 3CC71 2DE5A 1Z5RA 1IOFA 4K3NA 1TWHI 3D9XA 3JRUA 1VQ51 4MHNA 4MCRA 4FD5A 4FBEA 5F46A 2OH1A 4OC2A 1QSRA 5HMNA 5J1QA 4FWUA 1MJBA 2ZXVA 2IMOA 2JEWA 2F7VA 3K9TA 1PU9A 1USPA 1K4JA 2ZEHA 4Q36A 3KGQA 2QJ8A 3KASA 5C88A 3G4SZ 4A93I 1YVOA 4CYQA 2ZEDA 2PRBA 1YMEA 1YJWZ 4BY1I 3FBUA 4ZY0A 3IGRA 1XBUA 2PC1A 3S15I 3SXOA 1RO4A 1R9TI 3UY5A 4E31A 1UWYA 3PB6X 1VQK1 3SJXA 3QWUA 3TE4A 2R93I 1Q861 4NOZA 4TWEA 4FD4A 4XPDB 3NH5A 1Z4EA 3K9UA 4F0XA 3EERA 4AB7A 2AFMA 4R76A 2Z3MA 4MHZA 4OC1A 1QSMA 4OC4A 3PB7X 2FCKA 3B3VA 3CCR1 4PXBA 4MHPA 4KUBA 3SI1A 4UFWA 4L89A 4CAFA 4K30A 5D1OA 4MY3A 3RZOI 3VARA 4UCMA 3FVLA 4P6YA 1YIJZ 2O4HA 2ATRA 2OTJ1 2F5IA 1XRYA 3S1MI 2J8RA 5D1OB 2AYDA 2JEVA 2OU2A 1ARLA 5K8MA 4EWTA 3D7DA 4DJLA 4MBUA 3TT2A 5D1PA 4J3GA 4B12A 2P3YA 1IIDA 4X2TA 2RPRA 2Q7BA 4H6UA 2PR1A 3F5BA 1YIT1 4BINA 2AFWA 3NDJA 2F4MA 3F8KA 3CCL1 4F0YA 2WB1A 4NGPA 2ZW5A 3CCEZ 2GTIA 3IWWA 2OR4A 4C7HA 4MCQA 4II9A 5LRJA 2PJ9A 3PGPA 5H84A 4E0AA 2B5GA 3B35A 2FVGA 5AG6A 1Q862 3HOXI 1L0CA 2BO9A 3PBBA 3J81f 1KQSZ 1YHQZ 2FIWA 4HH4A 2B5GB 2PIYA 1DTDA 2H5MA 1ZG7A 4OC5A 2PJ8A 5A27A 1Z8WA 2CTCA 4GM5A 3H8GA 3VWDA 1ZG9A 1MK4A 4MHDA 1X3ZA 3G711 4EVYA 3GIUA 5JGFA 1XMTA 3IU1A 5J8FA 3TFYA 2C6CA 1Y7RA 4QVTA 1Y9WA 4H2KA 8CPAA 4EMEA 1VQP1 1Y8CA 3D7FA 4KOUA 3ZZIA 4NB9A 1KRLA 4R9MA 3RZAA 4HPSA 5THWA 4NSQA 2VBQA 4EFDA 2JIMA 5DWNA 1KWMA 3G6EZ 1R3NA 1S60A 5IT9f 2D4OA 2QVPA 4MCSA 1N8R1 4B6ZA 1P4NA 4MFPA 4JXRA 4PPZA 2ZEEA 3R9GA 4EWCA 3EEDA 1YVKA 2R8VA 2E2II 1M901 2G3TA 4MY0A 2OZGA 1LQLA 1M1DA 1KD11 3LWUA 2C6GA 1YUKA 1R43A 2PJ2A 2IL4A 4UFXA 1VQO1 4A94A 1JWQA 1ZLIA 2HUZA 3CC4Z 4UIBA 3T4NB 3I55Z 4R3KA 3D2LA 2G9DA 4DNCA 4A31A 3IIBA 3EO4A 2B58A 4LQ6A 1YI2Z 2CF4A 4P4BA 3DSBA 4U9YA 1EE3P 1VQ81 1M4GA 1YK3A 4CYPA 1QVGZ 1X12A 4F8ZA 3F3FC 4QBJA 2R92I 1K83I 2AFXA 5K8PA 3I4NI 2ODFA 3HKZA 4AG7A 3JVNA 3FF3A 5HH1A 4A33A 1KUXA 3GY9A 5LL6f 3CCUZ 4A39A 3MRUA 5F49A 2VPXA 5GCNA 4ZYQA 4LUAA 2ZEPA 4FAIA 3VTNA 3BG1B 1Y1VS 1JWHC 2G3AA 1VIXA 2VF1A 3KIFA 4MFJA 4UWIA 1QYPA 3CT9A 1VQ41 2R98A 4KORA 3CPWZ 3P2HA 4RI1A 2QIRA 2JS4A 1N8R2 1S7KA 2RT9A 4OC0A 4KZTA 1CPSA 2VI7A 4M6GA 3VB9A 3KQZA 3GTMI 1AMPA 3KZWA 3IFEA 2HB6A 3FEEA 1KD12 3K7AI 4BMHA 2BJOA 3T8WA 3S6FA 2AFUA 5FVJA 3IR7A 3MGDA 4XX2A 4NGSA 5IV0A 2WPXA 1QQ9A 3VH9A 1VQM1 2QYVA 3N5FA 5CBMA 2RBLA 2M48A 1TWGI 1WK4A 2EK9A 2KCWA 3NH4A 5D29A 2PVWA 2Q04A 1FDOA 4MMOA 4ZBGA 2LFUA 5AG4A 4B14A 2P6GA 2LEXA 4OIDA 2GTHA 1QXFA 4NFRA 4RVFA 4CYOA 5IP7I 4NGQA 4P44A 2GIVA 1VQ61 2OOYB 2FS5A 3EXNA 1SFOI 3CPXA 1S72Z 2IJZA 2E9HA 2OTL1 1VHSA 4A95A 4NBFA 4PQAA 1CX8A 2QECA 2DEAA 2C6PA 3S1QI 1CG2A 2XEFA 3OW2Y 2VXKA 4R3LA 3TCVA 3S6GA 3CCS1 3PB9X 5G22A 2ZEMA 3QAYA 3JTKA 4A38A 4NH1C 4H6ZA 3IJ3A 3D6WA 3J80b 5A28A 4OP4A 2LIYA 1BPMA 3EY5A 3I4MI 3GUXA 3GTGI 4MFZA 3ESWA 1LOKA 3EFAA 4GS4A 2VL1A 3FB3A 2POKA 5T6BA 2V77A 3GLJA 3H5ZA 4WWVA 4S1TA 3CC7Z 4F9UA 2PDOA 2JA6I 3TO6A 1M44A 3CCJ1 1VQ5Z 2DXQA 3KR5A 3IX0A 4G1PA 2PRQA 3RZDI 3GCFA 4KOXA 1X3WA 2GFQA 2XEJA 4E30A 2Q51A 2JR6A 2E2HI 5JQ4A 1I3QI 1Q811 4UWJA 4ZGYB 5CM2M 4Y49B 3JUWA 4E8OA 2JBJA 2NVYI 1R57A 2EO8A 5C44I 4KVME 1DL6A 3I9SA 2G0BA 5ISVA 3V8IA 1M4LA 4XPDC 1YR0A 1B87A 4P4IA 3D68A 1IY7A 1Q822 4IF5A 4RVGA 3V38A 4LQGA 4R7MA 2J8NA 1H8LA 5ELYA 1QF8A 2AKLA 1F57A 4RUHA 5FLXb 4CGMA 4NGMA 4GXHA 2K5RA 4A3GI 4ZX8A 3SHPA 2QMLA 4CGPA 1IU8A 1IYLA 3KL9A 3HOVI 1B6BA 2GREA 4RS4A 3W6SA 2YNCC 1YJW1 1J4JA 4NJQA 1VGYA 3PO2I 2IZ3A 1YQEA 4NBHA 1Z8TA 2ZPAA 4C68A 1NUIA 1VQN1 4AVCA 4B5PA 2YNCA 4U5YA 1XJOA 4ZY1A 4MCPA 4WJBA 3WT4A 3OWCA 1FNOA 1QSTA 1Y7EA 1TWAI 1IYKA 4Q7AA 2AFOA 4B5PB 1TKFA 2Q0YA 2DPSA 2OTJZ 1TXRA 4NB8A 4MFLA 5FLMI 4NEXA 2Z3PA 1TIQA 2PJ7A 1QVFZ 3TE5B 4YFJA 1S7NA 3HOYI 3TTHA 4AVBA 3D2PA 2JA8I 1W2BZ 3TO9A 5F47A 5C4JI 4A3LI 1TWCI 4RV9A 1Q7Y1 2IZ4A 1Q812 2QEX1 3B3SA 1XIXA 3CME1 4NCZA 4PSXA 1WJ2A 2R6MA 2HV2A 1M1K1 3IU2A 2NSMA 2Q43A 1YITZ 4DUKA 3KIHA 1VQL1 1KUYA 2CNTA 4MXUA 4B10A 1XE4A 1DE4C 3CCLZ 2Z10A 1VHEA 1PUAA 3BJ7A 2PJ5A 1AUGA 4NF1A 3F3PC 2JMOA 2EUIA 5CPAA 3Q87A 1CM0A 2PK7A 3HOWI 2QREB 2EBJA 4A3EI 4P4EA 2I3CA 3LODA 1Y1WI 3JAMb 2YGWA 4M85A 3G8WA 2RB7A 4CS0B 2VUMI 5LRGA 3CCV1 4R8FA 1L1OC 2DF5A 2JIQA 2VQYA 4CAVA 1KUVA 1S7MA 3S17I 3HOUI 3G71Z 2WUUA 5D8NA 3D7HA 5JM6A 2XEIA 1YJ91 1KZFA 3BI1A 2H85A 5E96A 3VWEA 2Q7SA 4HGZA 3S6KA 4A3KI 2Z3KA 1I1DA 2AJ6A 1YREA 2PIZA 3D8PA 1TFIA 4A2ZA 2B4DB 4PXCA 3I1UA 5HVFA 3PB4X 3GKRA 1K9M1 1VKCA 2V8KA 4KS9A 3DR8A 3LD2A 2FSRA 1Y0YA 5G20A 3U50C 4DK1A 4KSIA 3TOAA 1X10A 1Q7Y2 4NGTA 3I3GA 3LMSA 4R6TA 1NSLA 4C2YA 3GTMS 4KOSA 1LAPA 1I12A 1M1K2 4UEFA 3NE7A 1VQOZ 3N7ZA 1LRZA 1F2OA 1X0TA 2I79A 1PCAA 3BI0A 5F48A 3J7A4 3R95A 3KR4A 4OAEA 2Z3OA 1WWZA 3H4QA 1VQ71 5IP9I 2DE7A 3B7IA 5KTAA 2NVTI 1ELMP 5LRKA 3EC4A 4QC6A 4XPKA 2NVXI 1I50I 4A3II 2I00A 3MZLB 2WYRA 2W03A 2ANPA 1CBXA 1I21A 3G3SA 2F8HA 2R1IA 1YLOA 1YX0A 2Z0ZA 2V8JA 3NFZA 1YJN1 2BL1A 4PXEA 4PK3A 3CZXA 3S9LA 3T9YA 5IT9b 2JDDA 2EVNA 3I551 1Y0RA 5AN9F 4BXXI 4Y7NI 2P6FA 3CXCZ 2PJBA 3C26A 5F09A 1FY7A 1QVGY 4KOTA 4BBHA 2CIJA 1K731 1Z2LA 5CNPA 3VMGA 3KKWA 2OOXB 4E2YA 4YWYA 1CP7A 3GKQA 4FD6A 1K8A1 3S1NI 2QR1B 2ZELA 5BWAB 2ZEFA 3RYOA 4B11A 4A3JI 4OADA 4XNHB 2BUEA 2EWBA 1AA6A 4KOVA 3S9MA 5DWMA 4MI4A 3QB8A 2IV2X 1K9M2 5K8NA 3GTPI 5LYDA 3QAHA 2V45A 4JWPA 3MZKB 3NE8A 1LAMA 2FXFA 3CXSA 4E33A 5AG7A 1BO4A 3BG0B 2PSWA 3RBUA 1Z4RA 3FRMA 3CMA1 4KSFA 3VMIA 1KC81 2YNDA 4MRIA 4NBGA 1M902 3CPAA 2HU9A 2QLVB 1WCMI 3NDIA 1VQMZ 3B8GA 1Z02A 3CQZI 1BOBA 3CCQZ 1S3ZA 2VPWA 4AG9A 4UCNA 3D4UA 4CAEA 4X6AI 4IK2A 4DQYB 3VATA 4HGYA 5JPHA 2WPWA 1YW6A 1NP6A 5I4MA 3M3YI 1JJ2Z 3QNVA 3CC21 3K2KA 4B5OA 2OB0A 4YU9A 2WAQA 2OTLZ 3BXMA 3KHXA 3IO1A 3M4OI 5A2Qf 1RO2A 2AE6A 1Z9UA 3HUVA 3CD61 2C1CA 3FX6A 3DGVA 4P45A 4XPLA 3CCSZ 2OZHA 1I6HI 4A37A 3DDDA 5G21A 3OW2Z 2ABZA 5EBVA 3SJFA 3FMCA 2B3VA 2QA41 3I56Z 5I0CA 3SI0A 2PJ0A 2ZOGA 3R9FA 4UEEA 4A3FI 4OLLA 3W91A 3B2YA 3CCM1 1K8A2 4M6HA 4IUSA 2JLMA 1VQ9Z 1HDUA 1QSOA 2EGTA 3GTQI 3WC6A 3IC1A 2FT0A 1BAVA 3D67A 3S2HI 2ZW4A 3GTJI 4QTTA 1YSJA 1QMUA 4CGNA 3WC5A 5KTDA 4MONA 1JQGA 3TOBA 4A32A 4A3BI 3H8FA 3ISXA 2AFSA 1Y1VI 4U9ZA 2REEA 4Y49C 1YGHA 2P0WA 3LACA 4OIWA 4RVHA 3MONA 3VMHA 3L2NA 4MD7A 3NA6A 1VLAA 2J6AA 3PEIA 3IFUA 1OZPA 4UBRA 1LFWA 1XFOA 1FDIA 4CGOA 3I07A 3KQXA 4P4JA 1TWFI 2YADA 1S7LA 1TF9A 5FLXf 4QTUA 2JDCA 2R7HA 2ZW6A 2RIQA 4HNWB 2KPIA 4YGOA 4I49A 1SIWA 4P4FA 5LYIA 2B63I 1Q7LA 2E2JI 4UEZA 3PO3I 5T67A 1VQKZ 4UCPA 4KSAA 2FE7A 2VZYA 3R96A 2JUBA 2GLJA 1M4IA 1ZG8A 2PVVA 1TKHA 2V8GA 5C4XI 4W9YA 2FL4A 1USPB 1CJWA 5IX3A 2JA7I 1A2ZA 1ZB8A 3TC8A 3G4S1 4QUSA 4NBEA 3PFEA 2QRCB 1VQNZ 3GTOI 4RN7A 2VPYA 3KI9A 1LCPA 1RLYA 4R57A 4JZ0A 4Z65A 1AYEA 2NYQA 2G2KA 4KVOE 3CCRZ 4OMEA 1PFTA 5HVHA 1RTQA 1WIIA 2V8HA 2Y0SA 4JYWA 2OZUA 1ELLP 3FXTA 2V8DA 1NJI1 3S16I 4Q38A 1N2FA 3FJUA 4P4DA 2HF1A 4PV6A 1IGBA 1RNIA 3RNZA 5EMIA 3GTKI 2BEIA 2YNEA 4ONWA 1ZB9A 3PZJA 2K5TA 1RO0A 7CPAA 5HVGA 3CXPA 3SJEA 2QEXZ 2DE6A 2C27A 3CMEZ 5C3EI 4OC3A 2B4BA 2PJ4A 3JAMf 1VQLZ 3GTLI 2D4PA 2M6NA 5J8CA 2XEGA 3LUSA 4ZY2A 1QVFY 4QB9A 4E2ZA 2ZOFA 1Z03A 2VUGA 1W2BY 3B3CA 4IHMA 4X8IA 4IAVA 1YIJ1 4KVXA 4CRZB 2O53A 4ZX9A 4H89A 5K8OA 2PJAA 2RC4A 3V7ZA 1RXTA 2P6EA 3P5JB 3CCVZ 5LYFA 4NGNA 1IB1E 2DPTA 2ZEGA 2PJCA 3NH8A 3PP9A 3RAMA 1TKJA 2R7ZI 1RQFA 4NGRA 3A9LA 4TNUA 2PCUA 3SJGA 2P28A 2J9AA 5LYLA 1YJ9Z 1U6MA 4CPAA 5AG5A 4JLYA 3SI2A 2IQ6A 3CCE1 5JH9A 2PMZA 1CP6A 2CXAA 1P0HA 2NVQI 1GYTA 2B4DA 2OOTA 4MD9A 3W6XA 1YUAA 4CRYB 1VQPZ 1KQSY 4CYNA 2PJ6A 1XF8A 4M6IA 1ON0A 1XOVA 5AGEA 2W04A 1QSNA 3S1RI 1NJI2 4JJXA 1YHQ1 5HXDA 4BD9A 1LANA 2ZENA 1RO5A 4M3SA 1Q2CA 4A3MI 3PFOA 4YRHA 3IWGA 5C82A 2CY2A 3FIXA 1NMTA 3ISZA 1Q2YA 4C2XA 3WABA 4PK2A 4AVAA 3FH4A 4PXDA 2V8IA 1F2PA 3J81b 4E2XA 1Z8LA 4HNYB 1HDQA 4X5KA 1NE9A 4CAWA 3S9NA 4KUAA 1VQ7Z 3F0AA 3H0GI 2BCOA 4ORFA 1ML8A 3G6E1 4FD7A 1M4DA 1VHOA 1XEBA 1XMBA 3D66A 2O28A 1ZH1A 2RHBA 5IB0A 4AXVA 3H3VJ 2ZW7A 1VQ8Z 3DNSA 3GYAA 1YW4A 2NMTA 1WW9A 1WZNA 1YJNZ 5DS0A 3R1KA 4A30A 4A3DI 2J8MA 1P9NA 4F9VA 2BOAA 4KLWA 4CL1A 4NBDA 2CTBA 4FUUA 3TX8A 2Q4ZA 4CAXA 3CC41 3FECA 4XNHC 3FQQA 1IOIA 1N71A 2WSAA 2JNYA 1S5KA 2JIPA 5H86A 4LX9A 4Y52I 1YI21 4B13A 3S6HA 3S14I 2V8VA 2Z11A 1MJ9A 1ZLHA 3P2FA 2CNMA 3FQMA 4NBBA 3ZJ0A 3D3SA 4UFVA 2GU2A 1CPXA 3FYNA 4KOWA 2JIRA 3KHZA 1SQHA 3CXCY 1VQ4Z 1IICA 2JA5I 4BBSI 1Z8XA 4OKOA 3PRTA 2JIOA 4HNXB 4KOYA 1OBRA 4NXYA 2VEZA 3DR6A 2JBKA 2QRDB 4MJ8A 3CMAZ 4JXQA 3B3WA 4BY7I 1PYTB 2E7ZA 2EK8A 3CCU1 3WR7A 2CNSA 2HC9A 2B3UA 2GE3A 4F6AA 5KTCA 3BJ8A 2ZEOA 3HLPA 5T64A 2PJ1A 6CPAA 3IEHA 3HOZI 3CPWY 4MFQA 3DLJA 2Q4YA 3E0KA 2A4NA 4UA3A 1BLLE 1S7FA 1Q16A 3WC7A 3TDHB 4NJRA 2KI7B 1ARMA 4ONUA 2VZZA 4A3CI 2GLFA 4C2ZA 3CC2Z 2BSWA 3PBEA 3RO0A 5G1ZA 3D7GA 3GB0A 4P10A 1BPNA 3CD6Z 1VQ6Z 4RVDA 3J80f 1HEEA 2AFZA 2RFHA 3TO7A 4BBRI 3IF8A 4NBAA 3CCQ1 3PB8X 2GANA 3PO3S 2QA4Z 4PSWA 3FEDA
chains in the Genus database with same CATH topology
3PO3I 5T67A 3HOWI 1JJ2Y 1YI2Z 1VQKZ 2CF4A 2QREB 4A3EI 4P4EA 2I3CA 4P4BA 1FT7A 1TF8A 2JUBA 3CCMZ 1Y1WI 3JAMb 1EE3P 2GLJA 3S2DI 1VQ81 2RB7A 1ZG8A 2VUMI 2PVVA 3H8EA 5LRGA 1K732 3CCV1 1TKHA 4R8FA 1QVGZ 2V8GA 1L1OC 4E2WA 5C4XI 2K3RA 4UF4A 4MD8A 4W9YA 4DYOA 4DGLA 1S7MA 1USPB 3S17I 3CDXA 2JA7I 1ZB8A 3HOUI 3TC8A 1Q821 2ZAEB 4F8ZA 3G4S1 1S721 2PE3A 3F3FC 4NBCA 4NBEA 3G71Z 2R92I 3PFEA 1K83I 2QRCB 5D8NA 1VQNZ 4AYBA 2AFXA 3GTOI 3D7HA 2YU9I 5K8PA 3I4NI 1LCPA 3KI9A 1RLYA 4JZ0A 5JM6A 4Z65A 1NSAA 2XEIA 3HKZA 1YJ91 3BI1A 4X3RA 1AYEA 2PJ3A 2NYQA 2G2KA 3FF3A 2H85A 3CCRZ 4OMEA 3I561 1PFTA 4HGZA 5HVHA 4A3KI 1RTQA 5LL6f 1WIIA 4O23A 2V8HA 2Y0SA 3CCUZ 4A39A 3MRUA 2PIZA 1TFIA 4ZYQA 3B3TA 4JYWA 2ZEPA 4FAIA 3VTNA 3BG1B 4E32A 5A2Qb 3MN8A 1Y1VS 1ELLP 2V8DA 1NJI1 4PXCA 1JWHC 2QKDA 3CCJZ 3S16I 1VQ91 1N2FA 3I1UA 1VIXA 3FJUA 5HVFA 4P4DA 5IB9A 2VF1A 2HF1A 3KIFA 1KC82 3FKII 3PB4X 1IGBA 1RNIA 1K9M1 1QYPA 3GTKI 2V8KA 4ONWA 3CT9A 1ZB9A 1VQ41 4ZI6A 2PM9A 1RO0A 7CPAA 5HVGA 3CPWZ 4UIAA 3SJEA 2JS4A 2QEXZ 1Y0YA 2DE6A 1N8R2 3U50C 3CMEZ 1Z01A 2RT9A 4DK1A 5C3EI 4KSIA 4OC3A 1Q7Y2 4NGTA 4OC0A 3LMSA 4R6TA 2PJ4A 1CPSA 3JAMf 3GTMS 3VB9A 1VQLZ 2WZNA 3GTLI 3BHXA 3KQZA 2F4OA 2M6NA 2OZKA 1LAPA 3GTMI 4MHYA 1M1K2 2XEGA 3LUSA 4MH4A 4UEFA 1AMPA 1QVFY 3KZWA 4ZY2A 3CC71 1VQOZ 3IFEA 2DE5A 1Z5RA 4E2ZA 2HB6A 3FEEA 1KD12 3K7AI 4K3NA 2ZOFA 1Z03A 1TWHI 2BJOA 2VUGA 1X0TA 1W2BY 1F2OA 3D9XA 3B3CA 3T8WA 4IHMA 2AFUA 1PCAA 3BI0A 3JRUA 4X8IA 3J7A4 1VQ51 4IAVA 3KR4A 4MHNA 4MCRA 4XX2A 1YIJ1 4NGSA 1QQ9A 3VH9A 1VQM1 2QYVA 3N5FA 4FBEA 1VQ71 5IP9I 5CBMA 2O53A 4ZX9A 2DE7A 2RBLA 3B7IA 2M48A 1TWGI 5K8OA 2NVTI 2EK9A 2PJAA 4OC2A 1ELMP 5J1QA 3V7ZA 3NH4A 5D29A 2PVWA 4MMOA 4FWUA 5LRKA 2LFUA 3P5JB 3CCVZ 5LYFA 2NVXI 1I50I 4A3II 4NGNA 2IMOA 4OIDA 2JEWA 3MZLB 2GTHA 2ZEGA 2PJCA 2F7VA 2WYRA 2W03A 2ANPA 3K9TA 1CBXA 4NFRA 4RVFA 2F8HA 1USPA 5IP7I 1YLOA 3NH8A 2ZEHA 4NGQA 3RAMA 4P44A 3KGQA 2V8JA 1TKJA 2QJ8A 3KASA 2R7ZI 1VQ61 2OOYB 3NFZA 1SFOI 3G4SZ 3CPXA 1YJN1 1S72Z 4A93I 2IJZA 1RQFA 4PXEA 2ZEDA 4NGRA 2E9HA 2OTL1 4NBFA 1YMEA 3S9LA 1YJWZ 4TNUA 4PQAA 1CX8A 5IT9b 2PCUA 4BY1I 3SJGA 2P28A 3I551 1Y0RA 2J9AA 4ZY0A 5LYLA 2DEAA 2C6PA 1YJ9Z 3S1QI 5AN9F 1CG2A 1XBUA 2XEFA 3OW2Y 3S15I 4CPAA 4BXXI 4Y7NI 1RO4A 1R9TI 3SI2A 4E31A 3CCE1 1UWYA 2IQ6A 5JH9A 2PMZA 3CXCZ 1CP6A 2PJBA 3PB6X 5F09A 3CCS1 1VQK1 2NVQI 1QVGY 1GYTA 3SJXA 2OOTA 3QWUA 4MD9A 2CIJA 1K731 3PB9X 1YUAA 2ZEMA 2R93I 1VQPZ 1Z2LA 4A38A 3VMGA 2OOXB 4E2YA 1Q861 1KQSY 4YWYA 4NOZA 4NH1C 4TWEA 2PJ6A 1CP7A 3IJ3A 3GKQA 1K8A1 3D6WA 2W04A 3J80b 3NH5A 3S1NI 4OP4A 2QR1B 2ZELA 2LIYA 3S1RI 1NJI2 2ZEFA 1YHQ1 4A3JI 1BPMA 5HXDA 3I4MI 3GUXA 1LANA 3GTGI 2EWBA 2ZENA 4BD9A 3S9MA 3EERA 4A3MI 1K9M2 5K8NA 3PFOA 2AFMA 3ESWA 3GTPI 4R76A 5LYDA 1LOKA 3MZKB 4MHZA 4OC1A 2VL1A 4OC4A 3PB7X 3B3VA 2POKA 1LAMA 3CCR1 4E33A 5T6BA 4PXBA 3ISZA 4MHPA 2V77A 3WABA 3GLJA 3BG0B 4WWVA 3RBUA 3SI1A 4S1TA 3CC7Z 4F9UA 3FH4A 4PXDA 2V8IA 1F2PA 2JA6I 3J81b 3CMA1 4E2XA 3VMIA 1KC81 1Z8LA 4MRIA 5D1OA 3CCJ1 4NBGA 1M902 3RZOI 3CPAA 2HU9A 1VQ5Z 3VARA 3FVLA 4P6YA 2QLVB 1YIJZ 1HDQA 1WCMI 2O4HA 3NDIA 3KR5A 3S9NA 1VQMZ 3IX0A 1Z02A 3CQZI 1VQ7Z 4G1PA 2PRQA 3RZDI 2OTJ1 3GCFA 3CCQZ 1XRYA 3S1MI 3D4UA 3H0GI 1X3WA 5D1OB 2XEJA 4E30A 2BCOA 2Q51A 2JR6A 2E2HI 1ARLA 1I3QI 4X6AI 5K8MA 1ML8A 4EWTA 3G6E1 3D7DA 1Q811 4DQYB 4IK2A 3VATA 4DJLA 5CM2M 1VHOA 1XMBA 3D66A 4HGYA 1ZH1A 2RHBA 5D1PA 1YW6A 4AXVA 2P3YA 3H3VJ 1NP6A 4X2TA 1VQ8Z 5I4MA 2JBJA 2NVYI 2RPRA 3M3YI 1JJ2Z 1YW4A 1WW9A 1YJNZ 3QNVA 3CC21 3K2KA 5DS0A 4YU9A 5C44I 2WAQA 4A3DI 2OTLZ 3BXMA 3KHXA 3IO1A 3M4OI 5A2Qf 1DL6A 1RO2A 1YIT1 1P9NA 3HUVA 2AFWA 4F9VA 2BOAA 3CD61 2C1CA 3NDJA 2F4MA 1M4LA 4CL1A 3FX6A 4NBDA 3CCL1 2WB1A 4NGPA 4P4IA 2CTBA 4FUUA 3TX8A 2Q4ZA 3D68A 3CCEZ 2GTIA 3IWWA 3DGVA 1IY7A 4P45A 1Q822 3CC41 3CCSZ 3FECA 4RVGA 1I6HI 3V38A 4A37A 4LQGA 4R7MA 3OW2Z 2OR4A 3FQQA 2ABZA 3SJFA 1H8LA 3FMCA 5ELYA 1QF8A 4MCQA 2QA41 3I56Z 5LRJA 2PJ9A 2AKLA 1F57A 2JNYA 3SI0A 2PJ0A 5FLXb 2ZOGA 3B35A 4RUHA 4Y52I 1YI21 4A3FI 2FVGA 4UEEA 4NGMA 1Q862 3HOXI 3S14I 2K5RA 2BO9A 2V8VA 1ZLHA 4A3GI 3PBBA 3J81f 3B2YA 3CCM1 1KQSZ 1YHQZ 4ZX8A 3FQMA 4NBBA 1K8A2 3KL9A 4HH4A 2GU2A 1VQ9Z 3HOVI 1HDUA 1CPXA 2PIYA 1DTDA 1ZG7A 2EGTA 2GREA 4OC5A 3KHZA 4RS4A 3GTQI 3WC6A 1YJW1 3IC1A 3CXCY 1VQ4Z 1BAVA 4NJQA 2PJ8A 3D67A 2JA5I 4BBSI 3S2HI 2CTCA 4GM5A 3H8GA 1VGYA 4OKOA 3PO2I 3GTJI 1ZG9A 2IZ3A 3PRTA 4NBHA 1X3ZA 1OBRA 4QTTA 3G711 1YSJA 1NUIA 5JGFA 1QMUA 1VQN1 3WC5A 2C6CA 2JBKA 4MONA 2QRDB 4H2KA 1JQGA 8CPAA 4EMEA 1XJOA 3CMAZ 1VQP1 4ZY1A 3D7FA 4MCPA 3B3WA 4WJBA 4BY7I 1PYTB 4A3BI 3H8FA 3WT4A 4NB9A 3ISXA 1KRLA 1FNOA 1Y7EA 2AFSA 1TWAI 4Q7AA 1Y1VI 2EK8A 2AFOA 3CCU1 1TKFA 3RZAA 5THWA 2HC9A 4OIWA 2ZEOA 3HLPA 5T64A 2PJ1A 2OTJZ 4RVHA 4NB8A 1TXRA 4EFDA 3MONA 3VMHA 5FLMI 3L2NA 4MD7A 3NA6A 6CPAA 1VLAA 2J6AA 3HOZI 3IEHA 3PEIA 2PJ7A 1QVFZ 3TE5B 3CPWY 3HOYI 3DLJA 3IFUA 1KWMA 1LFWA 1XFOA 2JA8I 1W2BZ 3G6EZ 1R3NA 5IT9f 5C4JI 2QVPA 4A3LI 3I07A 1BLLE 1TWCI 3KQXA 1N8R1 4MCSA 4P4JA 3WC7A 4B6ZA 1TWFI 3TDHB 4RV9A 1Q7Y1 2IZ4A 1Q812 2KI7B 4NJRA 1ARMA 2QEX1 3B3SA 2YADA 1TF9A 5FLXf 4QTUA 4PPZA 3CME1 2ZEEA 4EWCA 4A3CI 2GLFA 3EEDA 3CC2Z 2E2II 2R6MA 2RIQA 1M901 2KPIA 1M1K1 2NSMA 2Q43A 3PBEA 1YITZ 4DUKA 3D7GA 3KIHA 1LQLA 1VQL1 3GB0A 4P10A 1KD11 1BPNA 4MXUA 3CD6Z 1VQ6Z 1DE4C 2C6GA 1YUKA 1R43A 3LWUA 4P4FA 4RVDA 3CCLZ 2PJ2A 3J80f 4A94A 1VQO1 1HEEA 2AFZA 1VHEA 1ZLIA 2RFHA 3CC4Z 2PJ5A 4BBRI 3T4NB 3IF8A 4NBAA 3I55Z 3CCQ1 3PB8X 4UIBA 2G9DA 3F3PC 2JMOA 5LYIA 2B63I 5CPAA 3IIBA 3PO3S 1Q7LA 3Q87A 2QA4Z 2E2JI 3FEDA 2PK7A 4UEZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CF4 A;  4P4E A;  2I3C A;  4P4B A;  1FT7 A;  1TF8 A;  1EE3 P;  2GLJ A;  2RB7 A;  1ZG8 A;  2PVV A;  3H8E A;  5LRG A;  1TKH A;  4R8F A;  2V8G A;  4UF4 A;  4W9Y A;  4DYO A;  3CDX A;  3TC8 A;  4F8Z A;  2PE3 A;  3PFE A;  5D8N A;  2AFX A;  3D7H A;  5K8P A;  3KI9 A;  1LCP A;  4JZ0 A;  5JM6 A;  4Z65 A;  1NSA A;  2XEI A;  3BI1 A;  4X3R A;  1AYE A;  2PJ3 A;  2NYQ A;  3FF3 A;  4OME A;  5HVH A;  1RTQ A;  4O23 A;  2V8H A;  4A39 A;  3MRU A;  2PIZ A;  4ZYQ A;  3B3T A;  4JYW A;  2ZEP A;  4FAI A;  3MN8 A;  1ELL P;  2V8D A;  4PXC A;  3I1U A;  5HVF A;  1VIX A;  3FJU A;  4P4D A;  5IB9 A;  3PB4 X;  1IGB A;  4ONW A;  3CT9 A;  4ZI6 A;  7CPA A;  5HVG A;  4UIA A;  3SJE A;  1Y0Y A;  4KSI A;  4OC3 A;  4NGT A;  4OC0 A;  3LMS A;  4R6T A;  2PJ4 A;  1CPS A;  2WZN A;  3BHX A;  3KQZ A;  1LAP A;  4MHY A;  2XEG A;  4UEF A;  4ZY2 A;  1AMP A;  3KZW A;  3IFE A;  1Z5R A;  3FEE A;  2HB6 A;  4K3N A;  2ZOF A;  1F2O A;  3B3C A;  3T8W A;  4IHM A;  2AFU A;  1PCA A;  3BI0 A;  3JRU A;  4X8I A;  4MHN A;  4IAV A;  3KR4 A;  4MCR A;  4NGS A;  1QQ9 A;  3VH9 A;  2QYV A;  3N5F A;  4FBE A;  5CBM A;  2O53 A;  4ZX9 A;  3B7I A;  5K8O A;  2EK9 A;  2PJA A;  4OC2 A;  1ELM P;  5J1Q A;  3V7Z A;  3NH4 A;  5D29 A;  2PVW A;  4MMO A;  4FWU A;  5LRK A;  5LYF A;  4NGN A;  2IMO A;  4OID A;  2JEW A;  2ZEG A;  2PJC A;  2F7V A;  2WYR A;  2ANP A;  3K9T A;  1CBX A;  4NFR A;  2F8H A;  1YLO A;  3NH8 A;  2ZEH A;  4NGQ A;  3RAM A;  4P44 A;  3KGQ A;  2QJ8 A;  1TKJ A;  3KAS A;  3NFZ A;  3CPX A;  2IJZ A;  4PXE A;  2ZED A;  4NGR A;  1YME A;  3S9L A;  4TNU A;  4PQA A;  1CX8 A;  2PCU A;  3SJG A;  1Y0R A;  2J9A A;  4ZY0 A;  5LYL A;  2DEA A;  2C6P A;  1CG2 A;  1XBU A;  2XEF A;  4CPA A;  3SI2 A;  1UWY A;  2IQ6 A;  5JH9 A;  1CP6 A;  2PJB A;  3PB6 X;  5F09 A;  1GYT A;  3SJX A;  2OOT A;  2CIJ A;  3PB9 X;  2ZEM A;  1Z2L A;  4A38 A;  4YWY A;  4TWE A;  2PJ6 A;  1CP7 A;  3IJ3 A;  3NH5 A;  4OP4 A;  2ZEL A;  2ZEF A;  1BPM A;  5HXD A;  3GUX A;  4BD9 A;  1LAN A;  2EWB A;  2ZEN A;  3S9M A;  5K8N A;  3PFO A;  2AFM A;  5LYD A;  4R76 A;  1LOK A;  4MHZ A;  4OC1 A;  2VL1 A;  4OC4 A;  3PB7 X;  3B3V A;  2POK A;  1LAM A;  4PXB A;  3ISZ A;  4MHP A;  2V77 A;  3WAB A;  3GLJ A;  4WWV A;  3RBU A;  3SI1 A;  4F9U A;  3FH4 A;  4PXD A;  1F2P A;  1Z8L A;  4MRI A;  3CPA A;  3VAR A;  3FVL A;  4P6Y A;  1HDQ A;  2O4H A;  3KR5 A;  3S9N A;  4G1P A;  2PRQ A;  1XRY A;  3D4U A;  2XEJ A;  2BCO A;  2Q51 A;  1ARL A;  5K8M A;  4EWT A;  3D7D A;  4IK2 A;  3VAT A;  4DJL A;  1VHO A;  1XMB A;  3D66 A;  1YW6 A;  4AXV A;  4X2T A;  5I4M A;  2JBJ A;  1YW4 A;  3QNV A;  3K2K A;  5DS0 A;  4YU9 A;  3BXM A;  3KHX A;  3IO1 A;  3HUV A;  2AFW A;  4F9V A;  2BOA A;  2C1C A;  3FX6 A;  1M4L A;  4NGP A;  4P4I A;  2CTB A;  4FUU A;  3TX8 A;  2Q4Z A;  3D68 A;  3IWW A;  3DGV A;  1IY7 A;  4P45 A;  3FEC A;  3V38 A;  4A37 A;  4LQG A;  4R7M A;  2OR4 A;  2ABZ A;  3SJF A;  1H8L A;  3FMC A;  5ELY A;  4MCQ A;  5LRJ A;  2PJ9 A;  1F57 A;  3SI0 A;  2PJ0 A;  2ZOG A;  4RUH A;  3B35 A;  4UEE A;  2FVG A;  4NGM A;  2BO9 A;  2V8V A;  1ZLH A;  3PBB A;  3B2Y A;  4ZX8 A;  3KL9 A;  2GU2 A;  1HDU A;  1CPX A;  2PIY A;  1DTD A;  1ZG7 A;  2GRE A;  4OC5 A;  3KHZ A;  3WC6 A;  3IC1 A;  1BAV A;  4NJQ A;  2PJ8 A;  3D67 A;  2CTC A;  4GM5 A;  3H8G A;  1VGY A;  4OKO A;  3PRT A;  1ZG9 A;  1OBR A;  1YSJ A;  5JGF A;  1QMU A;  3WC5 A;  2C6C A;  2JBK A;  4H2K A;  1JQG A;  8CPA A;  4EME A;  1XJO A;  4ZY1 A;  3D7F A;  4MCP A;  3B3W A;  4WJB A;  1PYT B;  3WT4 A;  3H8F A;  3ISX A;  1FNO A;  1Y7E A;  2AFS A;  4Q7A A;  2EK8 A;  2AFO A;  1TKF A;  3RZA A;  5THW A;  2HC9 A;  4OIW A;  2ZEO A;  3HLP A;  2PJ1 A;  1TXR A;  4EFD A;  3L2N A;  3NA6 A;  6CPA A;  3IEH A;  3PEI A;  2PJ7 A;  3DLJ A;  1KWM A;  1LFW A;  1XFO A;  1R3N A;  2QVP A;  1BLL E;  3KQX A;  4MCS A;  4P4J A;  3WC7 A;  4B6Z A;  4NJR A;  1ARM A;  3B3S A;  1TF9 A;  4PPZ A;  2ZEE A;  2GLF A;  2NSM A;  2Q43 A;  3PBE A;  4DUK A;  3D7G A;  3GB0 A;  4P10 A;  1BPN A;  4MXU A;  1DE4 C;  2C6G A;  3LWU A;  1R43 A;  4P4F A;  2PJ2 A;  4A94 A;  1HEE A;  2AFZ A;  1VHE A;  1ZLI A;  2RFH A;  2PJ5 A;  4UIB A;  3PB8 X;  2G9D A;  5LYI A;  5CPA A;  3IIB A;  1Q7L A;  3FED A;  4UEZ A; 
#chains in the Genus database with same CATH topology
 2FIA A;  1JJ2 Y;  4KLV A;  4CGL A;  1FT7 A;  1TF8 A;  3CCM Z;  2Z3L A;  3S2D I;  2Q4V A;  3CXQ A;  3H8E A;  1K73 2;  2NAP A;  4E2W A;  3T90 A;  1YLE A;  2K3R A;  4UF4 A;  4MD8 A;  2Y0M A;  4DYO A;  4DGL A;  4C7I A;  4R87 A;  3CDX A;  2ARH A;  1Q82 1;  2ZAE B;  1S72 1;  2PE3 A;  4NBC A;  3D2M A;  2Q44 A;  3R9E A;  4AYB A;  2YU9 I;  1Y9K A;  1NSA A;  4X3R A;  2PJ3 A;  4RS2 A;  5EC4 A;  3I56 1;  4L8A A;  1Q2D A;  4HKF A;  4O23 A;  3B3T A;  5A2Q b;  4E32 A;  3MN8 A;  2HQY A;  1GHE A;  2QKD A;  3CCJ Z;  2PR8 A;  1VQ9 1;  1MJA A;  5IB9 A;  1KC8 2;  2REF A;  3FKI I;  4ZI6 A;  2PM9 A;  3BLN A;  1ZO0 A;  3SXN A;  4JD6 A;  2VPZ A;  4UIA A;  1Z01 A;  2PQ8 A;  1V0C A;  3IWE A;  2X7B A;  4MFK A;  2WZN A;  3BHX A;  2F4O A;  2OZK A;  2V3V A;  3FNC A;  4E2A A;  4MHY A;  2Z3N A;  4MH4 A;  1UFH A;  3CC7 1;  2DE5 A;  1Z5R A;  1IOF A;  4K3N A;  1TWH I;  3D9X A;  3JRU A;  1VQ5 1;  4MHN A;  4MCR A;  4FD5 A;  4FBE A;  5F46 A;  2OH1 A;  4OC2 A;  1QSR A;  5HMN A;  5J1Q A;  4FWU A;  1MJB A;  2ZXV A;  2IMO A;  2JEW A;  2F7V A;  3K9T A;  1PU9 A;  1USP A;  1K4J A;  2ZEH A;  4Q36 A;  3KGQ A;  2QJ8 A;  3KAS A;  5C88 A;  3G4S Z;  4A93 I;  1YVO A;  4CYQ A;  2ZED A;  2PRB A;  1YME A;  1YJW Z;  4BY1 I;  3FBU A;  4ZY0 A;  3IGR A;  1XBU A;  2PC1 A;  3S15 I;  3SXO A;  1RO4 A;  1R9T I;  3UY5 A;  4E31 A;  1UWY A;  3PB6 X;  1VQK 1;  3SJX A;  3QWU A;  3TE4 A;  2R93 I;  1Q86 1;  4NOZ A;  4TWE A;  4FD4 A;  4XPD B;  3NH5 A;  1Z4E A;  3K9U A;  4F0X A;  3EER A;  4AB7 A;  2AFM A;  4R76 A;  2Z3M A;  4MHZ A;  4OC1 A;  1QSM A;  4OC4 A;  3PB7 X;  2FCK A;  3B3V A;  3CCR 1;  4PXB A;  4MHP A;  4KUB A;  3SI1 A;  4UFW A;  4L89 A;  4CAF A;  4K30 A;  5D1O A;  4MY3 A;  3RZO I;  3VAR A;  4UCM A;  3FVL A;  4P6Y A;  1YIJ Z;  2O4H A;  2ATR A;  2OTJ 1;  2F5I A;  1XRY A;  3S1M I;  2J8R A;  5D1O B;  2AYD A;  2JEV A;  2OU2 A;  1ARL A;  5K8M A;  4EWT A;  3D7D A;  4DJL A;  4MBU A;  3TT2 A;  5D1P A;  4J3G A;  4B12 A;  2P3Y A;  1IID A;  4X2T A;  2RPR A;  2Q7B A;  4H6U A;  2PR1 A;  3F5B A;  1YIT 1;  4BIN A;  2AFW A;  3NDJ A;  2F4M A;  3F8K A;  3CCL 1;  4F0Y A;  2WB1 A;  4NGP A;  2ZW5 A;  3CCE Z;  2GTI A;  3IWW A;  2OR4 A;  4C7H A;  4MCQ A;  4II9 A;  5LRJ A;  2PJ9 A;  3PGP A;  5H84 A;  4E0A A;  2B5G A;  3B35 A;  2FVG A;  5AG6 A;  1Q86 2;  3HOX I;  1L0C A;  2BO9 A;  3PBB A;  3J81 f;  1KQS Z;  1YHQ Z;  2FIW A;  4HH4 A;  2B5G B;  2PIY A;  1DTD A;  2H5M A;  1ZG7 A;  4OC5 A;  2PJ8 A;  5A27 A;  1Z8W A;  2CTC A;  4GM5 A;  3H8G A;  3VWD A;  1ZG9 A;  1MK4 A;  4MHD A;  1X3Z A;  3G71 1;  4EVY A;  3GIU A;  5JGF A;  1XMT A;  3IU1 A;  5J8F A;  3TFY A;  2C6C A;  1Y7R A;  4QVT A;  1Y9W A;  4H2K A;  8CPA A;  4EME A;  1VQP 1;  1Y8C A;  3D7F A;  4KOU A;  3ZZI A;  4NB9 A;  1KRL A;  4R9M A;  3RZA A;  4HPS A;  5THW A;  4NSQ A;  2VBQ A;  4EFD A;  2JIM A;  5DWN A;  1KWM A;  3G6E Z;  1R3N A;  1S60 A;  5IT9 f;  2D4O A;  2QVP A;  4MCS A;  1N8R 1;  4B6Z A;  1P4N A;  4MFP A;  4JXR A;  4PPZ A;  2ZEE A;  3R9G A;  4EWC A;  3EED A;  1YVK A;  2R8V A;  2E2I I;  1M90 1;  2G3T A;  4MY0 A;  2OZG A;  1LQL A;  1M1D A;  1KD1 1;  3LWU A;  2C6G A;  1YUK A;  1R43 A;  2PJ2 A;  2IL4 A;  4UFX A;  1VQO 1;  4A94 A;  1JWQ A;  1ZLI A;  2HUZ A;  3CC4 Z;  4UIB A;  3T4N B;  3I55 Z;  4R3K A;  3D2L A;  2G9D A;  4DNC A;  4A31 A;  3IIB A;  3EO4 A;  2B58 A;  4LQ6 A;  1YI2 Z;  2CF4 A;  4P4B A;  3DSB A;  4U9Y A;  1EE3 P;  1VQ8 1;  1M4G A;  1YK3 A;  4CYP A;  1QVG Z;  1X12 A;  4F8Z A;  3F3F C;  4QBJ A;  2R92 I;  1K83 I;  2AFX A;  5K8P A;  3I4N I;  2ODF A;  3HKZ A;  4AG7 A;  3JVN A;  3FF3 A;  5HH1 A;  4A33 A;  1KUX A;  3GY9 A;  5LL6 f;  3CCU Z;  4A39 A;  3MRU A;  5F49 A;  2VPX A;  5GCN A;  4ZYQ A;  4LUA A;  2ZEP A;  4FAI A;  3VTN A;  3BG1 B;  1Y1V S;  1JWH C;  2G3A A;  1VIX A;  2VF1 A;  3KIF A;  4MFJ A;  4UWI A;  1QYP A;  3CT9 A;  1VQ4 1;  2R98 A;  4KOR A;  3CPW Z;  3P2H A;  4RI1 A;  2QIR A;  2JS4 A;  1N8R 2;  1S7K A;  2RT9 A;  4OC0 A;  4KZT A;  1CPS A;  2VI7 A;  4M6G A;  3VB9 A;  3KQZ A;  3GTM I;  1AMP A;  3KZW A;  3IFE A;  2HB6 A;  3FEE A;  1KD1 2;  3K7A I;  4BMH A;  2BJO A;  3T8W A;  3S6F A;  2AFU A;  5FVJ A;  3IR7 A;  3MGD A;  4XX2 A;  4NGS A;  5IV0 A;  2WPX A;  1QQ9 A;  3VH9 A;  1VQM 1;  2QYV A;  3N5F A;  5CBM A;  2RBL A;  2M48 A;  1TWG I;  1WK4 A;  2EK9 A;  2KCW A;  3NH4 A;  5D29 A;  2PVW A;  2Q04 A;  1FDO A;  4MMO A;  4ZBG A;  2LFU A;  5AG4 A;  4B14 A;  2P6G A;  2LEX A;  4OID A;  2GTH A;  1QXF A;  4NFR A;  4RVF A;  4CYO A;  5IP7 I;  4NGQ A;  4P44 A;  2GIV A;  1VQ6 1;  2OOY B;  2FS5 A;  3EXN A;  1SFO I;  3CPX A;  1S72 Z;  2IJZ A;  2E9H A;  2OTL 1;  1VHS A;  4A95 A;  4NBF A;  4PQA A;  1CX8 A;  2QEC A;  2DEA A;  2C6P A;  3S1Q I;  1CG2 A;  2XEF A;  3OW2 Y;  2VXK A;  4R3L A;  3TCV A;  3S6G A;  3CCS 1;  3PB9 X;  5G22 A;  2ZEM A;  3QAY A;  3JTK A;  4A38 A;  4NH1 C;  4H6Z A;  3IJ3 A;  3D6W A;  3J80 b;  5A28 A;  4OP4 A;  2LIY A;  1BPM A;  3EY5 A;  3I4M I;  3GUX A;  3GTG I;  4MFZ A;  3ESW A;  1LOK A;  3EFA A;  4GS4 A;  2VL1 A;  3FB3 A;  2POK A;  5T6B A;  2V77 A;  3GLJ A;  3H5Z A;  4WWV A;  4S1T A;  3CC7 Z;  4F9U A;  2PDO A;  2JA6 I;  3TO6 A;  1M44 A;  3CCJ 1;  1VQ5 Z;  2DXQ A;  3KR5 A;  3IX0 A;  4G1P A;  2PRQ A;  3RZD I;  3GCF A;  4KOX A;  1X3W A;  2GFQ A;  2XEJ A;  4E30 A;  2Q51 A;  2JR6 A;  2E2H I;  5JQ4 A;  1I3Q I;  1Q81 1;  4UWJ A;  4ZGY B;  5CM2 M;  4Y49 B;  3JUW A;  4E8O A;  2JBJ A;  2NVY I;  1R57 A;  2EO8 A;  5C44 I;  4KVM E;  1DL6 A;  3I9S A;  2G0B A;  5ISV A;  3V8I A;  1M4L A;  4XPD C;  1YR0 A;  1B87 A;  4P4I A;  3D68 A;  1IY7 A;  1Q82 2;  4IF5 A;  4RVG A;  3V38 A;  4LQG A;  4R7M A;  2J8N A;  1H8L A;  5ELY A;  1QF8 A;  2AKL A;  1F57 A;  4RUH A;  5FLX b;  4CGM A;  4NGM A;  4GXH A;  2K5R A;  4A3G I;  4ZX8 A;  3SHP A;  2QML A;  4CGP A;  1IU8 A;  1IYL A;  3KL9 A;  3HOV I;  1B6B A;  2GRE A;  4RS4 A;  3W6S A;  2YNC C;  1YJW 1;  1J4J A;  4NJQ A;  1VGY A;  3PO2 I;  2IZ3 A;  1YQE A;  4NBH A;  1Z8T A;  2ZPA A;  4C68 A;  1NUI A;  1VQN 1;  4AVC A;  4B5P A;  2YNC A;  4U5Y A;  1XJO A;  4ZY1 A;  4MCP A;  4WJB A;  3WT4 A;  3OWC A;  1FNO A;  1QST A;  1Y7E A;  1TWA I;  1IYK A;  4Q7A A;  2AFO A;  4B5P B;  1TKF A;  2Q0Y A;  2DPS A;  2OTJ Z;  1TXR A;  4NB8 A;  4MFL A;  5FLM I;  4NEX A;  2Z3P A;  1TIQ A;  2PJ7 A;  1QVF Z;  3TE5 B;  4YFJ A;  1S7N A;  3HOY I;  3TTH A;  4AVB A;  3D2P A;  2JA8 I;  1W2B Z;  3TO9 A;  5F47 A;  5C4J I;  4A3L I;  1TWC I;  4RV9 A;  1Q7Y 1;  2IZ4 A;  1Q81 2;  2QEX 1;  3B3S A;  1XIX A;  3CME 1;  4NCZ A;  4PSX A;  1WJ2 A;  2R6M A;  2HV2 A;  1M1K 1;  3IU2 A;  2NSM A;  2Q43 A;  1YIT Z;  4DUK A;  3KIH A;  1VQL 1;  1KUY A;  2CNT A;  4MXU A;  4B10 A;  1XE4 A;  1DE4 C;  3CCL Z;  2Z10 A;  1VHE A;  1PUA A;  3BJ7 A;  2PJ5 A;  1AUG A;  4NF1 A;  3F3P C;  2JMO A;  2EUI A;  5CPA A;  3Q87 A;  1CM0 A;  2PK7 A;  3HOW I;  2QRE B;  2EBJ A;  4A3E I;  4P4E A;  2I3C A;  3LOD A;  1Y1W I;  3JAM b;  2YGW A;  4M85 A;  3G8W A;  2RB7 A;  4CS0 B;  2VUM I;  5LRG A;  3CCV 1;  4R8F A;  1L1O C;  2DF5 A;  2JIQ A;  2VQY A;  4CAV A;  1KUV A;  1S7M A;  3S17 I;  3HOU I;  3G71 Z;  2WUU A;  5D8N A;  3D7H A;  5JM6 A;  2XEI A;  1YJ9 1;  1KZF A;  3BI1 A;  2H85 A;  5E96 A;  3VWE A;  2Q7S A;  4HGZ A;  3S6K A;  4A3K I;  2Z3K A;  1I1D A;  2AJ6 A;  1YRE A;  2PIZ A;  3D8P A;  1TFI A;  4A2Z A;  2B4D B;  4PXC A;  3I1U A;  5HVF A;  3PB4 X;  3GKR A;  1K9M 1;  1VKC A;  2V8K A;  4KS9 A;  3DR8 A;  3LD2 A;  2FSR A;  1Y0Y A;  5G20 A;  3U50 C;  4DK1 A;  4KSI A;  3TOA A;  1X10 A;  1Q7Y 2;  4NGT A;  3I3G A;  3LMS A;  4R6T A;  1NSL A;  4C2Y A;  3GTM S;  4KOS A;  1LAP A;  1I12 A;  1M1K 2;  4UEF A;  3NE7 A;  1VQO Z;  3N7Z A;  1LRZ A;  1F2O A;  1X0T A;  2I79 A;  1PCA A;  3BI0 A;  5F48 A;  3J7A 4;  3R95 A;  3KR4 A;  4OAE A;  2Z3O A;  1WWZ A;  3H4Q A;  1VQ7 1;  5IP9 I;  2DE7 A;  3B7I A;  5KTA A;  2NVT I;  1ELM P;  5LRK A;  3EC4 A;  4QC6 A;  4XPK A;  2NVX I;  1I50 I;  4A3I I;  2I00 A;  3MZL B;  2WYR A;  2W03 A;  2ANP A;  1CBX A;  1I21 A;  3G3S A;  2F8H A;  2R1I A;  1YLO A;  1YX0 A;  2Z0Z A;  2V8J A;  3NFZ A;  1YJN 1;  2BL1 A;  4PXE A;  4PK3 A;  3CZX A;  3S9L A;  3T9Y A;  5IT9 b;  2JDD A;  2EVN A;  3I55 1;  1Y0R A;  5AN9 F;  4BXX I;  4Y7N I;  2P6F A;  3CXC Z;  2PJB A;  3C26 A;  5F09 A;  1FY7 A;  1QVG Y;  4KOT A;  4BBH A;  2CIJ A;  1K73 1;  1Z2L A;  5CNP A;  3VMG A;  3KKW A;  2OOX B;  4E2Y A;  4YWY A;  1CP7 A;  3GKQ A;  4FD6 A;  1K8A 1;  3S1N I;  2QR1 B;  2ZEL A;  5BWA B;  2ZEF A;  3RYO A;  4B11 A;  4A3J I;  4OAD A;  4XNH B;  2BUE A;  2EWB A;  1AA6 A;  4KOV A;  3S9M A;  5DWM A;  4MI4 A;  3QB8 A;  2IV2 X;  1K9M 2;  5K8N A;  3GTP I;  5LYD A;  3QAH A;  2V45 A;  4JWP A;  3MZK B;  3NE8 A;  1LAM A;  2FXF A;  3CXS A;  4E33 A;  5AG7 A;  1BO4 A;  3BG0 B;  2PSW A;  3RBU A;  1Z4R A;  3FRM A;  3CMA 1;  4KSF A;  3VMI A;  1KC8 1;  2YND A;  4MRI A;  4NBG A;  1M90 2;  3CPA A;  2HU9 A;  2QLV B;  1WCM I;  3NDI A;  1VQM Z;  3B8G A;  1Z02 A;  3CQZ I;  1BOB A;  3CCQ Z;  1S3Z A;  2VPW A;  4AG9 A;  4UCN A;  3D4U A;  4CAE A;  4X6A I;  4IK2 A;  4DQY B;  3VAT A;  4HGY A;  5JPH A;  2WPW A;  1YW6 A;  1NP6 A;  5I4M A;  3M3Y I;  1JJ2 Z;  3QNV A;  3CC2 1;  3K2K A;  4B5O A;  2OB0 A;  4YU9 A;  2WAQ A;  2OTL Z;  3BXM A;  3KHX A;  3IO1 A;  3M4O I;  5A2Q f;  1RO2 A;  2AE6 A;  1Z9U A;  3HUV A;  3CD6 1;  2C1C A;  3FX6 A;  3DGV A;  4P45 A;  4XPL A;  3CCS Z;  2OZH A;  1I6H I;  4A37 A;  3DDD A;  5G21 A;  3OW2 Z;  2ABZ A;  5EBV A;  3SJF A;  3FMC A;  2B3V A;  2QA4 1;  3I56 Z;  5I0C A;  3SI0 A;  2PJ0 A;  2ZOG A;  3R9F A;  4UEE A;  4A3F I;  4OLL A;  3W91 A;  3B2Y A;  3CCM 1;  1K8A 2;  4M6H A;  4IUS A;  2JLM A;  1VQ9 Z;  1HDU A;  1QSO A;  2EGT A;  3GTQ I;  3WC6 A;  3IC1 A;  2FT0 A;  1BAV A;  3D67 A;  3S2H I;  2ZW4 A;  3GTJ I;  4QTT A;  1YSJ A;  1QMU A;  4CGN A;  3WC5 A;  5KTD A;  4MON A;  1JQG A;  3TOB A;  4A32 A;  4A3B I;  3H8F A;  3ISX A;  2AFS A;  1Y1V I;  4U9Z A;  2REE A;  4Y49 C;  1YGH A;  2P0W A;  3LAC A;  4OIW A;  4RVH A;  3MON A;  3VMH A;  3L2N A;  4MD7 A;  3NA6 A;  1VLA A;  2J6A A;  3PEI A;  3IFU A;  1OZP A;  4UBR A;  1LFW A;  1XFO A;  1FDI A;  4CGO A;  3I07 A;  3KQX A;  4P4J A;  1TWF I;  2YAD A;  1S7L A;  1TF9 A;  5FLX f;  4QTU A;  2JDC A;  2R7H A;  2ZW6 A;  2RIQ A;  4HNW B;  2KPI A;  4YGO A;  4I49 A;  1SIW A;  4P4F A;  5LYI A;  2B63 I;  1Q7L A;  2E2J I;  4UEZ A;  3PO3 I;  5T67 A;  1VQK Z;  4UCP A;  4KSA A;  2FE7 A;  2VZY A;  3R96 A;  2JUB A;  2GLJ A;  1M4I A;  1ZG8 A;  2PVV A;  1TKH A;  2V8G A;  5C4X I;  4W9Y A;  2FL4 A;  1USP B;  1CJW A;  5IX3 A;  2JA7 I;  1A2Z A;  1ZB8 A;  3TC8 A;  3G4S 1;  4QUS A;  4NBE A;  3PFE A;  2QRC B;  1VQN Z;  3GTO I;  4RN7 A;  2VPY A;  3KI9 A;  1LCP A;  1RLY A;  4R57 A;  4JZ0 A;  4Z65 A;  1AYE A;  2NYQ A;  2G2K A;  4KVO E;  3CCR Z;  4OME A;  1PFT A;  5HVH A;  1RTQ A;  1WII A;  2V8H A;  2Y0S A;  4JYW A;  2OZU A;  1ELL P;  3FXT A;  2V8D A;  1NJI 1;  3S16 I;  4Q38 A;  1N2F A;  3FJU A;  4P4D A;  2HF1 A;  4PV6 A;  1IGB A;  1RNI A;  3RNZ A;  5EMI A;  3GTK I;  2BEI A;  2YNE A;  4ONW A;  1ZB9 A;  3PZJ A;  2K5T A;  1RO0 A;  7CPA A;  5HVG A;  3CXP A;  3SJE A;  2QEX Z;  2DE6 A;  2C27 A;  3CME Z;  5C3E I;  4OC3 A;  2B4B A;  2PJ4 A;  3JAM f;  1VQL Z;  3GTL I;  2D4P A;  2M6N A;  5J8C A;  2XEG A;  3LUS A;  4ZY2 A;  1QVF Y;  4QB9 A;  4E2Z A;  2ZOF A;  1Z03 A;  2VUG A;  1W2B Y;  3B3C A;  4IHM A;  4X8I A;  4IAV A;  1YIJ 1;  4KVX A;  4CRZ B;  2O53 A;  4ZX9 A;  4H89 A;  5K8O A;  2PJA A;  2RC4 A;  3V7Z A;  1RXT A;  2P6E A;  3P5J B;  3CCV Z;  5LYF A;  4NGN A;  1IB1 E;  2DPT A;  2ZEG A;  2PJC A;  3NH8 A;  3PP9 A;  3RAM A;  1TKJ A;  2R7Z I;  1RQF A;  4NGR A;  3A9L A;  4TNU A;  2PCU A;  3SJG A;  2P28 A;  2J9A A;  5LYL A;  1YJ9 Z;  1U6M A;  4CPA A;  5AG5 A;  4JLY A;  3SI2 A;  2IQ6 A;  3CCE 1;  5JH9 A;  2PMZ A;  1CP6 A;  2CXA A;  1P0H A;  2NVQ I;  1GYT A;  2B4D A;  2OOT A;  4MD9 A;  3W6X A;  1YUA A;  4CRY B;  1VQP Z;  1KQS Y;  4CYN A;  2PJ6 A;  1XF8 A;  4M6I A;  1ON0 A;  1XOV A;  5AGE A;  2W04 A;  1QSN A;  3S1R I;  1NJI 2;  4JJX A;  1YHQ 1;  5HXD A;  4BD9 A;  1LAN A;  2ZEN A;  1RO5 A;  4M3S A;  1Q2C A;  4A3M I;  3PFO A;  4YRH A;  3IWG A;  5C82 A;  2CY2 A;  3FIX A;  1NMT A;  3ISZ A;  1Q2Y A;  4C2X A;  3WAB A;  4PK2 A;  4AVA A;  3FH4 A;  4PXD A;  2V8I A;  1F2P A;  3J81 b;  4E2X A;  1Z8L A;  4HNY B;  1HDQ A;  4X5K A;  1NE9 A;  4CAW A;  3S9N A;  4KUA A;  1VQ7 Z;  3F0A A;  3H0G I;  2BCO A;  4ORF A;  1ML8 A;  3G6E 1;  4FD7 A;  1M4D A;  1VHO A;  1XEB A;  1XMB A;  3D66 A;  2O28 A;  1ZH1 A;  2RHB A;  5IB0 A;  4AXV A;  3H3V J;  2ZW7 A;  1VQ8 Z;  3DNS A;  3GYA A;  1YW4 A;  2NMT A;  1WW9 A;  1WZN A;  1YJN Z;  5DS0 A;  3R1K A;  4A30 A;  4A3D I;  2J8M A;  1P9N A;  4F9V A;  2BOA A;  4KLW A;  4CL1 A;  4NBD A;  2CTB A;  4FUU A;  3TX8 A;  2Q4Z A;  4CAX A;  3CC4 1;  3FEC A;  4XNH C;  3FQQ A;  1IOI A;  1N71 A;  2WSA A;  2JNY A;  1S5K A;  2JIP A;  5H86 A;  4LX9 A;  4Y52 I;  1YI2 1;  4B13 A;  3S6H A;  3S14 I;  2V8V A;  2Z11 A;  1MJ9 A;  1ZLH A;  3P2F A;  2CNM A;  3FQM A;  4NBB A;  3ZJ0 A;  3D3S A;  4UFV A;  2GU2 A;  1CPX A;  3FYN A;  4KOW A;  2JIR A;  3KHZ A;  1SQH A;  3CXC Y;  1VQ4 Z;  1IIC A;  2JA5 I;  4BBS I;  1Z8X A;  4OKO A;  3PRT A;  2JIO A;  4HNX B;  4KOY A;  1OBR A;  4NXY A;  2VEZ A;  3DR6 A;  2JBK A;  2QRD B;  4MJ8 A;  3CMA Z;  4JXQ A;  3B3W A;  4BY7 I;  1PYT B;  2E7Z A;  2EK8 A;  3CCU 1;  3WR7 A;  2CNS A;  2HC9 A;  2B3U A;  2GE3 A;  4F6A A;  5KTC A;  3BJ8 A;  2ZEO A;  3HLP A;  5T64 A;  2PJ1 A;  6CPA A;  3IEH A;  3HOZ I;  3CPW Y;  4MFQ A;  3DLJ A;  2Q4Y A;  3E0K A;  2A4N A;  4UA3 A;  1BLL E;  1S7F A;  1Q16 A;  3WC7 A;  3TDH B;  4NJR A;  2KI7 B;  1ARM A;  4ONU A;  2VZZ A;  4A3C I;  2GLF A;  4C2Z A;  3CC2 Z;  2BSW A;  3PBE A;  3RO0 A;  5G1Z A;  3D7G A;  3GB0 A;  4P10 A;  1BPN A;  3CD6 Z;  1VQ6 Z;  4RVD A;  3J80 f;  1HEE A;  2AFZ A;  2RFH A;  3TO7 A;  4BBR I;  3IF8 A;  4NBA A;  3CCQ 1;  3PB8 X;  2GAN A;  3PO3 S;  2QA4 Z;  4PSW A;  3FED A; 
#chains in the Genus database with same CATH homology
 3PO3 I;  5T67 A;  3HOW I;  1JJ2 Y;  1YI2 Z;  1VQK Z;  2CF4 A;  2QRE B;  4A3E I;  4P4E A;  2I3C A;  4P4B A;  1FT7 A;  1TF8 A;  2JUB A;  3CCM Z;  1Y1W I;  3JAM b;  1EE3 P;  2GLJ A;  3S2D I;  1VQ8 1;  2RB7 A;  1ZG8 A;  2VUM I;  2PVV A;  3H8E A;  5LRG A;  1K73 2;  3CCV 1;  1TKH A;  4R8F A;  1QVG Z;  2V8G A;  1L1O C;  4E2W A;  5C4X I;  2K3R A;  4UF4 A;  4MD8 A;  4W9Y A;  4DYO A;  4DGL A;  1S7M A;  1USP B;  3S17 I;  3CDX A;  2JA7 I;  1ZB8 A;  3HOU I;  3TC8 A;  1Q82 1;  2ZAE B;  4F8Z A;  3G4S 1;  1S72 1;  2PE3 A;  3F3F C;  4NBC A;  4NBE A;  3G71 Z;  2R92 I;  3PFE A;  1K83 I;  2QRC B;  5D8N A;  1VQN Z;  4AYB A;  2AFX A;  3GTO I;  3D7H A;  2YU9 I;  5K8P A;  3I4N I;  1LCP A;  3KI9 A;  1RLY A;  4JZ0 A;  5JM6 A;  4Z65 A;  1NSA A;  2XEI A;  3HKZ A;  1YJ9 1;  3BI1 A;  4X3R A;  1AYE A;  2PJ3 A;  2NYQ A;  2G2K A;  3FF3 A;  2H85 A;  3CCR Z;  4OME A;  3I56 1;  1PFT A;  4HGZ A;  5HVH A;  4A3K I;  1RTQ A;  5LL6 f;  1WII A;  4O23 A;  2V8H A;  2Y0S A;  3CCU Z;  4A39 A;  3MRU A;  2PIZ A;  1TFI A;  4ZYQ A;  3B3T A;  4JYW A;  2ZEP A;  4FAI A;  3VTN A;  3BG1 B;  4E32 A;  5A2Q b;  3MN8 A;  1Y1V S;  1ELL P;  2V8D A;  1NJI 1;  4PXC A;  1JWH C;  2QKD A;  3CCJ Z;  3S16 I;  1VQ9 1;  1N2F A;  3I1U A;  1VIX A;  3FJU A;  5HVF A;  4P4D A;  5IB9 A;  2VF1 A;  2HF1 A;  3KIF A;  1KC8 2;  3FKI I;  3PB4 X;  1IGB A;  1RNI A;  1K9M 1;  1QYP A;  3GTK I;  2V8K A;  4ONW A;  3CT9 A;  1ZB9 A;  1VQ4 1;  4ZI6 A;  2PM9 A;  1RO0 A;  7CPA A;  5HVG A;  3CPW Z;  4UIA A;  3SJE A;  2JS4 A;  2QEX Z;  1Y0Y A;  2DE6 A;  1N8R 2;  3U50 C;  3CME Z;  1Z01 A;  2RT9 A;  4DK1 A;  5C3E I;  4KSI A;  4OC3 A;  1Q7Y 2;  4NGT A;  4OC0 A;  3LMS A;  4R6T A;  2PJ4 A;  1CPS A;  3JAM f;  3GTM S;  3VB9 A;  1VQL Z;  2WZN A;  3GTL I;  3BHX A;  3KQZ A;  2F4O A;  2M6N A;  2OZK A;  1LAP A;  3GTM I;  4MHY A;  1M1K 2;  2XEG A;  3LUS A;  4MH4 A;  4UEF A;  1AMP A;  1QVF Y;  3KZW A;  4ZY2 A;  3CC7 1;  1VQO Z;  3IFE A;  2DE5 A;  1Z5R A;  4E2Z A;  2HB6 A;  3FEE A;  1KD1 2;  3K7A I;  4K3N A;  2ZOF A;  1Z03 A;  1TWH I;  2BJO A;  2VUG A;  1X0T A;  1W2B Y;  1F2O A;  3D9X A;  3B3C A;  3T8W A;  4IHM A;  2AFU A;  1PCA A;  3BI0 A;  3JRU A;  4X8I A;  3J7A 4;  1VQ5 1;  4IAV A;  3KR4 A;  4MHN A;  4MCR A;  4XX2 A;  1YIJ 1;  4NGS A;  1QQ9 A;  3VH9 A;  1VQM 1;  2QYV A;  3N5F A;  4FBE A;  1VQ7 1;  5IP9 I;  5CBM A;  2O53 A;  4ZX9 A;  2DE7 A;  2RBL A;  3B7I A;  2M48 A;  1TWG I;  5K8O A;  2NVT I;  2EK9 A;  2PJA A;  4OC2 A;  1ELM P;  5J1Q A;  3V7Z A;  3NH4 A;  5D29 A;  2PVW A;  4MMO A;  4FWU A;  5LRK A;  2LFU A;  3P5J B;  3CCV Z;  5LYF A;  2NVX I;  1I50 I;  4A3I I;  4NGN A;  2IMO A;  4OID A;  2JEW A;  3MZL B;  2GTH A;  2ZEG A;  2PJC A;  2F7V A;  2WYR A;  2W03 A;  2ANP A;  3K9T A;  1CBX A;  4NFR A;  4RVF A;  2F8H A;  1USP A;  5IP7 I;  1YLO A;  3NH8 A;  2ZEH A;  4NGQ A;  3RAM A;  4P44 A;  3KGQ A;  2V8J A;  1TKJ A;  2QJ8 A;  3KAS A;  2R7Z I;  1VQ6 1;  2OOY B;  3NFZ A;  1SFO I;  3G4S Z;  3CPX A;  1YJN 1;  1S72 Z;  4A93 I;  2IJZ A;  1RQF A;  4PXE A;  2ZED A;  4NGR A;  2E9H A;  2OTL 1;  4NBF A;  1YME A;  3S9L A;  1YJW Z;  4TNU A;  4PQA A;  1CX8 A;  5IT9 b;  2PCU A;  4BY1 I;  3SJG A;  2P28 A;  3I55 1;  1Y0R A;  2J9A A;  4ZY0 A;  5LYL A;  2DEA A;  2C6P A;  1YJ9 Z;  3S1Q I;  5AN9 F;  1CG2 A;  1XBU A;  2XEF A;  3OW2 Y;  3S15 I;  4CPA A;  4BXX I;  4Y7N I;  1RO4 A;  1R9T I;  3SI2 A;  4E31 A;  3CCE 1;  1UWY A;  2IQ6 A;  5JH9 A;  2PMZ A;  3CXC Z;  1CP6 A;  2PJB A;  3PB6 X;  5F09 A;  3CCS 1;  1VQK 1;  2NVQ I;  1QVG Y;  1GYT A;  3SJX A;  2OOT A;  3QWU A;  4MD9 A;  2CIJ A;  1K73 1;  3PB9 X;  1YUA A;  2ZEM A;  2R93 I;  1VQP Z;  1Z2L A;  4A38 A;  3VMG A;  2OOX B;  4E2Y A;  1Q86 1;  1KQS Y;  4YWY A;  4NOZ A;  4NH1 C;  4TWE A;  2PJ6 A;  1CP7 A;  3IJ3 A;  3GKQ A;  1K8A 1;  3D6W A;  2W04 A;  3J80 b;  3NH5 A;  3S1N I;  4OP4 A;  2QR1 B;  2ZEL A;  2LIY A;  3S1R I;  1NJI 2;  2ZEF A;  1YHQ 1;  4A3J I;  1BPM A;  5HXD A;  3I4M I;  3GUX A;  1LAN A;  3GTG I;  2EWB A;  2ZEN A;  4BD9 A;  3S9M A;  3EER A;  4A3M I;  1K9M 2;  5K8N A;  3PFO A;  2AFM A;  3ESW A;  3GTP I;  4R76 A;  5LYD A;  1LOK A;  3MZK B;  4MHZ A;  4OC1 A;  2VL1 A;  4OC4 A;  3PB7 X;  3B3V A;  2POK A;  1LAM A;  3CCR 1;  4E33 A;  5T6B A;  4PXB A;  3ISZ A;  4MHP A;  2V77 A;  3WAB A;  3GLJ A;  3BG0 B;  4WWV A;  3RBU A;  3SI1 A;  4S1T A;  3CC7 Z;  4F9U A;  3FH4 A;  4PXD A;  2V8I A;  1F2P A;  2JA6 I;  3J81 b;  3CMA 1;  4E2X A;  3VMI A;  1KC8 1;  1Z8L A;  4MRI A;  5D1O A;  3CCJ 1;  4NBG A;  1M90 2;  3RZO I;  3CPA A;  2HU9 A;  1VQ5 Z;  3VAR A;  3FVL A;  4P6Y A;  2QLV B;  1YIJ Z;  1HDQ A;  1WCM I;  2O4H A;  3NDI A;  3KR5 A;  3S9N A;  1VQM Z;  3IX0 A;  1Z02 A;  3CQZ I;  1VQ7 Z;  4G1P A;  2PRQ A;  3RZD I;  2OTJ 1;  3GCF A;  3CCQ Z;  1XRY A;  3S1M I;  3D4U A;  3H0G I;  1X3W A;  5D1O B;  2XEJ A;  4E30 A;  2BCO A;  2Q51 A;  2JR6 A;  2E2H I;  1ARL A;  1I3Q I;  4X6A I;  5K8M A;  1ML8 A;  4EWT A;  3G6E 1;  3D7D A;  1Q81 1;  4DQY B;  4IK2 A;  3VAT A;  4DJL A;  5CM2 M;  1VHO A;  1XMB A;  3D66 A;  4HGY A;  1ZH1 A;  2RHB A;  5D1P A;  1YW6 A;  4AXV A;  2P3Y A;  3H3V J;  1NP6 A;  4X2T A;  1VQ8 Z;  5I4M A;  2JBJ A;  2NVY I;  2RPR A;  3M3Y I;  1JJ2 Z;  1YW4 A;  1WW9 A;  1YJN Z;  3QNV A;  3CC2 1;  3K2K A;  5DS0 A;  4YU9 A;  5C44 I;  2WAQ A;  4A3D I;  2OTL Z;  3BXM A;  3KHX A;  3IO1 A;  3M4O I;  5A2Q f;  1DL6 A;  1RO2 A;  1YIT 1;  1P9N A;  3HUV A;  2AFW A;  4F9V A;  2BOA A;  3CD6 1;  2C1C A;  3NDJ A;  2F4M A;  1M4L A;  4CL1 A;  3FX6 A;  4NBD A;  3CCL 1;  2WB1 A;  4NGP A;  4P4I A;  2CTB A;  4FUU A;  3TX8 A;  2Q4Z A;  3D68 A;  3CCE Z;  2GTI A;  3IWW A;  3DGV A;  1IY7 A;  4P45 A;  1Q82 2;  3CC4 1;  3CCS Z;  3FEC A;  4RVG A;  1I6H I;  3V38 A;  4A37 A;  4LQG A;  4R7M A;  3OW2 Z;  2OR4 A;  3FQQ A;  2ABZ A;  3SJF A;  1H8L A;  3FMC A;  5ELY A;  1QF8 A;  4MCQ A;  2QA4 1;  3I56 Z;  5LRJ A;  2PJ9 A;  2AKL A;  1F57 A;  2JNY A;  3SI0 A;  2PJ0 A;  5FLX b;  2ZOG A;  3B35 A;  4RUH A;  4Y52 I;  1YI2 1;  4A3F I;  2FVG A;  4UEE A;  4NGM A;  1Q86 2;  3HOX I;  3S14 I;  2K5R A;  2BO9 A;  2V8V A;  1ZLH A;  4A3G I;  3PBB A;  3J81 f;  3B2Y A;  3CCM 1;  1KQS Z;  1YHQ Z;  4ZX8 A;  3FQM A;  4NBB A;  1K8A 2;  3KL9 A;  4HH4 A;  2GU2 A;  1VQ9 Z;  3HOV I;  1HDU A;  1CPX A;  2PIY A;  1DTD A;  1ZG7 A;  2EGT A;  2GRE A;  4OC5 A;  3KHZ A;  4RS4 A;  3GTQ I;  3WC6 A;  1YJW 1;  3IC1 A;  3CXC Y;  1VQ4 Z;  1BAV A;  4NJQ A;  2PJ8 A;  3D67 A;  2JA5 I;  4BBS I;  3S2H I;  2CTC A;  4GM5 A;  3H8G A;  1VGY A;  4OKO A;  3PO2 I;  3GTJ I;  1ZG9 A;  2IZ3 A;  3PRT A;  4NBH A;  1X3Z A;  1OBR A;  4QTT A;  3G71 1;  1YSJ A;  1NUI A;  5JGF A;  1QMU A;  1VQN 1;  3WC5 A;  2C6C A;  2JBK A;  4MON A;  2QRD B;  4H2K A;  1JQG A;  8CPA A;  4EME A;  1XJO A;  3CMA Z;  1VQP 1;  4ZY1 A;  3D7F A;  4MCP A;  3B3W A;  4WJB A;  4BY7 I;  1PYT B;  4A3B I;  3H8F A;  3WT4 A;  4NB9 A;  3ISX A;  1KRL A;  1FNO A;  1Y7E A;  2AFS A;  1TWA I;  4Q7A A;  1Y1V I;  2EK8 A;  2AFO A;  3CCU 1;  1TKF A;  3RZA A;  5THW A;  2HC9 A;  4OIW A;  2ZEO A;  3HLP A;  5T64 A;  2PJ1 A;  2OTJ Z;  4RVH A;  4NB8 A;  1TXR A;  4EFD A;  3MON A;  3VMH A;  5FLM I;  3L2N A;  4MD7 A;  3NA6 A;  6CPA A;  1VLA A;  2J6A A;  3HOZ I;  3IEH A;  3PEI A;  2PJ7 A;  1QVF Z;  3TE5 B;  3CPW Y;  3HOY I;  3DLJ A;  3IFU A;  1KWM A;  1LFW A;  1XFO A;  2JA8 I;  1W2B Z;  3G6E Z;  1R3N A;  5IT9 f;  5C4J I;  2QVP A;  4A3L I;  3I07 A;  1BLL E;  1TWC I;  3KQX A;  1N8R 1;  4MCS A;  4P4J A;  3WC7 A;  4B6Z A;  1TWF I;  3TDH B;  4RV9 A;  1Q7Y 1;  2IZ4 A;  1Q81 2;  2KI7 B;  4NJR A;  1ARM A;  2QEX 1;  3B3S A;  2YAD A;  1TF9 A;  5FLX f;  4QTU A;  4PPZ A;  3CME 1;  2ZEE A;  4EWC A;  4A3C I;  2GLF A;  3EED A;  3CC2 Z;  2E2I I;  2R6M A;  2RIQ A;  1M90 1;  2KPI A;  1M1K 1;  2NSM A;  2Q43 A;  3PBE A;  1YIT Z;  4DUK A;  3D7G A;  3KIH A;  1LQL A;  1VQL 1;  3GB0 A;  4P10 A;  1KD1 1;  1BPN A;  4MXU A;  3CD6 Z;  1VQ6 Z;  1DE4 C;  2C6G A;  1YUK A;  1R43 A;  3LWU A;  4P4F A;  4RVD A;  3CCL Z;  2PJ2 A;  3J80 f;  4A94 A;  1VQO 1;  1HEE A;  2AFZ A;  1VHE A;  1ZLI A;  2RFH A;  3CC4 Z;  2PJ5 A;  4BBR I;  3T4N B;  3IF8 A;  4NBA A;  3I55 Z;  3CCQ 1;  3PB8 X;  4UIB A;  2G9D A;  3F3P C;  2JMO A;  5LYI A;  2B63 I;  5CPA A;  3IIB A;  3PO3 S;  1Q7L A;  3Q87 A;  2QA4 Z;  2E2J I;  3FED A;  2PK7 A;  4UEZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...