2I3CA

Crystal structure of an aspartoacylase from homo sapiens
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
302
structure length
302
Chain Sequence
b'EHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartoacylase
publication title Structure of aspartoacylase, the brain enzyme impaired in Canavan disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 83
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2006-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2i3cA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2i3cA01
2XEGA 4PXCA 3K9TA 3FX6A 2Q51A 3HLPA 3B7IA 3PBBA 4NGMA 4ZYQA 4OP4A 2GREA 4P4DA 1M4LA 1ZLHA 2V8VA 3IIBA 5HXDA 5LYLA 3ISZA 3QNVA 4YU9A 1RTQA 3CDXA 2BOAA 2VL1A 3B2YA 1TKJA 2PIYA 4WWVA 4MHYA 2JEWA 1XFOA 2PJ1A 1DTDA 4P44A 4FWUA 3B3CA 3WC6A 4UEFA 4NJRA 2ZEMA 5IB9A 1GYTA 1Z8LA 3KR5A 5I4MA 2CIJA 2C6CA 2PVWA 1CPSA 3D68A 1XRYA 1VIXA 2HB6A 3BXMA 2PJ9A 2PCUA 1H8LA 5HVHA 3KL9A 2EK8A 4IHMA 2AFOA 4FUUA 3WC5A 5LYFA 2RFHA 1YW4A 4UEZA 1UWYA 2C6GA 2ZEHA 1CG2A 1XJOA 2AFSA 2IJZA 2IQ6A 3CT9A 1ELMP 3KHZA 3B3SA 1TF8A 3BI0A 4NJQA 4H2KA 4MHZA 4A38A 2CF4A 1TKFA 2PVVA 4FBEA 4MXUA 4JYWA 5J1QA 5JM6A 4MRIA 2V8HA 3NH8A 5HVGA 3PB4X 4F8ZA 2BO9A 3B3WA 3H8FA 2XEJA 4UEEA 2J9AA 4NGTA 3JRUA 3DGVA 4PXBA 3FVLA 1XMBA 3KQXA 3NFZA 3PFOA 1TXRA 1FT7A 1CP6A 1Y0RA 1Y7EA 1F2OA 1OBRA 1EE3P 5LRKA 2HC9A 5JH9A 4X3RA 2PJBA 3H8EA 4EWTA 3IEHA 5K8PA 4P4FA 4R76A 2PJ0A 3WC7A 3NH5A 4OKOA 1BLLE 3KZWA 2WZNA 3S9NA 2Q43A 2PJ7A 4OC0A 4KSIA 1LOKA 3RAMA 5LYIA 1NSAA 1DE4C 2FVGA 3B3VA 4O23A 4LQGA 5K8OA 4MCPA 2O4HA 5DS0A 1CPXA 2NYQA 4W9YA 3D67A 4OIWA 4ZY2A 4PXDA 3IC1A 2ZENA 4CPAA 2IMOA 3NH4A 3KASA 1KWMA 3V38A 2JBKA 2PJ5A 3PEIA 3SI2A 5K8NA 2C6PA 1HDQA 2ZEPA 3VARA 2PJ3A 1F57A 3L2NA 3KR4A 3FJUA 2AFMA 3IFEA 3PB6X 1LFWA 1IY7A 4UIAA 2QVPA 1QMUA 4F9UA 2CTBA 1YW6A 1F2PA 1HEEA 4K3NA 2ZEDA 3KGQA 4NGNA 1XBUA 3ISXA 3RZAA 4NFRA 3LMSA 4F9VA 1BAVA 3BI1A 1LCPA 3V7ZA 4IK2A 2EK9A 2Q4ZA 3S9MA 4FAIA 2F7VA 2GLJA 4P4JA 4ONWA 3VATA 3IO1A 3PB8X 4DJLA 1YMEA 3LWUA 4YWYA 3SI1A 3IWWA 5K8MA 2OR4A 4MCQA 4X2TA 4R8FA 3TX8A 1LAMA 2PE3A 4OMEA 4AXVA 1BPNA 2AFZA 4PPZA 1AYEA 3GUXA 3FECA 3FH4A 5CPAA 4ZY0A 2ANPA 2F8HA 3IJ3A 3N5FA 3GLJA 3PRTA 3VH9A 2AFXA 2XEIA 4P6YA 4P4BA 1ZG8A 4R7MA 2PJ6A 4MMOA 3D7GA 1CX8A 3FEEA 2AFWA 2PJAA 2ZOGA 2O53A 2WYRA 4EMEA 4RUHA 3KQZA 1CBXA 2AFUA 3CPXA 2EWBA 3BHXA 4Q7AA 3RBUA 4DUKA 2V8GA 4EFDA 4MCRA 5HVFA 4P10A 3PFEA 4A94A 1Y0YA 4Z65A 4TWEA 1YLOA 1ELLP 2PJ4A 3MRUA 2V8DA 2ZELA 1Z5RA 2PJ2A 3WABA 5F09A 3I1UA 2RB7A 3PB7X 4UIBA 1PCAA 2PJ8A 2PIZA 5D8NA 2XEFA 2POKA 5THWA 5LRJA 1ZG9A 3FMCA 4MCSA 1VHEA 1R3NA 2G9DA 5LYDA 1ZLIA 1ARLA 1R43A 4OC2A 5ELYA 1YSJA 2OOTA 5D29A 1ARMA 4ZX9A 1TKHA 3FF3A 1AMPA 3K2KA 8CPAA 4OC3A 3FEDA 4GM5A 1CP7A 4A37A 4B6ZA 4G1PA 4NGPA 3B3TA 5CBMA 2NSMA 4PXEA 4WJBA 4UF4A 1JQGA 4MHPA 2I3CA 3S9LA 3TC8A 2JBJA 2QYVA 1LAPA 2ZEOA 3KHXA 3SJGA 1Z2LA 4ZI6A 2ZEFA 2ABZA 2PRQA 2V77A 3WT4A 5JGFA 4P4EA 2DEAA 2BCOA 4P45A 4P4IA 5LRGA 3CPAA 3NA6A 3B35A 1QQ9A 4A39A 2C1CA 1ZG7A 2QJ8A 3D4UA 2GLFA 4ZX8A 2ZEEA 3GB0A 3SJEA 1VGYA 3KI9A 4OC5A 4NGRA 4ZY1A 1Q7LA 3D66A 7CPAA 3DLJA 3MN8A 3H8GA 2ZOFA 4MHNA 4OC1A 4NGQA 1HDUA 3SI0A 2GU2A 4DYOA 4X8IA 1VHOA 4BD9A 4PQAA 4TNUA 3SJXA 3D7FA 3D7HA 4NGSA 1LANA 6CPAA 1IGBA 3T8WA 3SJFA 3D7DA 3PB9X 3PBEA 1TF9A 3HUVA 4R6TA 2ZEGA 2CTCA 4OIDA 4IAVA 1PYTB 4JZ0A 2PJCA 1FNOA 1BPMA 4OC4A
chains in the Genus database with same CATH superfamily
1VQM1 2J8NA 2GFQA 3HLPA 5JPHA 3PBBA 2Q0YA 4NBGA 5IX3A 1VQNZ 4OP4A 3M3YI 1YR0A 4P4DA 1M4LA 3IIBA 4JD6A 2PRBA 3S15I 4H6UA 4ORFA 4YU9A 3CDXA 4KSAA 2JIQA 2V8IA 2QA41 3B2YA 1VQOZ 4CYQA 4KZTA 5FLXb 2NMTA 4E33A 2YNDA 3GIUA 2JEWA 2CY2A 4E31A 3DR6A 2CNSA 4UEFA 2F5IA 1Z8XA 1AUGA 4CGLA 5KTCA 3CME1 1VIXA 2R6MA 2PK7A 1Z4EA 3DDDA 2R93I 1S7LA 2RT9A 4B14A 3KL9A 1CM0A 3FXTA 3JTKA 2AFOA 2RFHA 1YW4A 4UEZA 2B3VA 3I561 3CC2Z 2C6GA 2VUMI 3FIXA 4Y49C 1IICA 4RI1A 2IJZA 2PMZA 3BI0A 1TF8A 3EC4A 4H2KA 2EGTA 1TKFA 1YJWZ 4QC6A 4FBEA 1Q862 3NE7A 1I6HI 3IR7A 4KUAA 4U9ZA 5HVGA 5FLMI 4F8ZA 1X0TA 4UEEA 1K4JA 4PSWA 4UCNA 5IP9I 2ATRA 2QEXZ 1XMBA 1QSMA 4K30A 3TO7A 1NP6A 1GHEA 5GCNA 4A2ZA 4CAXA 3NDIA 5C3EI 4UA3A 3CD6Z 3CCJ1 4X6AI 1F2OA 1OBRA 1EE3P 4MFKA 1NJI2 5JH9A 4X3RA 4EWTA 4KLWA 2OZGA 2D4OA 2PJ0A 3GTLI 3NH5A 2WZNA 3S9NA 2PJ7A 2PM9A 2Q7BA 3OWCA 3S14I 4CYOA 5LYIA 3I4MI 3F0AA 4H89A 3B3VA 4A33A 1FY7A 2GTHA 5C4JI 4R3LA 1M1K2 2ZENA 5I0CA 1TFIA 1QF8A 1WCMI 1YGHA 2ZAEB 5A27A 2FSRA 5IT9b 3JUWA 3T9YA 3QB8A 1ZO0A 3SI2A 2PQ8A 1N8R2 1HDQA 3W6XA 5IP7I 1F57A 2W04A 3KR4A 2ZPAA 4HNYB 3T90A 1S721 4KS9A 3VMGA 3PB6X 2DE7A 1RO0A 1IY7A 1LFWA 1Q7Y2 4DK1A 4CRYB 4KOSA 3S16I 1F2PA 3CC4Z 4LQ6A 4C2XA 1VQ71 3FNCA 3LMSA 4F6AA 1U6MA 1WJ2A 5H86A 4NBBA 2EK9A 5AN9F 4MFPA 4MFLA 3F3FC 3D3SA 1Q861 2JA6I 1NE9A 1IOIA 4LUAA 1VQMZ 3LWUA 3QAYA 1I50I 3IWWA 4MCQA 2JUBA 5G22A 3TX8A 1LAMA 3R9EA 3CXCY 4CAWA 4MJ8A 1FDIA 3F3PC 2AFZA 3TE5B 3DR8A 3PRTA 3MZLB 3VH9A 4P4BA 2QA4Z 2W03A 5LL6f 4KOVA 4IF5A 4R7MA 4A3MI 3FEEA 1NJI1 2WYRA 1Z9UA 4RVHA 4RUHA 5FLXf 2J8RA 4B12A 3R9GA 4MH4A 1XE4A 3VWEA 4Y49B 3G6E1 3CMEZ 2V8GA 2P3YA 1VQ61 3H5ZA 4P10A 4RS2A 2OB0A 1Y0YA 4E2AA 3PGPA 4NBCA 1ELLP 5F48A 5F09A 2VXKA 1YIT1 1TWHI 2PDOA 3I56Z 2FS5A 4KORA 1M1K1 1YI21 3CCSZ 3CZXA 2PJ8A 4RN7A 2XEFA 1Y1WI 3G3SA 4MCSA 4R3KA 1VHEA 2G9DA 1ZLIA 1ARLA 3FBUA 3J80b 4KOWA 5ELYA 1YSJA 2V8KA 1ARMA 3K2KA 1AMPA 1MJAA 4OC3A 4KLVA 2Y0MA 1YVKA 4A37A 1VQL1 3FRMA 1I21A 1Q7Y1 4X5KA 4MHPA 1QSNA 3S2HI 1YJN1 4S1TA 4M6GA 2ZEOA 3IFUA 3SJGA 1Z2LA 1MK4A 2V77A 3I55Z 3CCJZ 2GTIA 4P45A 3CPAA 3NA6A 1A2ZA 2VZYA 2C1CA 1K83I 3D4UA 3BG1B 3SJEA 2OTJZ 1M1DA 4HKFA 2B63I 2B5GB 4HNWB 4ZY1A 3D66A 1JWQA 3DLJA 2CNMA 1VLAA 3H8GA 3RYOA 2ZOFA 4BY7I 2V3VA 4NGQA 3GTQI 4NF1A 2E2II 4A3FI 4QTTA 4DYOA 1YUKA 1M4GA 3CPWZ 5E96A 2OZKA 4Y52I 5A28A 2VPWA 5IT9f 4NEXA 1TF9A 4R6TA 4RVGA 1S72Z 5G20A 3SXOA 1FNOA 2M6NA 1I3QI 4OC4A 4NBFA 3HOWI 4PXCA 2Q51A 4A3KI 3FQMA 2ZW7A 2J6AA 4A32A 1KUXA 1NMTA 3VMIA 1VQ7Z 2RPRA 1YQEA 1PUAA 2V8VA 2JNYA 2QRDB 1XEBA 1Z02A 1ML8A 3TO6A 2KPIA 3SHPA 1B87A 3D2PA 2VEZA 4UBRA 1N2FA 2VL1A 5C4XI 4B10A 1USPB 2OU2A 1TKJA 3JVNA 4MHYA 2JIRA 4P44A 1BOBA 1N71A 4UCPA 3B3CA 3WC6A 4NJRA 1GYTA 3KR5A 5I4MA 1WWZA 2CIJA 2PVWA 3D68A 3BXMA 5T6BA 2ARHA 5HVHA 4IHMA 4PV6A 4II9A 2YADA 1JJ2Y 2ZXVA 2GANA 2WUUA 3G6EZ 2AFSA 1Q16A 4CGNA 3CPWY 1NUIA 3KHZA 2Z10A 3B3SA 2VUGA 2IZ3A 2G3TA 2PVVA 4MXUA 4CRZB 2E2HI 3TDHB 1YITZ 2GIVA 3KIFA 1YI2Z 4LX9A 2J9AA 4NGTA 2J8MA 4A3BI 1Z8TA 1PFTA 3RZDI 3DGVA 4PXBA 3NFZA 5T64A 2Z3OA 2JA8I 1TXRA 2FCKA 3J80f 1Y7EA 3RZOI 2OOXB 4BXXI 4AVCA 3D2LA 5H84A 5LRKA 2HC9A 2PJBA 3H8EA 3A9LA 3IEHA 1K9M2 4R76A 1YJNZ 4OKOA 1BLLE 2Q43A 3LODA 2Q4YA 4OC0A 4KSIA 4B11A 4CYPA 1LOKA 1Y1VS 4A3JI 2FVGA 2FXFA 5K8OA 2B5GA 1Y1VI 3R1KA 5DS0A 1V0CA 4DQYB 4BMHA 2WAQA 1YLEA 4CPAA 2Z3MA 1KWMA 3GKQA 4E2XA 5F47A 4GXHA 2D4PA 2FE7A 5K8NA 2C6PA 3IWGA 3CCL1 2ZEPA 1QYPA 2M48A 1Y7RA 3PO2I 3CCE1 4A93I 4KOTA 1WZNA 2WPXA 2IL4A 1TWFI 4UIAA 2QVPA 4A3II 2EO8A 2HQYA 4K3NA 1X12A 2ZEDA 4NGNA 5AG4A 1XBUA 4XPLA 2HV2A 3CCS1 4F9VA 4JXRA 1BAVA 3BI1A 1L0CA 3I9SA 4M6IA 2Q4ZA 4AG9A 4A3LI 2F7VA 4BBHA 3LUSA 1Q811 2NVQI 2GLJA 4P4JA 1KD12 3VATA 2Y0SA 1S7NA 2H85A 2ZW5A 1YMEA 3SI1A 4CAVA 2AE6A 5K8MA 4MD7A 2KCWA 1USPA 1IOFA 2CNTA 4PPZA 4A3DI 1AYEA 2DF5A 3FH4A 3R9FA 3GLJA 4MY0A 2EUIA 4E0AA 1YREA 2AFXA 2JIPA 4KVOE 3I551 2FIAA 3VB9A 1TWCI 2AFWA 2YNEA 2ZOGA 5F46A 4E2YA 3GTOI 1K9M1 1R57A 2VPZA 3IU1A 3J7A4 4MD8A 1YK3A 2K5TA 2JIMA 4R9MA 4MCRA 4HPSA 2R98A 2OTJ1 2AJ6A 1I12A 3D8PA 3CCUZ 3MGDA 2VPYA 1YLOA 3CXQA 2PJ4A 3MRUA 4MI4A 2V8DA 1RNIA 2ZELA 5CNPA 2PJ2A 3I1UA 2Z3NA 3ESWA 3PB7X 4UIBA 2PIZA 3B8GA 2NVTI 5D8NA 2YU9I 3I3GA 3FMCA 3S6HA 3UY5A 4E32A 4OC2A 2OOTA 1VQK1 5D29A 3U50C 2O28A 5J8FA 3GTMS 3FEDA 2LIYA 4BINA 4MBUA 1TIQA 2NSMA 4PXEA 4ZBGA 3GTMI 3KKWA 2R7HA 3CCQZ 2I3CA 1XMTA 1M44A 2BEIA 2QYVA 2B58A 2E7ZA 2G2KA 2QREB 4ZI6A 2ZEFA 2NVXI 2ABZA 3WT4A 2ZW4A 5JGFA 4R87A 4P4IA 4QUSA 2Z3PA 1KD11 3B35A 1ZG7A 2K3RA 1RO5A 2QJ8A 4NBAA 5G1ZA 3G711 2GLFA 2R92I 2ZEEA 4JLYA 3KI9A 4CYNA 2RBLA 1Q7LA 3CMA1 7CPAA 4NH1C 2V45A 3QAHA 2HF1A 3M4OI 3HOXI 3ZJ0A 1Y9KA 2JR6A 1Z4RA 3D6WA 4CAEA 4PQAA 3PO3S 3P2FA 3D7HA 4U9YA 5D1OB 3CCLZ 1LANA 2VF1A 4XPDC 3SJFA 4CGOA 5T67A 3PO3I 2OZHA 3CCEZ 2ZEGA 4IAVA 1PYTB 4JZ0A 1ZB8A 1Z03A 1RQFA 1BPMA 2WSAA 2JMOA 3IWEA 1Q822 3S6GA 5KTAA 3K9TA 3FX6A 4MFZA 4CS0B 3B7IA 2DPSA 4MONA 4ZYQA 5AG5A 4HGZA 1LRZA 2NVYI 4R57A 4AG7A 2K5RA 1N8R1 4C2ZA 3TT2A 3QNVA 1RTQA 4QB9A 3K9UA 3PP9A 4M85A 2BOAA 5D1PA 3S2DI 2G3AA 1Q2YA 2PIYA 3GY9A 2VI7A 4NCZA 1JWHC 3G8WA 2PJ1A 1DTDA 2JDCA 4FWUA 1ZH1A 1X10A 4NBEA 1Z8LA 2PJ9A 4KVME 2PCUA 2F4MA 1H8LA 2B4BA 2G0BA 3DSBA 3LACA 4RVFA 4FUUA 5HH1A 3WC5A 5ISVA 3CXPA 4DGLA 3HKZA 2PR8A 1UWYA 1KUYA 2ZEHA 3S6FA 1R9TI 1X3ZA 2IQ6A 3CT9A 4AYBA 2CXAA 3GYAA 3TFYA 4NJQA 4AVBA 2JDDA 3EY5A 4MHZA 2CF4A 5J1QA 1P4NA 4MRIA 2P28A 2V8HA 1YVOA 2DXQA 2BO9A 3B3WA 3H8FA 5KTDA 5AG6A 1W2BZ 3FVLA 3KQXA 4AB7A 4FD5A 3PFOA 4KOUA 3CCR1 1VQKZ 1K732 3IU2A 2FL4A 4E8OA 2DE5A 2BSWA 4EVYA 1Q821 1PU9A 4OLLA 5K8PA 1RO4A 1RXTA 2HUZA 3RAMA 4Q36A 3BJ7A 2WB1A 2LEXA 4LQGA 5EBVA 2O4HA 1CPXA 3D67A 1VQ81 3FB3A 3NE8A 1WIIA 3G71Z 2JEVA 4FD4A 2E9HA 5CM2M 3GTGI 2JBKA 3FYNA 1TWAI 4XPDB 2OH1A 3CMAZ 2QECA 3JAMb 3GTJI 5D1OA 1KRLA 4BY1I 4NBDA 2Q04A 3CCU1 2VBQA 1QMUA 2CTBA 2I79A 3BLNA 1X3WA 3ISXA 3RO0A 3RZAA 5IB0A 2HU9A 1IYLA 4DNCA 2REEA 4NXYA 1SFOI 3RNZA 3V7ZA 3TCVA 3S9MA 3OW2Z 1W2BY 4ONWA 3IO1A 3PB8X 4L89A 4YWYA 4CL1A 3G4S1 1S7FA 4KOYA 2OR4A 4FD6A 1ON0A 4OADA 4AVAA 4GS4A 3S1NI 1P0HA 1IU8A 2EVNA 4AXVA 1BPNA 3GUXA 3FECA 5CPAA 4ZY0A 3CCQ1 2ANPA 2F8HA 3N5FA 1KQSZ 1TWGI 4FD7A 2FIWA 3TO9A 2XEIA 1ZG8A 4JJXA 4MMOA 3D7GA 1CX8A 4B13A 4EMEA 2PC1A 1CBXA 1Y8CA 2EWBA 3RBUA 4HNXB 3CCVZ 4UWIA 4E2WA 3GTPI 3PZJA 4EFDA 2BUEA 3S17I 3GTKI 1VKCA 4TWEA 3IF8A 1RO2A 2H5MA 1Z01A 4HGYA 4A30A 1Z5RA 1IB1E 2RB7A 4MHDA 1PCAA 4I49A 2POKA 5LRJA 1ZG9A 1R3NA 1VQP1 5LYDA 1R43A 5A2Qb 4ZX9A 3FF3A 1S5KA 8CPAA 4CAFA 3V8IA 4B6ZA 4G1PA 3OW2Y 3D2MA 3B3TA 1VHSA 5CBMA 1S60A 4C2YA 1JQGA 2YNCC 3S9LA 3TC8A 4KVXA 3BJ8A 1RLYA 2JBJA 3CCRZ 1LAPA 2AYDA 3KHXA 3J81f 2ODFA 1ZB9A 2BCOA 5LRGA 1QQ9A 3HOYI 3CXSA 2B3UA 4CGPA 1KQSY 3VWDA 5AGEA 3GCFA 5J8CA 2IZ4A 2OOYB 3W6SA 2KI7B 4NBHA 3GB0A 4OC5A 1VQ51 4NGRA 2GE3A 2Q44A 3TOAA 4Y7NI 2Z3KA 3T4NB 1VQ91 1VQ8Z 2GU2A 3WR7A 4X8IA 1QSRA 3DNSA 4XNHC 2OTL1 4TNUA 3C26A 2Z11A 3F5BA 4PK3A 2DE6A 1QVGZ 3IX0A 3GKRA 3D9XA 3D7DA 3CCM1 3JAMf 3PB9X 3P5JB 3HUVA 4A3EI 4OIDA 1FDOA 3CXCZ 1YIJZ 3HOUI 2VPXA 1YJ9Z 1LQLA 2XEGA 3Q87A 3H0GI 1Q2CA 4NGMA 2GREA 5C44I 1ZLHA 3IGRA 5HXDA 3MONA 2ZW6A 1K8A2 5LYLA 3ISZA 2JLMA 3G4SZ 2FT0A 3CC71 3CQZI 1YX0A 4MY3A 4WWVA 3EXNA 3HOZI 5G21A 1XFOA 1P9NA 5EC4A 2ZEMA 4JXQA 4C7HA 5IB9A 4L8AA 2C6CA 1CPSA 4B5OA 4BBSI 1XRYA 2HB6A 3P2HA 2A4NA 5AG7A 2EK8A 1UFHA 3K7AI 4RV9A 5LYFA 2QMLA 2IV2X 1KUVA 1CG2A 1XJOA 1QSOA 4NSQA 4NB8A 1ELMP 4A38A 4JYWA 5JM6A 1QVGY 2OZUA 3H4QA 1MJ9A 3NH8A 3PB4X 4UFVA 2F4OA 2XEJA 2R8VA 3N7ZA 3JRUA 4KUBA 4YRHA 1AA6A 1VQPZ 1S7MA 4KSFA 1FT7A 4Q38A 1CP6A 1Y0RA 5A2Qf 1YHQ1 3NDJA 1DL6A 3EEDA 1QVFZ 2BJOA 1WK4A 3BG0B 1Y9WA 4E2ZA 3TTHA 2R1IA 3R95A 4P4FA 2PR1A 3WC7A 3H3VJ 3KZWA 2E2JI 1WW9A 4QVTA 2P6FA 1IYKA 1VQ41 3LD2A 1NSAA 1DE4C 4PSXA 4O23A 4MCPA 1K8A1 2I00A 4JWPA 2DPTA 2NYQA 4W9YA 2BL1A 3I07A 2JIOA 4OIWA 4ZY2A 3S1QI 4KOXA 2WPWA 4PXDA 3IC1A 4ONUA 2AKLA 2IMOA 3NH4A 4XNHB 3EO4A 3KASA 5DWNA 3R96A 4UFWA 3V38A 1VQ5Z 2RC4A 2PJ5A 1QSTA 3KIHA 3PEIA 1Q2DA 1CJWA 2B4DB 1L1OC 4ZGYB 1VQ9Z 3VMHA 3VARA 2PJ3A 3TOBA 3L2NA 3CCV1 3QWUA 3FJUA 2AFMA 2JA7I 5C82A 2JS4A 1OZPA 3IFEA 4A31A 2V8JA 1S7KA 2OTLZ 4F9UA 1YW6A 4F0XA 1HEEA 3KGQA 2C27A 4PK2A 2QKDA 1IIDA 4NFRA 1XF8A 3CCMZ 1YUAA 1VQN1 4YGOA 1KZFA 1LCPA 2PSWA 4IK2A 4B5PB 4FAIA 3E0KA 2Z3LA 4DJLA 3MZKB 4M3SA 3VTNA 4EWCA 1VQO1 4X2TA 4M6HA 4E30A 4H6ZA 1QVFY 4R8FA 2PE3A 4OMEA 2RIQA 3IJ3A 2VZZA 1JJ2Z 3J81b 1M4IA 3S1RI 3CC7Z 4P6YA 2P0WA 2Q7SA 2PJ6A 2X7BA 2PJAA 2O53A 2LFUA 3KQZA 4RS4A 2Z0ZA 1BO4A 2AFUA 4A95A 4NB9A 3CPXA 3W91A 4U5YA 3CC21 3BHXA 4J3GA 4Q7AA 4UWJA 4DUKA 1M902 4F0YA 5HVFA 3PFEA 4A94A 1XOVA 4Z65A 1KC82 2REFA 5BWAB 1YJW1 3F8KA 3WABA 4MFJA 4XX2A 2RHBA 2QR1B 5THWA 5DWMA 5JQ4A 4YFJA 2QEX1 2YGWA 4C68A 2YNCA 2JA5I 1TKHA 3FQQA 5C88A 3S6KA 5F49A 3CD61 4GM5A 1CP7A 4UFXA 4MFQA 2Q4VA 4NGPA 4C7IA 4XPKA 1YIJ1 4WJBA 3EERA 1YJ91 4UF4A 2QRCB 1MJBA 1QXFA 1I1DA 1B6BA 4HH4A 1M4DA 1YHQZ 2PRQA 4P4EA 2DEAA 2EBJA 2NAPA 1SQHA 4RVDA 4A3CI 5IV0A 4UCMA 4A39A 4MD9A 3I4NI 1NSLA 2QLVB 1Z8WA 4QBJA 3TE4A 4BBRI 4ZX8A 2QIRA 1VQ6Z 4A3GI 1VGYA 1VQ4Z 4QTUA 4OAEA 1Q812 2VQYA 3EFAA 4NOZA 3MN8A 3SXNA 3FKII 4MHNA 4OC1A 5EMIA 2B4DA 1HDUA 3SI0A 1K731 3ZZIA 2P6EA 5FVJA 2R7ZI 5HMNA 1S3ZA 1VHOA 3S1MI 4IUSA 3HOVI 1XIXA 4BD9A 1SIWA 3SJXA 3D7FA 3CC41 4NGSA 2P6GA 6CPAA 1IGBA 3T8WA 4CGMA 1J4JA 1M901 3PBEA 2CTCA 1KC81 1VQLZ 2PJCA 4B5PA
chains in the Genus database with same CATH topology
1VQM1 1YJ9Z 1LQLA 2XEGA 4PXCA 3K9TA 3FX6A 2Q51A 3Q87A 3HLPA 4A3KI 3H0GI 3FQMA 3B7IA 4MONA 3PBBA 4NGMA 4NBGA 4ZYQA 2J6AA 1VQNZ 3VMIA 4OP4A 3M3YI 1VQ7Z 2RPRA 4HGZA 2GREA 4P4DA 1M4LA 5C44I 1ZLHA 2V8VA 2NVYI 3IIBA 2JNYA 2QRDB 2K5RA 5HXDA 1Z02A 1ML8A 3S15I 1N8R1 3MONA 2KPIA 1K8A2 5LYLA 3ISZA 3QNVA 4YU9A 1RTQA 3CDXA 2BOAA 3G4SZ 5D1PA 1N2FA 2VL1A 2V8IA 5C4XI 3CC71 2QA41 3CQZI 1USPB 3B2YA 1VQOZ 3S2DI 1TKJA 2PIYA 4WWVA 5FLXb 4E33A 4MHYA 3HOZI 2JEWA 1XFOA 1JWHC 4E31A 2PJ1A 1DTDA 4P44A 1P9NA 4FWUA 3B3CA 3WC6A 4UEFA 1ZH1A 4NJRA 2ZEMA 4NBEA 5IB9A 1GYTA 1Z8LA 3KR5A 5I4MA 3CME1 2CIJA 2C6CA 2PVWA 1CPSA 3D68A 4BBSI 1XRYA 1VIXA 2R6MA 2HB6A 3BXMA 5T6BA 2PJ9A 2PK7A 2PCUA 2F4MA 2R93I 1H8LA 2RT9A 5HVHA 3KL9A 2EK8A 4IHMA 3K7AI 4RVFA 4RV9A 2AFOA 4FUUA 2YADA 3WC5A 5LYFA 2RFHA 4DGLA 1YW4A 4UEZA 1JJ2Y 3HKZA 3I561 3CC2Z 1UWYA 2C6GA 2VUMI 2ZEHA 1CG2A 3G6EZ 1XJOA 2AFSA 1R9TI 3CPWY 1X3ZA 2IJZA 2IQ6A 3CT9A 4AYBA 1NUIA 4NB8A 1ELMP 3KHZA 2PMZA 3B3SA 1TF8A 2VUGA 3BI0A 2IZ3A 4NJQA 4H2KA 2EGTA 4MHZA 4A38A 2CF4A 1TKFA 1YJWZ 2PVVA 4FBEA 1Q862 4MXUA 4JYWA 1I6HI 5J1QA 5JM6A 4MRIA 1QVGY 2E2HI 2P28A 2V8HA 3TDHB 3NH8A 1YITZ 5HVGA 3PB4X 3KIFA 5FLMI 1YI2Z 4F8ZA 1X0TA 2BO9A 2F4OA 3B3WA 3H8FA 2XEJA 4UEEA 2J9AA 4NGTA 3JRUA 4A3BI 3DGVA 1PFTA 3RZDI 5IP9I 1W2BZ 2QEXZ 1VQPZ 3FVLA 1XMBA 3KQXA 4PXBA 3NFZA 5T64A 1S7MA 3PFOA 2JA8I 1NP6A 1TXRA 3CCR1 1FT7A 1VQKZ 1CP6A 1Y0RA 5A2Qf 3J80f 1Y7EA 1K732 3NDIA 3RZOI 1YHQ1 2OOXB 5C3EI 4BXXI 3NDJA 1DL6A 2DE5A 3CD6Z 3CCJ1 4X6AI 1F2OA 1OBRA 1EE3P 3EEDA 1QVFZ 5LRKA 2BJOA 1NJI2 2HC9A 5JH9A 4X3RA 1Q821 3BG0B 2PJBA 3H8EA 4EWTA 4E2ZA 3IEHA 5K8PA 1K9M2 4P4FA 4R76A 2PJ0A 1RO4A 1YJNZ 3WC7A 3GTLI 3NH5A 3H3VJ 1BLLE 3KZWA 2WZNA 4OKOA 2Q43A 3S9NA 2PJ7A 2E2JI 1WW9A 2PM9A 4OC0A 4KSIA 3S14I 1LOKA 1VQ41 1Y1VS 3RAMA 5LYIA 1NSAA 3I4MI 4A3JI 1DE4C 2FVGA 2WB1A 3B3VA 4O23A 4LQGA 5K8OA 4MCPA 2O4HA 1K8A1 1Y1VI 5DS0A 1CPXA 2NYQA 4W9YA 3D67A 3I07A 1VQ81 4OIWA 4ZY2A 3S1QI 2GTHA 5C4JI 1M1K2 4DQYB 4PXDA 1WIIA 3IC1A 2WAQA 3G71Z 2ZENA 4CPAA 2AKLA 2IMOA 1TFIA 2E9HA 3NH4A 1QF8A 3KASA 5CM2M 1KWMA 1WCMI 3GKQA 3V38A 3GTGI 2JBKA 2ZAEB 4E2XA 1VQ5Z 5IT9b 2PJ5A 1TWAI 3KIHA 3PEIA 3SI2A 3CMAZ 5K8NA 1N8R2 2C6PA 1HDQA 1L1OC 3CCL1 3JAMb 1VQ9Z 5IP7I 2ZEPA 1QYPA 3VMHA 3GTJI 5D1OA 3VARA 2PJ3A 2M48A 1F57A 3L2NA 2W04A 3CCV1 3KR4A 3QWUA 3PO2I 3FJUA 2AFMA 2JA7I 2JS4A 1KRLA 3CCE1 1S721 4A93I 3IFEA 3VMGA 4BY1I 4NBDA 3CCU1 3PB6X 2DE7A 2V8JA 1TWFI 1RO0A 1IY7A 1LFWA 2QVPA 4UIAA 2OTLZ 1QMUA 4A3II 4DK1A 1Q7Y2 4F9UA 2CTBA 3S16I 1YW6A 1F2PA 1HEEA 4K3NA 3CC4Z 2ZEDA 3KGQA 4NGNA 1XBUA 1X3WA 2QKDA 3ISXA 3RZAA 4NFRA 2HU9A 3CCMZ 1YUAA 3CCS1 1VQN1 1VQ71 3LMSA 4F9VA 1SFOI 1BAVA 3BI1A 1LCPA 3V7ZA 4IK2A 4NBBA 2EK9A 5AN9F 2Q4ZA 3S9MA 4FAIA 4A3LI 3OW2Z 2F7VA 3LUSA 1Q811 1W2BY 3F3FC 2NVQI 2GLJA 4P4JA 1Q861 2JA6I 4ONWA 1KD12 1VQMZ 2Y0SA 3VATA 3IO1A 3PB8X 4DJLA 2H85A 1YMEA 3LWUA 4YWYA 4CL1A 3G4S1 3MZKB 3SI1A 3VTNA 4EWCA 1I50I 3IWWA 5K8MA 4MD7A 1VQO1 2OR4A 4MCQA 4X2TA 2JUBA 4E30A 1USPA 3S1NI 4R8FA 1QVFY 1LAMA 3TX8A 3CXCY 2PE3A 4OMEA 4AXVA 1BPNA 3F3PC 2AFZA 4PPZA 4A3DI 1AYEA 3GUXA 3FECA 3TE5B 3FH4A 2RIQA 5CPAA 3CCQ1 4ZY0A 2ANPA 2F8HA 3IJ3A 3N5FA 3GLJA 1KQSZ 1TWGI 1JJ2Z 3PRTA 3J81b 3MZLB 3VH9A 2AFXA 2XEIA 3S1RI 3CC7Z 4P6YA 4P4BA 2QA4Z 1ZG8A 2W03A 5LL6f 4R7MA 4A3MI 2PJ6A 4MMOA 3I551 3D7GA 1CX8A 3VB9A 1TWCI 3FEEA 2AFWA 2PJAA 2ZOGA 1NJI1 2O53A 2WYRA 4EMEA 2LFUA 4RVHA 4RUHA 3KQZA 4RS4A 5FLXf 4E2YA 3GTOI 1CBXA 1K9M1 2AFUA 4NB9A 3CPXA 4MH4A 2EWBA 3J7A4 3CC21 3BHXA 4MD8A 4Q7AA 3RBUA 3CCVZ 4E2WA 3G6E1 4DUKA 3CMEZ 2V8GA 3GTPI 1M902 4EFDA 2P3YA 4MCRA 1VQ61 2OTJ1 5HVFA 4P10A 3PFEA 4A94A 3S17I 1Y0YA 4Z65A 3GTKI 3CCUZ 1KC82 4TWEA 3IF8A 1RO2A 1YLOA 1YJW1 4NBCA 1Z01A 1ELLP 2PJ4A 3MRUA 4HGYA 2V8DA 1RNIA 2ZELA 1Z5RA 2PJ2A 3WABA 4XX2A 5F09A 3I1UA 2RHBA 1TWHI 3ESWA 1YIT1 2RB7A 3I56Z 3PB7X 1M1K1 1YI21 4UIBA 1PCAA 3CCSZ 2PJ8A 2PIZA 2NVTI 5D8NA 2XEFA 2QR1B 2YU9I 2POKA 1Y1WI 5LRJA 5THWA 1ZG9A 3FMCA 4MCSA 1VHEA 1R3NA 2G9DA 2QEX1 1VQP1 5LYDA 1ZLIA 1ARLA 1R43A 4E32A 4OC2A 5A2Qb 3J80b 5ELYA 1YSJA 1VQK1 2OOTA 5D29A 3U50C 2V8KA 1ARMA 2JA5I 4ZX9A 1TKHA 3FF3A 1AMPA 3K2KA 8CPAA 4OC3A 3FQQA 3GTMS 3FEDA 2LIYA 3CD61 4GM5A 1CP7A 4A37A 4B6ZA 1VQL1 4G1PA 3OW2Y 4NGPA 3B3TA 5CBMA 1Q7Y1 1YIJ1 2NSMA 4PXEA 3GTMI 4WJBA 3EERA 1YJ91 4UF4A 1JQGA 4MHPA 3S2HI 3CCQZ 2QRCB 2I3CA 3S9LA 1YJN1 3TC8A 1RLYA 4S1TA 3CCRZ 2JBJA 2QYVA 1LAPA 2ZEOA 4HH4A 3IFUA 2G2KA 2QREB 1YHQZ 1Z2LA 3J81f 3KHXA 2ZEFA 3SJGA 4ZI6A 2NVXI 2ABZA 2PRQA 2V77A 3WT4A 3I55Z 3CCJZ 5JGFA 4P4EA 2DEAA 1ZB9A 2GTIA 2BCOA 4P45A 4P4IA 5LRGA 4RVDA 3CPAA 3NA6A 4A3CI 1KD11 3B35A 1QQ9A 3HOYI 4A39A 2C1CA 4MD9A 1KQSY 3I4NI 2K3RA 1K83I 1ZG7A 2QLVB 2QJ8A 4NBAA 3GCFA 3D4UA 2IZ4A 2OOYB 4BBRI 2KI7B 3G711 2GLFA 4ZX8A 3BG1B 2R92I 4NBHA 2ZEEA 3GB0A 3SJEA 1VQ6Z 2OTJZ 4A3GI 1VGYA 1VQ4Z 3KI9A 2B63I 4QTUA 4OC5A 1VQ51 4NGRA 2RBLA 4Y7NI 4ZY1A 1Q812 1Q7LA 3CMA1 3D66A 7CPAA 3DLJA 4NOZA 1VLAA 3T4NB 3H8GA 3MN8A 4NH1C 2ZOFA 3FKII 1VQ91 4MHNA 4OC1A 4BY7I 2HF1A 3M4OI 3HOXI 4NGQA 3GTQI 1HDUA 3SI0A 1VQ8Z 2GU2A 2E2II 4A3FI 1K731 4QTTA 2JR6A 2R7ZI 4DYOA 1YUKA 4X8IA 1VHOA 3S1MI 3CPWZ 3D6WA 3HOVI 2OZKA 4BD9A 2OTL1 4Y52I 4PQAA 4TNUA 3PO3S 3SJXA 3D7FA 3D7HA 5D1OB 3CC41 5IT9f 2DE6A 4NGSA 3CCLZ 1LANA 2VF1A 6CPAA 1QVGZ 3IX0A 1IGBA 3T8WA 3SJFA 3D9XA 3D7DA 3CCM1 5T67A 3JAMf 3PO3I 3PB9X 1M901 3PBEA 3P5JB 1TF9A 3HUVA 4R6TA 3CCEZ 4RVGA 4A3EI 2ZEGA 2CTCA 4OIDA 1S72Z 4IAVA 1PYTB 1KC81 4JZ0A 1ZB8A 1Z03A 1VQLZ 2PJCA 1FNOA 1RQFA 1I3QI 2M6NA 1BPMA 4OC4A 3CXCZ 4NBFA 2JMOA 3HOWI 1YIJZ 1Q822 3HOUI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XEG A;  4PXC A;  3K9T A;  3FX6 A;  2Q51 A;  3HLP A;  3B7I A;  3PBB A;  4NGM A;  4ZYQ A;  4OP4 A;  2GRE A;  4P4D A;  1M4L A;  1ZLH A;  2V8V A;  3IIB A;  5HXD A;  5LYL A;  3ISZ A;  3QNV A;  4YU9 A;  1RTQ A;  3CDX A;  2BOA A;  2VL1 A;  3B2Y A;  1TKJ A;  2PIY A;  4WWV A;  4MHY A;  2JEW A;  1XFO A;  2PJ1 A;  1DTD A;  4P44 A;  4FWU A;  3B3C A;  3WC6 A;  4UEF A;  4NJR A;  2ZEM A;  5IB9 A;  1GYT A;  1Z8L A;  3KR5 A;  5I4M A;  2CIJ A;  2C6C A;  2PVW A;  1CPS A;  3D68 A;  1XRY A;  1VIX A;  2HB6 A;  3BXM A;  2PJ9 A;  2PCU A;  1H8L A;  5HVH A;  3KL9 A;  2EK8 A;  4IHM A;  2AFO A;  4FUU A;  3WC5 A;  5LYF A;  2RFH A;  1YW4 A;  4UEZ A;  1UWY A;  2C6G A;  2ZEH A;  1CG2 A;  1XJO A;  2AFS A;  2IJZ A;  2IQ6 A;  3CT9 A;  1ELM P;  3KHZ A;  3B3S A;  1TF8 A;  3BI0 A;  4NJQ A;  4H2K A;  4MHZ A;  4A38 A;  2CF4 A;  1TKF A;  2PVV A;  4FBE A;  4MXU A;  4JYW A;  5J1Q A;  5JM6 A;  4MRI A;  2V8H A;  3NH8 A;  5HVG A;  3PB4 X;  4F8Z A;  2BO9 A;  3B3W A;  3H8F A;  2XEJ A;  4UEE A;  2J9A A;  4NGT A;  3JRU A;  3DGV A;  4PXB A;  3FVL A;  1XMB A;  3KQX A;  3NFZ A;  3PFO A;  1TXR A;  1FT7 A;  1CP6 A;  1Y0R A;  1Y7E A;  1F2O A;  1OBR A;  1EE3 P;  5LRK A;  2HC9 A;  5JH9 A;  4X3R A;  2PJB A;  3H8E A;  4EWT A;  3IEH A;  5K8P A;  4P4F A;  4R76 A;  2PJ0 A;  3WC7 A;  3NH5 A;  4OKO A;  1BLL E;  3KZW A;  2WZN A;  3S9N A;  2Q43 A;  2PJ7 A;  4OC0 A;  4KSI A;  1LOK A;  3RAM A;  5LYI A;  1NSA A;  1DE4 C;  2FVG A;  3B3V A;  4O23 A;  4LQG A;  5K8O A;  4MCP A;  2O4H A;  5DS0 A;  1CPX A;  2NYQ A;  4W9Y A;  3D67 A;  4OIW A;  4ZY2 A;  4PXD A;  3IC1 A;  2ZEN A;  4CPA A;  2IMO A;  3NH4 A;  3KAS A;  1KWM A;  3V38 A;  2JBK A;  2PJ5 A;  3PEI A;  3SI2 A;  5K8N A;  2C6P A;  1HDQ A;  2ZEP A;  3VAR A;  2PJ3 A;  1F57 A;  3L2N A;  3KR4 A;  3FJU A;  2AFM A;  3IFE A;  3PB6 X;  1LFW A;  1IY7 A;  4UIA A;  2QVP A;  1QMU A;  4F9U A;  2CTB A;  1YW6 A;  1F2P A;  1HEE A;  4K3N A;  2ZED A;  3KGQ A;  4NGN A;  1XBU A;  3ISX A;  3RZA A;  4NFR A;  3LMS A;  4F9V A;  1BAV A;  3BI1 A;  1LCP A;  3V7Z A;  4IK2 A;  2EK9 A;  2Q4Z A;  3S9M A;  4FAI A;  2F7V A;  2GLJ A;  4P4J A;  4ONW A;  3VAT A;  3IO1 A;  3PB8 X;  4DJL A;  1YME A;  3LWU A;  4YWY A;  3SI1 A;  3IWW A;  5K8M A;  2OR4 A;  4MCQ A;  4X2T A;  4R8F A;  3TX8 A;  1LAM A;  2PE3 A;  4OME A;  4AXV A;  1BPN A;  2AFZ A;  4PPZ A;  1AYE A;  3GUX A;  3FEC A;  3FH4 A;  5CPA A;  4ZY0 A;  2ANP A;  2F8H A;  3IJ3 A;  3N5F A;  3GLJ A;  3PRT A;  3VH9 A;  2AFX A;  2XEI A;  4P6Y A;  4P4B A;  1ZG8 A;  4R7M A;  2PJ6 A;  4MMO A;  3D7G A;  1CX8 A;  3FEE A;  2AFW A;  2PJA A;  2ZOG A;  2O53 A;  2WYR A;  4EME A;  4RUH A;  3KQZ A;  1CBX A;  2AFU A;  3CPX A;  2EWB A;  3BHX A;  4Q7A A;  3RBU A;  4DUK A;  2V8G A;  4EFD A;  4MCR A;  5HVF A;  4P10 A;  3PFE A;  4A94 A;  1Y0Y A;  4Z65 A;  4TWE A;  1YLO A;  1ELL P;  2PJ4 A;  3MRU A;  2V8D A;  2ZEL A;  1Z5R A;  2PJ2 A;  3WAB A;  5F09 A;  3I1U A;  2RB7 A;  3PB7 X;  4UIB A;  1PCA A;  2PJ8 A;  2PIZ A;  5D8N A;  2XEF A;  2POK A;  5THW A;  5LRJ A;  1ZG9 A;  3FMC A;  4MCS A;  1VHE A;  1R3N A;  2G9D A;  5LYD A;  1ZLI A;  1ARL A;  1R43 A;  4OC2 A;  5ELY A;  1YSJ A;  2OOT A;  5D29 A;  1ARM A;  4ZX9 A;  1TKH A;  3FF3 A;  1AMP A;  3K2K A;  8CPA A;  4OC3 A;  3FED A;  4GM5 A;  1CP7 A;  4A37 A;  4B6Z A;  4G1P A;  4NGP A;  3B3T A;  5CBM A;  2NSM A;  4PXE A;  4WJB A;  4UF4 A;  1JQG A;  4MHP A;  2I3C A;  3S9L A;  3TC8 A;  2JBJ A;  2QYV A;  1LAP A;  2ZEO A;  3KHX A;  3SJG A;  1Z2L A;  4ZI6 A;  2ZEF A;  2ABZ A;  2PRQ A;  2V77 A;  3WT4 A;  5JGF A;  4P4E A;  2DEA A;  2BCO A;  4P45 A;  4P4I A;  5LRG A;  3CPA A;  3NA6 A;  3B35 A;  1QQ9 A;  4A39 A;  2C1C A;  1ZG7 A;  2QJ8 A;  3D4U A;  2GLF A;  4ZX8 A;  2ZEE A;  3GB0 A;  3SJE A;  1VGY A;  3KI9 A;  4OC5 A;  4NGR A;  4ZY1 A;  1Q7L A;  3D66 A;  7CPA A;  3DLJ A;  3MN8 A;  3H8G A;  2ZOF A;  4MHN A;  4OC1 A;  4NGQ A;  1HDU A;  3SI0 A;  2GU2 A;  4DYO A;  4X8I A;  1VHO A;  4BD9 A;  4PQA A;  4TNU A;  3SJX A;  3D7F A;  3D7H A;  4NGS A;  1LAN A;  6CPA A;  1IGB A;  3T8W A;  3SJF A;  3D7D A;  3PB9 X;  3PBE A;  1TF9 A;  3HUV A;  4R6T A;  2ZEG A;  2CTC A;  4OID A;  4IAV A;  1PYT B;  4JZ0 A;  2PJC A;  1FNO A;  1BPM A;  4OC4 A; 
#chains in the Genus database with same CATH topology
 1VQM 1;  2J8N A;  2GFQ A;  3HLP A;  5JPH A;  3PBB A;  2Q0Y A;  4NBG A;  5IX3 A;  1VQN Z;  4OP4 A;  3M3Y I;  1YR0 A;  4P4D A;  1M4L A;  3IIB A;  4JD6 A;  2PRB A;  3S15 I;  4H6U A;  4ORF A;  4YU9 A;  3CDX A;  4KSA A;  2JIQ A;  2V8I A;  2QA4 1;  3B2Y A;  1VQO Z;  4CYQ A;  4KZT A;  5FLX b;  2NMT A;  4E33 A;  2YND A;  3GIU A;  2JEW A;  2CY2 A;  4E31 A;  3DR6 A;  2CNS A;  4UEF A;  2F5I A;  1Z8X A;  1AUG A;  4CGL A;  5KTC A;  3CME 1;  1VIX A;  2R6M A;  2PK7 A;  1Z4E A;  3DDD A;  2R93 I;  1S7L A;  2RT9 A;  4B14 A;  3KL9 A;  1CM0 A;  3FXT A;  3JTK A;  2AFO A;  2RFH A;  1YW4 A;  4UEZ A;  2B3V A;  3I56 1;  3CC2 Z;  2C6G A;  2VUM I;  3FIX A;  4Y49 C;  1IIC A;  4RI1 A;  2IJZ A;  2PMZ A;  3BI0 A;  1TF8 A;  3EC4 A;  4H2K A;  2EGT A;  1TKF A;  1YJW Z;  4QC6 A;  4FBE A;  1Q86 2;  3NE7 A;  1I6H I;  3IR7 A;  4KUA A;  4U9Z A;  5HVG A;  5FLM I;  4F8Z A;  1X0T A;  4UEE A;  1K4J A;  4PSW A;  4UCN A;  5IP9 I;  2ATR A;  2QEX Z;  1XMB A;  1QSM A;  4K30 A;  3TO7 A;  1NP6 A;  1GHE A;  5GCN A;  4A2Z A;  4CAX A;  3NDI A;  5C3E I;  4UA3 A;  3CD6 Z;  3CCJ 1;  4X6A I;  1F2O A;  1OBR A;  1EE3 P;  4MFK A;  1NJI 2;  5JH9 A;  4X3R A;  4EWT A;  4KLW A;  2OZG A;  2D4O A;  2PJ0 A;  3GTL I;  3NH5 A;  2WZN A;  3S9N A;  2PJ7 A;  2PM9 A;  2Q7B A;  3OWC A;  3S14 I;  4CYO A;  5LYI A;  3I4M I;  3F0A A;  4H89 A;  3B3V A;  4A33 A;  1FY7 A;  2GTH A;  5C4J I;  4R3L A;  1M1K 2;  2ZEN A;  5I0C A;  1TFI A;  1QF8 A;  1WCM I;  1YGH A;  2ZAE B;  5A27 A;  2FSR A;  5IT9 b;  3JUW A;  3T9Y A;  3QB8 A;  1ZO0 A;  3SI2 A;  2PQ8 A;  1N8R 2;  1HDQ A;  3W6X A;  5IP7 I;  1F57 A;  2W04 A;  3KR4 A;  2ZPA A;  4HNY B;  3T90 A;  1S72 1;  4KS9 A;  3VMG A;  3PB6 X;  2DE7 A;  1RO0 A;  1IY7 A;  1LFW A;  1Q7Y 2;  4DK1 A;  4CRY B;  4KOS A;  3S16 I;  1F2P A;  3CC4 Z;  4LQ6 A;  4C2X A;  1VQ7 1;  3FNC A;  3LMS A;  4F6A A;  1U6M A;  1WJ2 A;  5H86 A;  4NBB A;  2EK9 A;  5AN9 F;  4MFP A;  4MFL A;  3F3F C;  3D3S A;  1Q86 1;  2JA6 I;  1NE9 A;  1IOI A;  4LUA A;  1VQM Z;  3LWU A;  3QAY A;  1I50 I;  3IWW A;  4MCQ A;  2JUB A;  5G22 A;  3TX8 A;  1LAM A;  3R9E A;  3CXC Y;  4CAW A;  4MJ8 A;  1FDI A;  3F3P C;  2AFZ A;  3TE5 B;  3DR8 A;  3PRT A;  3MZL B;  3VH9 A;  4P4B A;  2QA4 Z;  2W03 A;  5LL6 f;  4KOV A;  4IF5 A;  4R7M A;  4A3M I;  3FEE A;  1NJI 1;  2WYR A;  1Z9U A;  4RVH A;  4RUH A;  5FLX f;  2J8R A;  4B12 A;  3R9G A;  4MH4 A;  1XE4 A;  3VWE A;  4Y49 B;  3G6E 1;  3CME Z;  2V8G A;  2P3Y A;  1VQ6 1;  3H5Z A;  4P10 A;  4RS2 A;  2OB0 A;  1Y0Y A;  4E2A A;  3PGP A;  4NBC A;  1ELL P;  5F48 A;  5F09 A;  2VXK A;  1YIT 1;  1TWH I;  2PDO A;  3I56 Z;  2FS5 A;  4KOR A;  1M1K 1;  1YI2 1;  3CCS Z;  3CZX A;  2PJ8 A;  4RN7 A;  2XEF A;  1Y1W I;  3G3S A;  4MCS A;  4R3K A;  1VHE A;  2G9D A;  1ZLI A;  1ARL A;  3FBU A;  3J80 b;  4KOW A;  5ELY A;  1YSJ A;  2V8K A;  1ARM A;  3K2K A;  1AMP A;  1MJA A;  4OC3 A;  4KLV A;  2Y0M A;  1YVK A;  4A37 A;  1VQL 1;  3FRM A;  1I21 A;  1Q7Y 1;  4X5K A;  4MHP A;  1QSN A;  3S2H I;  1YJN 1;  4S1T A;  4M6G A;  2ZEO A;  3IFU A;  3SJG A;  1Z2L A;  1MK4 A;  2V77 A;  3I55 Z;  3CCJ Z;  2GTI A;  4P45 A;  3CPA A;  3NA6 A;  1A2Z A;  2VZY A;  2C1C A;  1K83 I;  3D4U A;  3BG1 B;  3SJE A;  2OTJ Z;  1M1D A;  4HKF A;  2B63 I;  2B5G B;  4HNW B;  4ZY1 A;  3D66 A;  1JWQ A;  3DLJ A;  2CNM A;  1VLA A;  3H8G A;  3RYO A;  2ZOF A;  4BY7 I;  2V3V A;  4NGQ A;  3GTQ I;  4NF1 A;  2E2I I;  4A3F I;  4QTT A;  4DYO A;  1YUK A;  1M4G A;  3CPW Z;  5E96 A;  2OZK A;  4Y52 I;  5A28 A;  2VPW A;  5IT9 f;  4NEX A;  1TF9 A;  4R6T A;  4RVG A;  1S72 Z;  5G20 A;  3SXO A;  1FNO A;  2M6N A;  1I3Q I;  4OC4 A;  4NBF A;  3HOW I;  4PXC A;  2Q51 A;  4A3K I;  3FQM A;  2ZW7 A;  2J6A A;  4A32 A;  1KUX A;  1NMT A;  3VMI A;  1VQ7 Z;  2RPR A;  1YQE A;  1PUA A;  2V8V A;  2JNY A;  2QRD B;  1XEB A;  1Z02 A;  1ML8 A;  3TO6 A;  2KPI A;  3SHP A;  1B87 A;  3D2P A;  2VEZ A;  4UBR A;  1N2F A;  2VL1 A;  5C4X I;  4B10 A;  1USP B;  2OU2 A;  1TKJ A;  3JVN A;  4MHY A;  2JIR A;  4P44 A;  1BOB A;  1N71 A;  4UCP A;  3B3C A;  3WC6 A;  4NJR A;  1GYT A;  3KR5 A;  5I4M A;  1WWZ A;  2CIJ A;  2PVW A;  3D68 A;  3BXM A;  5T6B A;  2ARH A;  5HVH A;  4IHM A;  4PV6 A;  4II9 A;  2YAD A;  1JJ2 Y;  2ZXV A;  2GAN A;  2WUU A;  3G6E Z;  2AFS A;  1Q16 A;  4CGN A;  3CPW Y;  1NUI A;  3KHZ A;  2Z10 A;  3B3S A;  2VUG A;  2IZ3 A;  2G3T A;  2PVV A;  4MXU A;  4CRZ B;  2E2H I;  3TDH B;  1YIT Z;  2GIV A;  3KIF A;  1YI2 Z;  4LX9 A;  2J9A A;  4NGT A;  2J8M A;  4A3B I;  1Z8T A;  1PFT A;  3RZD I;  3DGV A;  4PXB A;  3NFZ A;  5T64 A;  2Z3O A;  2JA8 I;  1TXR A;  2FCK A;  3J80 f;  1Y7E A;  3RZO I;  2OOX B;  4BXX I;  4AVC A;  3D2L A;  5H84 A;  5LRK A;  2HC9 A;  2PJB A;  3H8E A;  3A9L A;  3IEH A;  1K9M 2;  4R76 A;  1YJN Z;  4OKO A;  1BLL E;  2Q43 A;  3LOD A;  2Q4Y A;  4OC0 A;  4KSI A;  4B11 A;  4CYP A;  1LOK A;  1Y1V S;  4A3J I;  2FVG A;  2FXF A;  5K8O A;  2B5G A;  1Y1V I;  3R1K A;  5DS0 A;  1V0C A;  4DQY B;  4BMH A;  2WAQ A;  1YLE A;  4CPA A;  2Z3M A;  1KWM A;  3GKQ A;  4E2X A;  5F47 A;  4GXH A;  2D4P A;  2FE7 A;  5K8N A;  2C6P A;  3IWG A;  3CCL 1;  2ZEP A;  1QYP A;  2M48 A;  1Y7R A;  3PO2 I;  3CCE 1;  4A93 I;  4KOT A;  1WZN A;  2WPX A;  2IL4 A;  1TWF I;  4UIA A;  2QVP A;  4A3I I;  2EO8 A;  2HQY A;  4K3N A;  1X12 A;  2ZED A;  4NGN A;  5AG4 A;  1XBU A;  4XPL A;  2HV2 A;  3CCS 1;  4F9V A;  4JXR A;  1BAV A;  3BI1 A;  1L0C A;  3I9S A;  4M6I A;  2Q4Z A;  4AG9 A;  4A3L I;  2F7V A;  4BBH A;  3LUS A;  1Q81 1;  2NVQ I;  2GLJ A;  4P4J A;  1KD1 2;  3VAT A;  2Y0S A;  1S7N A;  2H85 A;  2ZW5 A;  1YME A;  3SI1 A;  4CAV A;  2AE6 A;  5K8M A;  4MD7 A;  2KCW A;  1USP A;  1IOF A;  2CNT A;  4PPZ A;  4A3D I;  1AYE A;  2DF5 A;  3FH4 A;  3R9F A;  3GLJ A;  4MY0 A;  2EUI A;  4E0A A;  1YRE A;  2AFX A;  2JIP A;  4KVO E;  3I55 1;  2FIA A;  3VB9 A;  1TWC I;  2AFW A;  2YNE A;  2ZOG A;  5F46 A;  4E2Y A;  3GTO I;  1K9M 1;  1R57 A;  2VPZ A;  3IU1 A;  3J7A 4;  4MD8 A;  1YK3 A;  2K5T A;  2JIM A;  4R9M A;  4MCR A;  4HPS A;  2R98 A;  2OTJ 1;  2AJ6 A;  1I12 A;  3D8P A;  3CCU Z;  3MGD A;  2VPY A;  1YLO A;  3CXQ A;  2PJ4 A;  3MRU A;  4MI4 A;  2V8D A;  1RNI A;  2ZEL A;  5CNP A;  2PJ2 A;  3I1U A;  2Z3N A;  3ESW A;  3PB7 X;  4UIB A;  2PIZ A;  3B8G A;  2NVT I;  5D8N A;  2YU9 I;  3I3G A;  3FMC A;  3S6H A;  3UY5 A;  4E32 A;  4OC2 A;  2OOT A;  1VQK 1;  5D29 A;  3U50 C;  2O28 A;  5J8F A;  3GTM S;  3FED A;  2LIY A;  4BIN A;  4MBU A;  1TIQ A;  2NSM A;  4PXE A;  4ZBG A;  3GTM I;  3KKW A;  2R7H A;  3CCQ Z;  2I3C A;  1XMT A;  1M44 A;  2BEI A;  2QYV A;  2B58 A;  2E7Z A;  2G2K A;  2QRE B;  4ZI6 A;  2ZEF A;  2NVX I;  2ABZ A;  3WT4 A;  2ZW4 A;  5JGF A;  4R87 A;  4P4I A;  4QUS A;  2Z3P A;  1KD1 1;  3B35 A;  1ZG7 A;  2K3R A;  1RO5 A;  2QJ8 A;  4NBA A;  5G1Z A;  3G71 1;  2GLF A;  2R92 I;  2ZEE A;  4JLY A;  3KI9 A;  4CYN A;  2RBL A;  1Q7L A;  3CMA 1;  7CPA A;  4NH1 C;  2V45 A;  3QAH A;  2HF1 A;  3M4O I;  3HOX I;  3ZJ0 A;  1Y9K A;  2JR6 A;  1Z4R A;  3D6W A;  4CAE A;  4PQA A;  3PO3 S;  3P2F A;  3D7H A;  4U9Y A;  5D1O B;  3CCL Z;  1LAN A;  2VF1 A;  4XPD C;  3SJF A;  4CGO A;  5T67 A;  3PO3 I;  2OZH A;  3CCE Z;  2ZEG A;  4IAV A;  1PYT B;  4JZ0 A;  1ZB8 A;  1Z03 A;  1RQF A;  1BPM A;  2WSA A;  2JMO A;  3IWE A;  1Q82 2;  3S6G A;  5KTA A;  3K9T A;  3FX6 A;  4MFZ A;  4CS0 B;  3B7I A;  2DPS A;  4MON A;  4ZYQ A;  5AG5 A;  4HGZ A;  1LRZ A;  2NVY I;  4R57 A;  4AG7 A;  2K5R A;  1N8R 1;  4C2Z A;  3TT2 A;  3QNV A;  1RTQ A;  4QB9 A;  3K9U A;  3PP9 A;  4M85 A;  2BOA A;  5D1P A;  3S2D I;  2G3A A;  1Q2Y A;  2PIY A;  3GY9 A;  2VI7 A;  4NCZ A;  1JWH C;  3G8W A;  2PJ1 A;  1DTD A;  2JDC A;  4FWU A;  1ZH1 A;  1X10 A;  4NBE A;  1Z8L A;  2PJ9 A;  4KVM E;  2PCU A;  2F4M A;  1H8L A;  2B4B A;  2G0B A;  3DSB A;  3LAC A;  4RVF A;  4FUU A;  5HH1 A;  3WC5 A;  5ISV A;  3CXP A;  4DGL A;  3HKZ A;  2PR8 A;  1UWY A;  1KUY A;  2ZEH A;  3S6F A;  1R9T I;  1X3Z A;  2IQ6 A;  3CT9 A;  4AYB A;  2CXA A;  3GYA A;  3TFY A;  4NJQ A;  4AVB A;  2JDD A;  3EY5 A;  4MHZ A;  2CF4 A;  5J1Q A;  1P4N A;  4MRI A;  2P28 A;  2V8H A;  1YVO A;  2DXQ A;  2BO9 A;  3B3W A;  3H8F A;  5KTD A;  5AG6 A;  1W2B Z;  3FVL A;  3KQX A;  4AB7 A;  4FD5 A;  3PFO A;  4KOU A;  3CCR 1;  1VQK Z;  1K73 2;  3IU2 A;  2FL4 A;  4E8O A;  2DE5 A;  2BSW A;  4EVY A;  1Q82 1;  1PU9 A;  4OLL A;  5K8P A;  1RO4 A;  1RXT A;  2HUZ A;  3RAM A;  4Q36 A;  3BJ7 A;  2WB1 A;  2LEX A;  4LQG A;  5EBV A;  2O4H A;  1CPX A;  3D67 A;  1VQ8 1;  3FB3 A;  3NE8 A;  1WII A;  3G71 Z;  2JEV A;  4FD4 A;  2E9H A;  5CM2 M;  3GTG I;  2JBK A;  3FYN A;  1TWA I;  4XPD B;  2OH1 A;  3CMA Z;  2QEC A;  3JAM b;  3GTJ I;  5D1O A;  1KRL A;  4BY1 I;  4NBD A;  2Q04 A;  3CCU 1;  2VBQ A;  1QMU A;  2CTB A;  2I79 A;  3BLN A;  1X3W A;  3ISX A;  3RO0 A;  3RZA A;  5IB0 A;  2HU9 A;  1IYL A;  4DNC A;  2REE A;  4NXY A;  1SFO I;  3RNZ A;  3V7Z A;  3TCV A;  3S9M A;  3OW2 Z;  1W2B Y;  4ONW A;  3IO1 A;  3PB8 X;  4L89 A;  4YWY A;  4CL1 A;  3G4S 1;  1S7F A;  4KOY A;  2OR4 A;  4FD6 A;  1ON0 A;  4OAD A;  4AVA A;  4GS4 A;  3S1N I;  1P0H A;  1IU8 A;  2EVN A;  4AXV A;  1BPN A;  3GUX A;  3FEC A;  5CPA A;  4ZY0 A;  3CCQ 1;  2ANP A;  2F8H A;  3N5F A;  1KQS Z;  1TWG I;  4FD7 A;  2FIW A;  3TO9 A;  2XEI A;  1ZG8 A;  4JJX A;  4MMO A;  3D7G A;  1CX8 A;  4B13 A;  4EME A;  2PC1 A;  1CBX A;  1Y8C A;  2EWB A;  3RBU A;  4HNX B;  3CCV Z;  4UWI A;  4E2W A;  3GTP I;  3PZJ A;  4EFD A;  2BUE A;  3S17 I;  3GTK I;  1VKC A;  4TWE A;  3IF8 A;  1RO2 A;  2H5M A;  1Z01 A;  4HGY A;  4A30 A;  1Z5R A;  1IB1 E;  2RB7 A;  4MHD A;  1PCA A;  4I49 A;  2POK A;  5LRJ A;  1ZG9 A;  1R3N A;  1VQP 1;  5LYD A;  1R43 A;  5A2Q b;  4ZX9 A;  3FF3 A;  1S5K A;  8CPA A;  4CAF A;  3V8I A;  4B6Z A;  4G1P A;  3OW2 Y;  3D2M A;  3B3T A;  1VHS A;  5CBM A;  1S60 A;  4C2Y A;  1JQG A;  2YNC C;  3S9L A;  3TC8 A;  4KVX A;  3BJ8 A;  1RLY A;  2JBJ A;  3CCR Z;  1LAP A;  2AYD A;  3KHX A;  3J81 f;  2ODF A;  1ZB9 A;  2BCO A;  5LRG A;  1QQ9 A;  3HOY I;  3CXS A;  2B3U A;  4CGP A;  1KQS Y;  3VWD A;  5AGE A;  3GCF A;  5J8C A;  2IZ4 A;  2OOY B;  3W6S A;  2KI7 B;  4NBH A;  3GB0 A;  4OC5 A;  1VQ5 1;  4NGR A;  2GE3 A;  2Q44 A;  3TOA A;  4Y7N I;  2Z3K A;  3T4N B;  1VQ9 1;  1VQ8 Z;  2GU2 A;  3WR7 A;  4X8I A;  1QSR A;  3DNS A;  4XNH C;  2OTL 1;  4TNU A;  3C26 A;  2Z11 A;  3F5B A;  4PK3 A;  2DE6 A;  1QVG Z;  3IX0 A;  3GKR A;  3D9X A;  3D7D A;  3CCM 1;  3JAM f;  3PB9 X;  3P5J B;  3HUV A;  4A3E I;  4OID A;  1FDO A;  3CXC Z;  1YIJ Z;  3HOU I;  2VPX A;  1YJ9 Z;  1LQL A;  2XEG A;  3Q87 A;  3H0G I;  1Q2C A;  4NGM A;  2GRE A;  5C44 I;  1ZLH A;  3IGR A;  5HXD A;  3MON A;  2ZW6 A;  1K8A 2;  5LYL A;  3ISZ A;  2JLM A;  3G4S Z;  2FT0 A;  3CC7 1;  3CQZ I;  1YX0 A;  4MY3 A;  4WWV A;  3EXN A;  3HOZ I;  5G21 A;  1XFO A;  1P9N A;  5EC4 A;  2ZEM A;  4JXQ A;  4C7H A;  5IB9 A;  4L8A A;  2C6C A;  1CPS A;  4B5O A;  4BBS I;  1XRY A;  2HB6 A;  3P2H A;  2A4N A;  5AG7 A;  2EK8 A;  1UFH A;  3K7A I;  4RV9 A;  5LYF A;  2QML A;  2IV2 X;  1KUV A;  1CG2 A;  1XJO A;  1QSO A;  4NSQ A;  4NB8 A;  1ELM P;  4A38 A;  4JYW A;  5JM6 A;  1QVG Y;  2OZU A;  3H4Q A;  1MJ9 A;  3NH8 A;  3PB4 X;  4UFV A;  2F4O A;  2XEJ A;  2R8V A;  3N7Z A;  3JRU A;  4KUB A;  4YRH A;  1AA6 A;  1VQP Z;  1S7M A;  4KSF A;  1FT7 A;  4Q38 A;  1CP6 A;  1Y0R A;  5A2Q f;  1YHQ 1;  3NDJ A;  1DL6 A;  3EED A;  1QVF Z;  2BJO A;  1WK4 A;  3BG0 B;  1Y9W A;  4E2Z A;  3TTH A;  2R1I A;  3R95 A;  4P4F A;  2PR1 A;  3WC7 A;  3H3V J;  3KZW A;  2E2J I;  1WW9 A;  4QVT A;  2P6F A;  1IYK A;  1VQ4 1;  3LD2 A;  1NSA A;  1DE4 C;  4PSX A;  4O23 A;  4MCP A;  1K8A 1;  2I00 A;  4JWP A;  2DPT A;  2NYQ A;  4W9Y A;  2BL1 A;  3I07 A;  2JIO A;  4OIW A;  4ZY2 A;  3S1Q I;  4KOX A;  2WPW A;  4PXD A;  3IC1 A;  4ONU A;  2AKL A;  2IMO A;  3NH4 A;  4XNH B;  3EO4 A;  3KAS A;  5DWN A;  3R96 A;  4UFW A;  3V38 A;  1VQ5 Z;  2RC4 A;  2PJ5 A;  1QST A;  3KIH A;  3PEI A;  1Q2D A;  1CJW A;  2B4D B;  1L1O C;  4ZGY B;  1VQ9 Z;  3VMH A;  3VAR A;  2PJ3 A;  3TOB A;  3L2N A;  3CCV 1;  3QWU A;  3FJU A;  2AFM A;  2JA7 I;  5C82 A;  2JS4 A;  1OZP A;  3IFE A;  4A31 A;  2V8J A;  1S7K A;  2OTL Z;  4F9U A;  1YW6 A;  4F0X A;  1HEE A;  3KGQ A;  2C27 A;  4PK2 A;  2QKD A;  1IID A;  4NFR A;  1XF8 A;  3CCM Z;  1YUA A;  1VQN 1;  4YGO A;  1KZF A;  1LCP A;  2PSW A;  4IK2 A;  4B5P B;  4FAI A;  3E0K A;  2Z3L A;  4DJL A;  3MZK B;  4M3S A;  3VTN A;  4EWC A;  1VQO 1;  4X2T A;  4M6H A;  4E30 A;  4H6Z A;  1QVF Y;  4R8F A;  2PE3 A;  4OME A;  2RIQ A;  3IJ3 A;  2VZZ A;  1JJ2 Z;  3J81 b;  1M4I A;  3S1R I;  3CC7 Z;  4P6Y A;  2P0W A;  2Q7S A;  2PJ6 A;  2X7B A;  2PJA A;  2O53 A;  2LFU A;  3KQZ A;  4RS4 A;  2Z0Z A;  1BO4 A;  2AFU A;  4A95 A;  4NB9 A;  3CPX A;  3W91 A;  4U5Y A;  3CC2 1;  3BHX A;  4J3G A;  4Q7A A;  4UWJ A;  4DUK A;  1M90 2;  4F0Y A;  5HVF A;  3PFE A;  4A94 A;  1XOV A;  4Z65 A;  1KC8 2;  2REF A;  5BWA B;  1YJW 1;  3F8K A;  3WAB A;  4MFJ A;  4XX2 A;  2RHB A;  2QR1 B;  5THW A;  5DWM A;  5JQ4 A;  4YFJ A;  2QEX 1;  2YGW A;  4C68 A;  2YNC A;  2JA5 I;  1TKH A;  3FQQ A;  5C88 A;  3S6K A;  5F49 A;  3CD6 1;  4GM5 A;  1CP7 A;  4UFX A;  4MFQ A;  2Q4V A;  4NGP A;  4C7I A;  4XPK A;  1YIJ 1;  4WJB A;  3EER A;  1YJ9 1;  4UF4 A;  2QRC B;  1MJB A;  1QXF A;  1I1D A;  1B6B A;  4HH4 A;  1M4D A;  1YHQ Z;  2PRQ A;  4P4E A;  2DEA A;  2EBJ A;  2NAP A;  1SQH A;  4RVD A;  4A3C I;  5IV0 A;  4UCM A;  4A39 A;  4MD9 A;  3I4N I;  1NSL A;  2QLV B;  1Z8W A;  4QBJ A;  3TE4 A;  4BBR I;  4ZX8 A;  2QIR A;  1VQ6 Z;  4A3G I;  1VGY A;  1VQ4 Z;  4QTU A;  4OAE A;  1Q81 2;  2VQY A;  3EFA A;  4NOZ A;  3MN8 A;  3SXN A;  3FKI I;  4MHN A;  4OC1 A;  5EMI A;  2B4D A;  1HDU A;  3SI0 A;  1K73 1;  3ZZI A;  2P6E A;  5FVJ A;  2R7Z I;  5HMN A;  1S3Z A;  1VHO A;  3S1M I;  4IUS A;  3HOV I;  1XIX A;  4BD9 A;  1SIW A;  3SJX A;  3D7F A;  3CC4 1;  4NGS A;  2P6G A;  6CPA A;  1IGB A;  3T8W A;  4CGM A;  1J4J A;  1M90 1;  3PBE A;  2CTC A;  1KC8 1;  1VQL Z;  2PJC A;  4B5P A; 
#chains in the Genus database with same CATH homology
 1VQM 1;  1YJ9 Z;  1LQL A;  2XEG A;  4PXC A;  3K9T A;  3FX6 A;  2Q51 A;  3Q87 A;  3HLP A;  4A3K I;  3H0G I;  3FQM A;  3B7I A;  4MON A;  3PBB A;  4NGM A;  4NBG A;  4ZYQ A;  2J6A A;  1VQN Z;  3VMI A;  4OP4 A;  3M3Y I;  1VQ7 Z;  2RPR A;  4HGZ A;  2GRE A;  4P4D A;  1M4L A;  5C44 I;  1ZLH A;  2V8V A;  2NVY I;  3IIB A;  2JNY A;  2QRD B;  2K5R A;  5HXD A;  1Z02 A;  1ML8 A;  3S15 I;  1N8R 1;  3MON A;  2KPI A;  1K8A 2;  5LYL A;  3ISZ A;  3QNV A;  4YU9 A;  1RTQ A;  3CDX A;  2BOA A;  3G4S Z;  5D1P A;  1N2F A;  2VL1 A;  2V8I A;  5C4X I;  3CC7 1;  2QA4 1;  3CQZ I;  1USP B;  3B2Y A;  1VQO Z;  3S2D I;  1TKJ A;  2PIY A;  4WWV A;  5FLX b;  4E33 A;  4MHY A;  3HOZ I;  2JEW A;  1XFO A;  1JWH C;  4E31 A;  2PJ1 A;  1DTD A;  4P44 A;  1P9N A;  4FWU A;  3B3C A;  3WC6 A;  4UEF A;  1ZH1 A;  4NJR A;  2ZEM A;  4NBE A;  5IB9 A;  1GYT A;  1Z8L A;  3KR5 A;  5I4M A;  3CME 1;  2CIJ A;  2C6C A;  2PVW A;  1CPS A;  3D68 A;  4BBS I;  1XRY A;  1VIX A;  2R6M A;  2HB6 A;  3BXM A;  5T6B A;  2PJ9 A;  2PK7 A;  2PCU A;  2F4M A;  2R93 I;  1H8L A;  2RT9 A;  5HVH A;  3KL9 A;  2EK8 A;  4IHM A;  3K7A I;  4RVF A;  4RV9 A;  2AFO A;  4FUU A;  2YAD A;  3WC5 A;  5LYF A;  2RFH A;  4DGL A;  1YW4 A;  4UEZ A;  1JJ2 Y;  3HKZ A;  3I56 1;  3CC2 Z;  1UWY A;  2C6G A;  2VUM I;  2ZEH A;  1CG2 A;  3G6E Z;  1XJO A;  2AFS A;  1R9T I;  3CPW Y;  1X3Z A;  2IJZ A;  2IQ6 A;  3CT9 A;  4AYB A;  1NUI A;  4NB8 A;  1ELM P;  3KHZ A;  2PMZ A;  3B3S A;  1TF8 A;  2VUG A;  3BI0 A;  2IZ3 A;  4NJQ A;  4H2K A;  2EGT A;  4MHZ A;  4A38 A;  2CF4 A;  1TKF A;  1YJW Z;  2PVV A;  4FBE A;  1Q86 2;  4MXU A;  4JYW A;  1I6H I;  5J1Q A;  5JM6 A;  4MRI A;  1QVG Y;  2E2H I;  2P28 A;  2V8H A;  3TDH B;  3NH8 A;  1YIT Z;  5HVG A;  3PB4 X;  3KIF A;  5FLM I;  1YI2 Z;  4F8Z A;  1X0T A;  2BO9 A;  2F4O A;  3B3W A;  3H8F A;  2XEJ A;  4UEE A;  2J9A A;  4NGT A;  3JRU A;  4A3B I;  3DGV A;  1PFT A;  3RZD I;  5IP9 I;  1W2B Z;  2QEX Z;  1VQP Z;  3FVL A;  1XMB A;  3KQX A;  4PXB A;  3NFZ A;  5T64 A;  1S7M A;  3PFO A;  2JA8 I;  1NP6 A;  1TXR A;  3CCR 1;  1FT7 A;  1VQK Z;  1CP6 A;  1Y0R A;  5A2Q f;  3J80 f;  1Y7E A;  1K73 2;  3NDI A;  3RZO I;  1YHQ 1;  2OOX B;  5C3E I;  4BXX I;  3NDJ A;  1DL6 A;  2DE5 A;  3CD6 Z;  3CCJ 1;  4X6A I;  1F2O A;  1OBR A;  1EE3 P;  3EED A;  1QVF Z;  5LRK A;  2BJO A;  1NJI 2;  2HC9 A;  5JH9 A;  4X3R A;  1Q82 1;  3BG0 B;  2PJB A;  3H8E A;  4EWT A;  4E2Z A;  3IEH A;  5K8P A;  1K9M 2;  4P4F A;  4R76 A;  2PJ0 A;  1RO4 A;  1YJN Z;  3WC7 A;  3GTL I;  3NH5 A;  3H3V J;  1BLL E;  3KZW A;  2WZN A;  4OKO A;  2Q43 A;  3S9N A;  2PJ7 A;  2E2J I;  1WW9 A;  2PM9 A;  4OC0 A;  4KSI A;  3S14 I;  1LOK A;  1VQ4 1;  1Y1V S;  3RAM A;  5LYI A;  1NSA A;  3I4M I;  4A3J I;  1DE4 C;  2FVG A;  2WB1 A;  3B3V A;  4O23 A;  4LQG A;  5K8O A;  4MCP A;  2O4H A;  1K8A 1;  1Y1V I;  5DS0 A;  1CPX A;  2NYQ A;  4W9Y A;  3D67 A;  3I07 A;  1VQ8 1;  4OIW A;  4ZY2 A;  3S1Q I;  2GTH A;  5C4J I;  1M1K 2;  4DQY B;  4PXD A;  1WII A;  3IC1 A;  2WAQ A;  3G71 Z;  2ZEN A;  4CPA A;  2AKL A;  2IMO A;  1TFI A;  2E9H A;  3NH4 A;  1QF8 A;  3KAS A;  5CM2 M;  1KWM A;  1WCM I;  3GKQ A;  3V38 A;  3GTG I;  2JBK A;  2ZAE B;  4E2X A;  1VQ5 Z;  5IT9 b;  2PJ5 A;  1TWA I;  3KIH A;  3PEI A;  3SI2 A;  3CMA Z;  5K8N A;  1N8R 2;  2C6P A;  1HDQ A;  1L1O C;  3CCL 1;  3JAM b;  1VQ9 Z;  5IP7 I;  2ZEP A;  1QYP A;  3VMH A;  3GTJ I;  5D1O A;  3VAR A;  2PJ3 A;  2M48 A;  1F57 A;  3L2N A;  2W04 A;  3CCV 1;  3KR4 A;  3QWU A;  3PO2 I;  3FJU A;  2AFM A;  2JA7 I;  2JS4 A;  1KRL A;  3CCE 1;  1S72 1;  4A93 I;  3IFE A;  3VMG A;  4BY1 I;  4NBD A;  3CCU 1;  3PB6 X;  2DE7 A;  2V8J A;  1TWF I;  1RO0 A;  1IY7 A;  1LFW A;  2QVP A;  4UIA A;  2OTL Z;  1QMU A;  4A3I I;  4DK1 A;  1Q7Y 2;  4F9U A;  2CTB A;  3S16 I;  1YW6 A;  1F2P A;  1HEE A;  4K3N A;  3CC4 Z;  2ZED A;  3KGQ A;  4NGN A;  1XBU A;  1X3W A;  2QKD A;  3ISX A;  3RZA A;  4NFR A;  2HU9 A;  3CCM Z;  1YUA A;  3CCS 1;  1VQN 1;  1VQ7 1;  3LMS A;  4F9V A;  1SFO I;  1BAV A;  3BI1 A;  1LCP A;  3V7Z A;  4IK2 A;  4NBB A;  2EK9 A;  5AN9 F;  2Q4Z A;  3S9M A;  4FAI A;  4A3L I;  3OW2 Z;  2F7V A;  3LUS A;  1Q81 1;  1W2B Y;  3F3F C;  2NVQ I;  2GLJ A;  4P4J A;  1Q86 1;  2JA6 I;  4ONW A;  1KD1 2;  1VQM Z;  2Y0S A;  3VAT A;  3IO1 A;  3PB8 X;  4DJL A;  2H85 A;  1YME A;  3LWU A;  4YWY A;  4CL1 A;  3G4S 1;  3MZK B;  3SI1 A;  3VTN A;  4EWC A;  1I50 I;  3IWW A;  5K8M A;  4MD7 A;  1VQO 1;  2OR4 A;  4MCQ A;  4X2T A;  2JUB A;  4E30 A;  1USP A;  3S1N I;  4R8F A;  1QVF Y;  1LAM A;  3TX8 A;  3CXC Y;  2PE3 A;  4OME A;  4AXV A;  1BPN A;  3F3P C;  2AFZ A;  4PPZ A;  4A3D I;  1AYE A;  3GUX A;  3FEC A;  3TE5 B;  3FH4 A;  2RIQ A;  5CPA A;  3CCQ 1;  4ZY0 A;  2ANP A;  2F8H A;  3IJ3 A;  3N5F A;  3GLJ A;  1KQS Z;  1TWG I;  1JJ2 Z;  3PRT A;  3J81 b;  3MZL B;  3VH9 A;  2AFX A;  2XEI A;  3S1R I;  3CC7 Z;  4P6Y A;  4P4B A;  2QA4 Z;  1ZG8 A;  2W03 A;  5LL6 f;  4R7M A;  4A3M I;  2PJ6 A;  4MMO A;  3I55 1;  3D7G A;  1CX8 A;  3VB9 A;  1TWC I;  3FEE A;  2AFW A;  2PJA A;  2ZOG A;  1NJI 1;  2O53 A;  2WYR A;  4EME A;  2LFU A;  4RVH A;  4RUH A;  3KQZ A;  4RS4 A;  5FLX f;  4E2Y A;  3GTO I;  1CBX A;  1K9M 1;  2AFU A;  4NB9 A;  3CPX A;  4MH4 A;  2EWB A;  3J7A 4;  3CC2 1;  3BHX A;  4MD8 A;  4Q7A A;  3RBU A;  3CCV Z;  4E2W A;  3G6E 1;  4DUK A;  3CME Z;  2V8G A;  3GTP I;  1M90 2;  4EFD A;  2P3Y A;  4MCR A;  1VQ6 1;  2OTJ 1;  5HVF A;  4P10 A;  3PFE A;  4A94 A;  3S17 I;  1Y0Y A;  4Z65 A;  3GTK I;  3CCU Z;  1KC8 2;  4TWE A;  3IF8 A;  1RO2 A;  1YLO A;  1YJW 1;  4NBC A;  1Z01 A;  1ELL P;  2PJ4 A;  3MRU A;  4HGY A;  2V8D A;  1RNI A;  2ZEL A;  1Z5R A;  2PJ2 A;  3WAB A;  4XX2 A;  5F09 A;  3I1U A;  2RHB A;  1TWH I;  3ESW A;  1YIT 1;  2RB7 A;  3I56 Z;  3PB7 X;  1M1K 1;  1YI2 1;  4UIB A;  1PCA A;  3CCS Z;  2PJ8 A;  2PIZ A;  2NVT I;  5D8N A;  2XEF A;  2QR1 B;  2YU9 I;  2POK A;  1Y1W I;  5LRJ A;  5THW A;  1ZG9 A;  3FMC A;  4MCS A;  1VHE A;  1R3N A;  2G9D A;  2QEX 1;  1VQP 1;  5LYD A;  1ZLI A;  1ARL A;  1R43 A;  4E32 A;  4OC2 A;  5A2Q b;  3J80 b;  5ELY A;  1YSJ A;  1VQK 1;  2OOT A;  5D29 A;  3U50 C;  2V8K A;  1ARM A;  2JA5 I;  4ZX9 A;  1TKH A;  3FF3 A;  1AMP A;  3K2K A;  8CPA A;  4OC3 A;  3FQQ A;  3GTM S;  3FED A;  2LIY A;  3CD6 1;  4GM5 A;  1CP7 A;  4A37 A;  4B6Z A;  1VQL 1;  4G1P A;  3OW2 Y;  4NGP A;  3B3T A;  5CBM A;  1Q7Y 1;  1YIJ 1;  2NSM A;  4PXE A;  3GTM I;  4WJB A;  3EER A;  1YJ9 1;  4UF4 A;  1JQG A;  4MHP A;  3S2H I;  3CCQ Z;  2QRC B;  2I3C A;  3S9L A;  1YJN 1;  3TC8 A;  1RLY A;  4S1T A;  3CCR Z;  2JBJ A;  2QYV A;  1LAP A;  2ZEO A;  4HH4 A;  3IFU A;  2G2K A;  2QRE B;  1YHQ Z;  1Z2L A;  3J81 f;  3KHX A;  2ZEF A;  3SJG A;  4ZI6 A;  2NVX I;  2ABZ A;  2PRQ A;  2V77 A;  3WT4 A;  3I55 Z;  3CCJ Z;  5JGF A;  4P4E A;  2DEA A;  1ZB9 A;  2GTI A;  2BCO A;  4P45 A;  4P4I A;  5LRG A;  4RVD A;  3CPA A;  3NA6 A;  4A3C I;  1KD1 1;  3B35 A;  1QQ9 A;  3HOY I;  4A39 A;  2C1C A;  4MD9 A;  1KQS Y;  3I4N I;  2K3R A;  1K83 I;  1ZG7 A;  2QLV B;  2QJ8 A;  4NBA A;  3GCF A;  3D4U A;  2IZ4 A;  2OOY B;  4BBR I;  2KI7 B;  3G71 1;  2GLF A;  4ZX8 A;  3BG1 B;  2R92 I;  4NBH A;  2ZEE A;  3GB0 A;  3SJE A;  1VQ6 Z;  2OTJ Z;  4A3G I;  1VGY A;  1VQ4 Z;  3KI9 A;  2B63 I;  4QTU A;  4OC5 A;  1VQ5 1;  4NGR A;  2RBL A;  4Y7N I;  4ZY1 A;  1Q81 2;  1Q7L A;  3CMA 1;  3D66 A;  7CPA A;  3DLJ A;  4NOZ A;  1VLA A;  3T4N B;  3H8G A;  3MN8 A;  4NH1 C;  2ZOF A;  3FKI I;  1VQ9 1;  4MHN A;  4OC1 A;  4BY7 I;  2HF1 A;  3M4O I;  3HOX I;  4NGQ A;  3GTQ I;  1HDU A;  3SI0 A;  1VQ8 Z;  2GU2 A;  2E2I I;  4A3F I;  1K73 1;  4QTT A;  2JR6 A;  2R7Z I;  4DYO A;  1YUK A;  4X8I A;  1VHO A;  3S1M I;  3CPW Z;  3D6W A;  3HOV I;  2OZK A;  4BD9 A;  2OTL 1;  4Y52 I;  4PQA A;  4TNU A;  3PO3 S;  3SJX A;  3D7F A;  3D7H A;  5D1O B;  3CC4 1;  5IT9 f;  2DE6 A;  4NGS A;  3CCL Z;  1LAN A;  2VF1 A;  6CPA A;  1QVG Z;  3IX0 A;  1IGB A;  3T8W A;  3SJF A;  3D9X A;  3D7D A;  3CCM 1;  5T67 A;  3JAM f;  3PO3 I;  3PB9 X;  1M90 1;  3PBE A;  3P5J B;  1TF9 A;  3HUV A;  4R6T A;  3CCE Z;  4RVG A;  4A3E I;  2ZEG A;  2CTC A;  4OID A;  1S72 Z;  4IAV A;  1PYT B;  1KC8 1;  4JZ0 A;  1ZB8 A;  1Z03 A;  1VQL Z;  2PJC A;  1FNO A;  1RQF A;  1I3Q I;  2M6N A;  1BPM A;  4OC4 A;  3CXC Z;  4NBF A;  2JMO A;  3HOW I;  1YIJ Z;  1Q82 2;  3HOU I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...