2I3CA

Crystal structure of an aspartoacylase from homo sapiens
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
302
structure length
302
Chain Sequence
EHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of aspartoacylase, the brain enzyme impaired in Canavan disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Aspartoacylase
total genus 83
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2006-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2i3cA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2i3cA01
3BXMA 2PJ4A 3RBUA 4P6YA 3PB7X 3KGQA 3KASA 5DS0A 4X2TA 4NJQA 3B3VA 4EFDA 3IWWA 1LAPA 1XJOA 1XRYA 2BOAA 2DEAA 2F8HA 3KQXA 3VATA 3WC5A 4A94A 2XEGA 4O23A 3D7GA 2ZEEA 2PJ6A 5LRGA 3B3TA 4MCQA 3VARA 2PJ2A 5CBMA 4ZX8A 4ZYQA 3N5FA 4RUHA 3FF3A 3PB6X 3H8EA 1ELLP 3D7HA 4ZI6A 1Z2LA 2ZENA 3NH5A 4JYWA 3CDXA 2IMOA 4F8ZA 4AXVA 1CP7A 1ZG7A 4UIAA 2PJ9A 1ELMP 4MHYA 4OIDA 4P4FA 2POKA 4W9YA 3RAMA 3BHXA 1ZLHA 4K3NA 3CPAA 3WC6A 4F9VA 3RZAA 1H8LA 3B3SA 4P10A 5D8NA 3FECA 3WABA 1YSJA 2CIJA 1CPSA 4MMOA 4FWUA 2QVPA 5CPAA 1Q7LA 3S9NA 3NA6A 1TKJA 2GLFA 1EE3P 3SJEA 4G1PA 1JQGA 2JEWA 1HDUA 4MHPA 3FEEA 1LOKA 2VL1A 2Q43A 5JH9A 3H8GA 1R43A 4P44A 4NGRA 2AFUA 3IFEA 5HXDA 2JBKA 2GU2A 2V8GA 3BI1A 2ZEPA 4YU9A 4DJLA 3GLJA 2AFSA 1QQ9A 1IY7A 4KSIA 2WYRA 2QJ8A 1KWMA 4P4BA 3KI9A 1LCPA 2ZOFA 3FH4A 1UWYA 1F2PA 3NH4A 4F9UA 1VHEA 4PPZA 4P4DA 4OC0A 1PYTB 3BI0A 2Q51A 3KZWA 4MCSA 1RTQA 4OKOA 2QYVA 1BPNA 2IJZA 2AFOA 5J1QA 2XEJA 4MXUA 2F7VA 4FUUA 5LYDA 4NJRA 2GLJA 3SJGA 3L2NA 5K8NA 1BPMA 2O53A 2HB6A 2OR4A 1DE4C 3FVLA 3D7FA 3MRUA 4OC4A 4YWYA 1HEEA 4NGNA 4MRIA 5D29A 5LRJA 4R6TA 4A39A 4DYOA 4UF4A 1VHOA 2PJ0A 4OIWA 2G9DA 4NGQA 4MHNA 3JRUA 4WWVA 1CX8A 1Y0RA 3B7IA 2RFHA 1YW4A 4R76A 5HVFA 3CPXA 4OC3A 4X8IA 3SI2A 2O4HA 4P4EA 2HC9A 3NFZA 4OMEA 3ISXA 4ONWA 4R8FA 3K9TA 1IGBA 2C6CA 2JBJA 1AMPA 4TWEA 1DTDA 3IC1A 3KR5A 3PFOA 3D4UA 4ZY0A 2PJ8A 3B3CA 4BD9A 3HLPA 3V38A 4PXBA 2V8HA 1AYEA 3H8FA 3SI0A 1VIXA 2ZOGA 4OC1A 3IIBA 1CG2A 4P4JA 2ZEDA 4PXEA 3PB4X 3KL9A 3KHZA 1XBUA 2AFMA 2CTCA 3PRTA 3TX8A 3PEIA 4PXCA 1ARLA 2GREA 2EK9A 8CPAA 1F57A 3PB8X 4Z65A 4IAVA 1QMUA 4P45A 4X3RA 1XFOA 4OC5A 3MN8A 2EWBA 5LYIA 1Z8LA 3B3WA 5IB9A 2AFWA 2NYQA 2AFZA 4Q7AA 2CTBA 3T8WA 2IQ6A 2ZEHA 2J9AA 3TC8A 3SJXA 3GB0A 2ZELA 1CPXA 4JZ0A 3DGVA 1M4LA 2BCOA 3B2YA 4NGPA 1PCAA 3PFEA 4NFRA 4WJBA 1BAVA 2RB7A 1CBXA 4EWTA 2FVGA 3S9MA 4UEEA 2I3CA 3KR4A 5HVGA 3DLJA 5HVHA 5K8MA 1NSAA 4A38A 2PIZA 1FT7A 3V7ZA 3QNVA 4OP4A 2PJAA 4NGTA 3B35A 4MHZA 1TF8A 3K2KA 2Q4ZA 3HUVA 1ZG8A 3VH9A 4MCRA 2BO9A 3S9LA 4P4IA 1ARMA 2ZEMA 3IO1A 5LRKA 2PJ7A 2C1CA 3D67A 4UEFA 4ZX9A 4R7MA 3FX6A 1ZLIA 2OOTA 4FAIA 4OC2A 2PVVA 4PQAA 2ZEGA 2XEIA 3WC7A 3D68A 3PBBA 1LANA 1YMEA 4DUKA 3IJ3A 1VGYA 1BLLE 3LMSA 5JGFA 5LYFA 2AFXA 5JM6A 4TNUA 5LYLA 5I4MA 2ZEFA 4PXDA 7CPAA 4ZY2A 1TKFA 4LQGA 2XEFA 2ANPA 4H2KA 1Y7EA 1F2OA 2V8DA 2PJ1A 2PJ3A 4NGSA 2PE3A 1LAMA 3SJFA 3WT4A 1FNOA 5K8OA 6CPAA 2V77A 2NSMA 2PIYA 2PCUA 1TXRA 3FJUA 3PBEA 1LFWA 3KQZA 2EK8A 4UIBA 1CP6A 4IHMA 5ELYA 4ZY1A 4GM5A 1Z5RA 3I1UA 4NGMA 3NH8A 1TF9A 2ZEOA 1XMBA 3SI1A 5K8PA 2ABZA 3ISZA 1R3NA 5F09A 2WZNA 1OBRA 3GUXA 2PJBA 2PJCA 2PVWA 4IK2A 4MCPA 2PRQA 1YLOA 4EMEA 3KHXA 3FMCA 1ZG9A 3FEDA 2CF4A 3PB9X 3IEHA 1YW6A 4CPAA 1Y0YA 4UEZA 1TKHA 4A37A 4FBEA 2PJ5A 3D7DA 3D66A 2V8VA 1HDQA 3CT9A 4B6ZA 2C6PA 5THWA 2C6GA 3LWUA 1GYTA
chains in the Genus database with same CATH superfamily
4Q36A 4E2YA 4B5PB 4AYBA 5IX3A 4X2TA 3JAMf 4EFDA 1LAPA 1XRYA 3JAMb 4KORA 3CCJ1 1YREA 4NBEA 2ZEEA 4EWCA 4MCQA 3VTNA 3CXPA 2OTL1 1Y1WI 4ZYQA 1U6MA 4RUHA 3FF3A 4CAWA 2K3RA 2QMLA 3F3PC 2C27A 3D7HA 4M6IA 3EXNA 5GCNA 3CDXA 4F8ZA 3K7AI 2Z3OA 3Q87A 1CP7A 4CS0B 3CMA1 2PJ9A 3G4SZ 4A2ZA 4W9YA 2WAQA 3J81b 3J80f 3WC6A 4F9VA 3IU1A 4CGPA 2Z10A 3B3SA 3S2HI 1WWZA 4H89A 4UFVA 4MD9A 2F4OA 4MMOA 1S7FA 2QVPA 3CCSZ 5G1ZA 4A3JI 2EO8A 1JQGA 2GTHA 1YITZ 2B4DB 3I3GA 1LOKA 2Q43A 5JH9A 4JXRA 1NJI1 4LX9A 5IP7I 2VPYA 4ZGYB 3S15I 4OLLA 1ON0A 5FLXf 4YU9A 3EFAA 3CD6Z 2AFSA 3GCFA 3LD2A 1IY7A 3GTQI 2QJ8A 2PM9A 3T4NB 3KI9A 3MZLB 1LCPA 1YR0A 2QR1B 1AA6A 3NH4A 1F2PA 2ZAEB 4P4DA 5H86A 2RT9A 1PYTB 3BI0A 2Q51A 4KOTA 1RTQA 4OKOA 4MD7A 2QYVA 2RPRA 1P4NA 2Z0ZA 3P2HA 3H3VJ 1IIDA 2G3AA 2AFOA 4CYNA 4MXUA 2F7VA 1QF8A 2GLJA 2QKDA 3L2NA 3DNSA 1BPMA 4M85A 4KLWA 1FDIA 5ISVA 3FVLA 3F3FC 3D7FA 3BG0B 3JUWA 4UFXA 3I07A 1UFHA 5LRJA 4L8AA 1R57A 4UF4A 4OIWA 1VQOZ 3R9GA 2R93I 3CCVZ 2VI7A 2V3VA 3R9EA 2YNEA 1WK4A 4WWVA 4B10A 3PGPA 4R76A 3TCVA 3CPXA 1VQL1 3PO3I 2HC9A 3NFZA 4E32A 4RVGA 4OMEA 1YK3A 3BJ8A 4PK3A 1RO5A 2QREB 4FD7A 4B5OA 1AMPA 4OAEA 1Q862 3RNZA 4CRZB 3D4UA 3WR7A 2G0BA 2RBLA 5A27A 4DK1A 3HLPA 3V38A 4NBFA 4YRHA 3EEDA 3IIBA 1TFIA 1QXFA 1QVGY 3NDIA 4PXEA 3PB4X 4CAXA 1DL6A 3PRTA 2JIMA 5T67A 4CYQA 4CRYB 4Z65A 4BINA 2R7HA 3CXCZ 4NH1C 4X3RA 5AG6A 4A3II 1VQNZ 2OTLZ 2JMOA 3I561 4MY0A 2NVYI 3D6WA 2NYQA 4M6GA 1VQN1 3SJXA 3S1NI 1CPXA 4JZ0A 1YUAA 1M4LA 1YHQZ 4KUBA 2BCOA 1IICA 3QAYA 3FIXA 4NBGA 1I3QI 4BBHA 1BAVA 3G6E1 3R96A 2Q04A 3S9MA 1QYPA 2W03A 5K8MA 1KD12 1KQSZ 4MI4A 4A3BI 1K9M2 5D1OB 2PRBA 3HOWI 4QC6A 2PQ8A 4JJXA 1K8A2 2REFA 2ZW7A 2B5GB 2JDCA 1TWAI 1S3ZA 4NBDA 3VMGA 4AVBA 1ARMA 1M902 3SHPA 2Z3KA 4UBRA 4MONA 3D67A 3MONA 4OC2A 2PVVA 1S7NA 4R57A 5D1OA 2XEIA 1LANA 1YIT1 1VGYA 1BLLE 5LYFA 2AFXA 4XPDC 3S6HA 5LYLA 1TKFA 1VQK1 4LQGA 3B8GA 2ANPA 1Y7EA 3CMEZ 4NXYA 2V8DA 4RVDA 3CCUZ 4Y49C 5G22A 3WT4A 3BG1B 4HNXB 6CPAA 2QECA 3EERA 2NSMA 3PBEA 1M4DA 1LFWA 2EK8A 2Z3LA 1MJBA 4IHMA 3EO4A 1Z5RA 5IP9I 3I1UA 1A2ZA 4HGZA 3SI1A 4CGMA 1R3NA 5CNPA 2QRDB 2JIPA 2R7ZI 2Q4YA 2ZW5A 3GUXA 4EMEA 1IOIA 4HKFA 1CM0A 3FMCA 4A33A 3E0KA 2VZYA 2CF4A 1XIXA 3IEHA 4F6AA 4AVAA 4UEZA 4A37A 3D66A 3GIUA 2B4BA 1Q7Y2 1Q811 2C6GA 3LWUA 3NE7A 4KOUA 2OTJZ 3RYOA 3RBUA 4NEXA 2YNDA 2Q0YA 2Z3NA 3PB7X 3V8IA 3KASA 3GTPI 2JR6A 3IWWA 2F8HA 1XJOA 2DEAA 1NSLA 3VATA 3RZDI 2XEGA 3JVNA 2OOYB 3HKZA 3S16I 2PJ6A 5LRGA 4E31A 2PJ2A 2J8RA 3TFYA 4BBRI 3GKQA 2DE6A 1ELLP 1NUIA 5FLMI 2HQYA 3PZJA 4ZI6A 1XOVA 1Z2LA 2WB1A 2QLVB 2Y0MA 4JYWA 2YNCC 3IF8A 4AXVA 3I4MI 4UIAA 2FE7A 4LQ6A 4XNHB 1P9NA 4HGYA 1XE4A 2POKA 3BHXA 4K3NA 2PR8A 2CXAA 3DR6A 2WSAA 1W2BZ 2E2JI 1H8LA 3FQMA 1K732 2HV2A 1Z4RA 5D8NA 3FECA 1YLEA 3F5BA 4UCNA 4QTTA 2JDDA 4UWJA 3IX0A 1B87A 5AGEA 1Q7LA 3S9NA 4A3EI 2ODFA 3M3YI 4OADA 4AG9A 4RS2A 2JEWA 1HDUA 3KIHA 2E9HA 1XEBA 3H8GA 4BY1I 4F0XA 2GIVA 2EUIA 1Q7Y1 1Q812 1VQ71 3GTGI 2FL4A 3HOVI 2V8GA 2ZW4A 3BI1A 1X0TA 2VBQA 1KUYA 4KSIA 1KWMA 2FIWA 2CNSA 2VZZA 4Y7NI 2BUEA 1UWYA 4F9UA 1VHEA 2IL4A 3G4S1 1BPNA 4MBUA 2IJZA 3D3SA 1RO0A 4GS4A 4FUUA 4MFPA 2OTJ1 4R9MA 1VQ6Z 3ZJ0A 1Y7RA 2HB6A 4CGOA 4RVHA 2LIYA 1Q2CA 3MRUA 4KS9A 4YWYA 3R1KA 3BJ7A 2H85A 4MRIA 3FNCA 1YIJZ 5D29A 2P0WA 2BL1A 2W04A 1VHOA 2PJ0A 2P6FA 3IWEA 1FY7A 4MHNA 2R1IA 1M901 2GFQA 4MJ8A 1CX8A 1Y0RA 2PSWA 1YW4A 4XX2A 3GTKI 4JD6A 3SI2A 4RN7A 2O4HA 4R8FA 1QSTA 1YVKA 5HH1A 3K9TA 5C4JI 2V8IA 1DTDA 1VQ91 3KR5A 3GKRA 3D8PA 4E33A 2LEXA 2VQYA 4PXBA 2V8KA 1VQ51 4QVTA 1PUAA 4BXXI 1LQLA 3TE4A 4MFZA 2ZEDA 3W6XA 2OOXB 3KL9A 2AFMA 1VQP1 1YJ91 1M4IA 4KLVA 3S1MI 1RNIA 3PEIA 1ARLA 1Z8XA 8CPAA 1F57A 2CY2A 1X3ZA 2BJOA 4IAVA 1TWCI 2HF1A 4OC5A 3MN8A 3C26A 3CCRZ 5LYIA 2RHBA 2R6MA 2JA5I 2I79A 3T8WA 1QVFY 5C3EI 5JPHA 3TC8A 2ZPAA 1YJW1 2G3TA 2KPIA 3I4NI 4KOXA 4K30A 1VQLZ 4NFRA 3S2DI 3PFEA 4E2XA 2ZXVA 2FVGA 2I3CA 4AG7A 5HVGA 4S1TA 1VHSA 3T9YA 3DLJA 2J8MA 5IV0A 2VPZA 2QRCB 4A38A 1Y9KA 4MHDA 4A3LI 1M4GA 2Z3MA 1S72Z 4MHZA 3GTJI 4HPSA 1TF8A 4XPKA 5T6BA 4B5PA 2Q4ZA 3VH9A 2OH1A 3S1RI 2BO9A 3CCLZ 1VQMZ 2ZEMA 2VUMI 2PJ7A 3SXNA 3IFUA 4JLYA 2C1CA 4KZTA 4ZX9A 2O28A 4MFJA 4A30A 3TTHA 1QSNA 2KCWA 3HOXI 3WC7A 2JLMA 4DQYB 3TOBA 4NSQA 1USPA 1KUVA 2QA41 5JGFA 2WPXA 3J80b 3CC71 5T64A 5I4MA 7CPAA 4CYOA 4KUAA 1SFOI 1F2OA 4NBBA 2PJ1A 3TDHB 1VQ5Z 3G71Z 3N7ZA 3SJFA 3S17I 1IYKA 5C44I 4NCZA 1Q16A 4MFLA 5K8OA 5JQ4A 3D2PA 4A32A 2PCUA 3FJUA 3KQZA 1L1OC 2Y0SA 5J8CA 5AG7A 4NGMA 4E2ZA 2ZEOA 3PO2I 4ONUA 3SXOA 1X10A 3ISZA 4KVXA 4RS4A 3CC7Z 3S1QI 2WZNA 5FVJA 1MJ9A 3QWUA 5H84A 1VQO1 2V45A 2B4DA 2D4PA 1YJNZ 2LFUA 1Y1VI 2JA6I 5HMNA 4C7HA 3D9XA 1Z9UA 4FBEA 2PJ5A 3D7DA 1RLYA 4M3SA 1GYTA 4B11A 2NMTA 3BXMA 3CCQZ 2DXQA 1XF8A 4P6YA 3KGQA 1N71A 1Y9WA 5DS0A 4KVME 4NJQA 2JEVA 4R3KA 2DPTA 3B3VA 1S721 2BOAA 4J3GA 3KQXA 1WIIA 4O23A 3FBUA 1JWQA 3VARA 5CBMA 1SIWA 3N5FA 5EC4A 2J6AA 5FLXb 3H8EA 2FT0A 4FD6A 3J7A4 1KZFA 3D2MA 1ZG7A 2G2KA 2NVXI 4CYPA 2JNYA 3P2FA 1K9M1 3CME1 2REEA 2AYDA 1ZB9A 4P4FA 5A28A 1J4JA 3RAMA 2VPWA 2Z11A 3OWCA 1VQ9Z 3UY5A 5D1PA 4FD4A 3RZAA 3F8KA 1YSJA 1CPSA 3LODA 1KQSY 3GTLI 2P6EA 4IF5A 4BMHA 2GLFA 4E2WA 3SJEA 2OZGA 3S6KA 2JIOA 5EBVA 2FCKA 1WZNA 1N8R2 1V0CA 1R43A 4P44A 4X6AI 5LL6f 3CQZI 2AFUA 3IFEA 5G20A 1S60A 4BY7I 2JBKA 1Q2DA 2GU2A 1YUKA 3GLJA 1VQ61 4M6HA 1VQ4Z 1QQ9A 2B3UA 2WYRA 3CCR1 4CGLA 4PK2A 1WW9A 3FH4A 1KUXA 1VQ81 4QB9A 3CCJZ 1RO2A 4PPZA 1I21A 2RIQA 1RO4A 4OC0A 2Q4VA 3KZWA 2P6GA 4MCSA 3HOYI 5J1QA 2EBJA 4QUSA 5LYDA 1Z8WA 5IT9f 1VQ8Z 4A93I 3SJGA 5F49A 4II9A 3CC21 2O53A 3CPWY 1DE4C 2B63I 1NP6A 2OZUA 3CXSA 2JUBA 4OC4A 1HEEA 4RV9A 2IZ3A 4NGNA 1QSOA 1I6HI 3VWDA 2GANA 4UCPA 2G9DA 2FIAA 2VXKA 3CCEZ 3LACA 3BLNA 3FXTA 4X8IA 3VB9A 5G21A 1K83I 2B5GA 4P4EA 2GTIA 3CXCY 3I9SA 2C6CA 3FB3A 3D2LA 1YJWZ 3IC1A 1Y8CA 4JXQA 4ZY0A 4BD9A 4B13A 2JA7I 3H8FA 1VIXA 2ZOGA 3W6SA 2DF5A 2R92I 3CCS1 3G3SA 1VQM1 3KHZA 2CTCA 2M6NA 5A2Qb 4U5YA 2AKLA 1L0CA 3TO7A 3PB8X 4P45A 1XFOA 4NB8A 1YHQ1 1K731 3B3WA 4CGNA 5IB9A 1M44A 2P3YA 4AVCA 4Q7AA 2ZEHA 2J9AA 4AB7A 1K8A1 2ZELA 3DGVA 2PR1A 3B2YA 4IUSA 2E2HI 3PP9A 1IYLA 1CBXA 3CC41 5C4XI 3KR4A 5A2Qf 1X12A 3HOUI 5HVHA 1BO4A 1NSAA 1S7LA 2PIZA 3V7ZA 1FT7A 2VPXA 3DR8A 4OP4A 4CAEA 4NGTA 2M48A 1YJN1 1ML8A 1FDOA 1Z4EA 4NB9A 3HUVA 5F47A 2VUGA 2VEZA 4MCRA 4A95A 3U50C 5LRKA 5E96A 3VMHA 3I55Z 1WJ2A 3A9LA 4PSWA 4UEFA 4R7MA 3FX6A 2BSWA 2YNCA 4FAIA 4EVYA 4PQAA 2PC1A 3D68A 1B6BA 3HOZI 2PK7A 1N2FA 4C68A 5IB0A 3LMSA 1LRZA 2GE3A 1XMTA 4TNUA 2X7BA 2ZEFA 2EGTA 2YU9I 2XEFA 3F0AA 2HUZA 2PJ3A 2R8VA 4NGSA 2R98A 2PE3A 1FNOA 1R9TI 4CAVA 2PIYA 2IZ4A 4UIBA 2FS5A 3H0GI 1NJI2 1CP6A 5ELYA 4ZY1A 1Q2YA 1VQKZ 1TF9A 3CPWZ 5K8PA 2ABZA 2QIRA 1MK4A 1QVFZ 5F09A 2PJCA 2FXFA 4IK2A 3KHXA 5F46A 4QBJA 1ZG9A 3FEDA 4CAFA 4C7IA 3CCM1 3H4QA 4A31A 1KD11 3RZOI 3ESWA 2F5IA 3EC4A 1YW6A 1Y0YA 1TKHA 4MY3A 1HDQA 1YJ9Z 5THWA 2WUUA 2CNTA 2OZKA 5DWMA 1AUGA 2PJ4A 3GTOI 4MFKA 2OB0A 4A3MI 5EMIA 1YI21 4UFWA 1QSMA 1NE9A 4PSXA 4A94A 3WC5A 1ZO0A 1VQ7Z 2E2II 3J81f 3D7GA 1JJ2Z 4F0YA 3FKII 4XNHC 4A3FI 3B3TA 3G8WA 1BOBA 4ZX8A 4UCMA 3PB6X 1JJ2Y 1Y1VS 1OZPA 4MH4A 4HH4A 2JS4A 1KRLA 3H5ZA 1TWGI 4CL1A 5CM2M 2ZENA 3NH5A 3IWGA 2IMOA 1TIQA 1Q821 4NF1A 4GXHA 3MZKB 3CCMZ 3NDJA 4U9ZA 1ELMP 4MHYA 4OIDA 3CCE1 4A3CI 2Q7BA 1ZLHA 2Z3PA 4DGLA 3CPAA 3KKWA 3GYAA 4P10A 2ARHA 3I56Z 3WABA 2CIJA 2HU9A 3MGDA 3OW2Y 3TE5B 3DDDA 4FWUA 4R87A 4KOWA 5CPAA 3NA6A 2ATRA 1TKJA 4UA3A 1VKCA 1EE3P 4G1PA 1RXTA 4MHPA 3FEEA 1S5KA 2VL1A 1WCMI 4A3DI 1IB1E 4NGRA 2IV2X 1MJAA 1KC81 3DSBA 3NE8A 5HXDA 4MFQA 2QEXZ 2ZEPA 5IT9b 4DJLA 2OZHA 1M1K1 3CMAZ 4MD8A 4Y49B 4QTUA 2D4OA 4P4BA 2H5MA 2ZOFA 1VQ41 4BBSI 2DE7A 4LUAA 2FSRA 2Q7SA 1YGHA 2KI7B 3T90A 4L89A 3GTMI 4ZBGA 4NBCA 3I551 2K5TA 2XEJA 2NVQI 1KC82 4NJRA 1RQFA 3IGRA 4Y52I 1S7MA 3GTMS 5K8NA 3FYNA 2OR4A 3IR7A 4XPLA 2Q44A 3CC4Z 4RI1A 1PFTA 4R6TA 4A39A 1P0HA 4DYOA 4KOSA 4NGQA 3R95A 3W91A 3S6GA 1Z02A 2B58A 4YFJA 3JRUA 3KIFA 3B7IA 3CCQ1 2RFHA 5BWAB 4Q38A 5KTDA 5HVFA 1YVOA 4OC3A 1JWHC 3CCL1 5I0CA 3CC2Z 2DE5A 3PO3S 4KSAA 3ISXA 4ONWA 1IGBA 3QAHA 3CD61 3FQQA 2JBJA 4TWEA 4HNWB 1TWHI 5F48A 2E7ZA 3M4OI 3PFOA 4E2AA 2PJ8A 3B3CA 1VLAA 4KSFA 3R9FA 2RC4A 2V8HA 2K5RA 1AYEA 3SI0A 2JA8I 4OC1A 1Z03A 1CG2A 4P4JA 4R3LA 1USPB 3TT2A 2ZW6A 4C2YA 2A4NA 1XBUA 3CZXA 3TX8A 2V8JA 4RVFA 4PXCA 2YADA 2GREA 2EK9A 5C82A 1QMUA 4U9YA 2JIQA 1X3WA 2EWBA 5AG4A 1Z8LA 2VF1A 4KVOE 3S6FA 2I00A 4C2ZA 2AFWA 2AFZA 2CTBA 1Q861 2IQ6A 5AG5A 3JTKA 3GB0A 1YIJ1 3G6EZ 2NAPA 3OW2Z 1IOFA 3GY9A 4NGPA 5DWNA 2PDOA 2CNMA 2PMZA 1PCAA 2NVTI 1K4JA 4WJBA 2RB7A 3IU2A 1N8R1 4EWTA 4H6ZA 2AJ6A 1Z01A 4UEEA 1NMTA 2WPWA 3LUSA 4E0AA 4H6UA 4X5KA 2B3VA 3ZZIA 4JWPA 2P28A 4NOZA 1YI2Z 3TO6A 3K9UA 3QNVA 5KTAA 2PJAA 2QEX1 3B35A 5AN9F 3K2KA 3TOAA 1ZG8A 5J8FA 4E30A 3S9LA 1ZB8A 4P4IA 2JIRA 1W2BY 1I50I 3IO1A 3TO9A 3RO0A 1M1K2 2EVNA 4UWIA 1M1DA 3QB8A 1Q822 1CJWA 1ZLIA 4KOYA 2OOTA 4NBHA 2ZEGA 3FRMA 1PU9A 3VMIA 3PBBA 1YX0A 1YMEA 4DUKA 3IJ3A 1TWFI 3EY5A 4E8OA 2OU2A 5JM6A 4NBAA 4PXDA 4ZY2A 1IU8A 1I1DA 4H2KA 4B12A 1GHEA 4HNYB 2DPSA 1LAMA 2QA4Z 1YQEA 4FD5A 4C2XA 3CCV1 4KOVA 2YGWA 2V77A 1QVGZ 1TXRA 3P5JB 2F4MA 1S7KA 1VQPZ 4DNCA 4GM5A 1ZH1A 1Z8TA 3NH8A 1XMBA 4YGOA 2J8NA 4I49A 4B14A 2BEIA 3CCU1 1OBRA 2PJBA 4A3GI 2PVWA 4MCPA 4PV6A 2PRQA 1YLOA 1SQHA 3S14I 3PB9X 3G711 1I12A 3VWEA 3CXQA 5C88A 1QSRA 4XPDB 4CPAA 5KTCA 4A3KI 4ORFA 2AE6A 2V8VA 3CT9A 4B6ZA 2C6PA
chains in the Genus database with same CATH topology
2OZKA 3BXMA 2PJ4A 4E2YA 2OTJZ 3CCQZ 3RBUA 3GTOI 4P6YA 3PB7X 4AYBA 3KGQA 4A3MI 3KASA 1YI21 5DS0A 4X2TA 4NJQA 3JAMf 3B3VA 3GTPI 2JR6A 3IWWA 4EFDA 1S721 1LAPA 1XJOA 1XRYA 2BOAA 3JAMb 2DEAA 2F8HA 3RZDI 3KQXA 3CCJ1 3VATA 3WC5A 2XEGA 1VQ7Z 1WIIA 2E2II 4O23A 2OOYB 3J81f 3D7GA 1JJ2Z 3HKZA 4NBEA 3S16I 3FKII 2ZEEA 2PJ6A 5LRGA 4A3FI 3B3TA 4EWCA 4MCQA 4E31A 3VTNA 3VARA 2PJ2A 5CBMA 4ZX8A 2OTL1 1Y1WI 4ZYQA 3N5FA 4BBRI 4RUHA 3GKQA 3FF3A 2J6AA 2DE6A 3PB6X 5FLXb 3H8EA 1ELLP 1JJ2Y 1NUIA 1Y1VS 4MH4A 4HH4A 2K3RA 5FLMI 2JS4A 1KRLA 3F3PC 3D7HA 1TWGI 4ZI6A 4CL1A 5CM2M 3J7A4 2WB1A 1Z2LA 2ZENA 3NH5A 2QLVB 4JYWA 3IF8A 3CDXA 2IMOA 4F8ZA 3K7AI 1Q821 3Q87A 4AXVA 3MZKB 3I4MI 3CCMZ 1CP7A 2G2KA 3CMA1 1ZG7A 3NDJA 2PJ9A 4UIAA 2NVXI 3G4SZ 2JNYA 1K9M1 3CME1 1ELMP 4MHYA 4OIDA 1P9NA 4HGYA 4P4FA 1ZB9A 2POKA 4W9YA 2WAQA 3J81b 3CCE1 4A3CI 3RAMA 3BHXA 1ZLHA 4DGLA 4K3NA 3J80f 3CPAA 3WC6A 1VQ9Z 4F9VA 5D1PA 1W2BZ 2E2JI 3RZAA 1H8LA 3FQMA 3B3SA 1K732 4P10A 5D8NA 3I56Z 3FECA 3S2HI 3WABA 1YSJA 2CIJA 2HU9A 4MD9A 4QTTA 2F4OA 3OW2Y 1CPSA 3TE5B 4MMOA 4FWUA 3IX0A 2QVPA 3CCSZ 1KQSY 3GTLI 5CPAA 1Q7LA 3S9NA 4A3JI 3NA6A 4A3EI 1TKJA 2GLFA 1EE3P 4E2WA 3M3YI 3SJEA 4G1PA 1JQGA 2GTHA 1YITZ 1HDUA 3KIHA 2JEWA 4MHPA 3FEEA 1LOKA 2VL1A 1N8R2 2E9HA 2Q43A 3H8GA 1WCMI 5JH9A 1R43A 4P44A 4A3DI 5LL6f 4X6AI 4NGRA 4BY1I 3CQZI 2AFUA 1Q7Y1 1Q812 3IFEA 1NJI1 1KC81 1VQ71 4BY7I 3GTGI 5IP7I 5HXDA 2JBKA 2GU2A 1YUKA 3HOVI 2QEXZ 3S15I 2V8GA 1X0TA 2ZEPA 3BI1A 5FLXf 5IT9b 4YU9A 4DJLA 3GLJA 1M1K1 1VQ61 3CMAZ 3CD6Z 2AFSA 3GCFA 1VQ4Z 4MD8A 1QQ9A 1IY7A 4KSIA 2WYRA 4QTUA 3GTQI 2QJ8A 2PM9A 1KWMA 3T4NB 3CCR1 4P4BA 3KI9A 3MZLB 1LCPA 2ZOFA 1VQ41 4BBSI 1WW9A 4Y7NI 2QR1B 2DE7A 3FH4A 1VQ81 1UWYA 3NH4A 1F2PA 4F9UA 2ZAEB 3CCJZ 1RO2A 1VHEA 4PPZA 2KI7B 4P4DA 2RIQA 1RO4A 4OC0A 2RT9A 3GTMI 1PYTB 3G4S1 2Q51A 3BI0A 3KZWA 4MCSA 3HOYI 1RTQA 4NBCA 4OKOA 4MD7A 2QYVA 1BPNA 2RPRA 3I551 3H3VJ 2IJZA 2AFOA 5J1QA 1RO0A 2XEJA 4MXUA 2F7VA 1QF8A 4FUUA 2NVQI 2OTJ1 5LYDA 1KC82 2GLJA 4NJRA 2QKDA 1RQFA 5IT9f 1VQ8Z 4A93I 4Y52I 3SJGA 3L2NA 1S7MA 1VQ6Z 3GTMS 5K8NA 3CC21 1BPMA 2O53A 2HB6A 2OR4A 3CPWY 1DE4C 2B63I 4RVHA 1NP6A 2LIYA 3FVLA 3F3FC 3D7FA 3MRUA 3BG0B 4OC4A 2JUBA 4YWYA 1HEEA 4RV9A 2IZ3A 2H85A 4NGNA 4MRIA 3CC4Z 1I6HI 3I07A 1YIJZ 5D29A 5LRJA 1PFTA 4R6TA 4A39A 4DYOA 2W04A 4UF4A 1VHOA 2PJ0A 4OIWA 2G9DA 1VQOZ 2R93I 4NGQA 3CCVZ 1Z02A 4MHNA 3CCEZ 1M901 3JRUA 3KIFA 4WWVA 1CX8A 1Y0RA 3B7IA 3CCQ1 2RFHA 1YW4A 4R76A 5HVFA 3CPXA 1JWHC 4XX2A 4OC3A 4X8IA 3GTKI 3VB9A 3SI2A 1VQL1 3CCL1 1K83I 3PO3I 2O4HA 4P4EA 3CC2Z 2DE5A 3NFZA 2HC9A 4E32A 4RVGA 3PO3S 4OMEA 2GTIA 3ISXA 3CXCY 4ONWA 4R8FA 2QREB 3K9TA 5C4JI 1IGBA 2C6CA 3CD61 2V8IA 3FQQA 2JBJA 1AMPA 1YJWZ 4TWEA 1TWHI 1Q862 1DTDA 3IC1A 1VQ91 3M4OI 3KR5A 3PFOA 3D4UA 4ZY0A 2PJ8A 4E33A 3B3CA 2RBLA 4BD9A 1VLAA 4DK1A 3HLPA 3V38A 4PXBA 2JA7I 2V8HA 2K5RA 4NBFA 1AYEA 3H8FA 2V8KA 3SI0A 1VQ51 1VIXA 2ZOGA 2JA8I 3EEDA 4OC1A 1Z03A 1TFIA 3IIBA 2R92I 4BXXI 1LQLA 1CG2A 4P4JA 1QVGY 3CCS1 3NDIA 2ZEDA 1USPB 4PXEA 3PB4X 1VQM1 2OOXB 1DL6A 3KL9A 3KHZA 1XBUA 2AFMA 2CTCA 2M6NA 3PRTA 5A2Qb 1VQP1 1YJ91 5T67A 2AKLA 3TX8A 2V8JA 3S1MI 1RNIA 3PEIA 4RVFA 4PXCA 1ARLA 2YADA 2GREA 2EK9A 8CPAA 1F57A 3PB8X 4Z65A 1X3ZA 2BJOA 4IAVA 1TWCI 2HF1A 1QMUA 3CXCZ 4NH1C 4P45A 4X3RA 1XFOA 4OC5A 1X3WA 3MN8A 2EWBA 3CCRZ 4NB8A 4A3II 1YHQ1 1VQNZ 1K731 2RHBA 2OTLZ 2JMOA 2R6MA 2VF1A 1Z8LA 3B3WA 2JA5I 3I561 2NVYI 5IB9A 2AFWA 2P3YA 3D6WA 2NYQA 2AFZA 4Q7AA 2CTBA 1Q861 1VQN1 3T8WA 2IQ6A 1QVFY 2ZEHA 2J9AA 5C3EI 1K8A1 3TC8A 3SJXA 3S1NI 3GB0A 2ZELA 1CPXA 3DGVA 1YIJ1 1YUAA 4JZ0A 1M4LA 1YHQZ 2BCOA 3G6EZ 3B2YA 3OW2Z 2E2HI 1YJW1 4NGPA 2KPIA 3I4NI 4NBGA 2PMZA 1PCAA 2NVTI 1I3QI 1VQLZ 4NFRA 3S2DI 1BAVA 3G6E1 2RB7A 3PFEA 4E2XA 4WJBA 1N8R1 1CBXA 4EWTA 4A94A 2FVGA 3S9MA 1Z01A 3CC41 5C4XI 4UEEA 2I3CA 3KR4A 5HVGA 3LUSA 5A2Qf 4S1TA 1QYPA 3HOUI 3DLJA 5HVHA 2W03A 5K8MA 1KD12 1KQSZ 2QRCB 4A3BI 1NSAA 4A38A 2PIZA 1K9M2 2P28A 4A3LI 4NOZA 1FT7A 3V7ZA 1YI2Z 5D1OB 3HOWI 3QNVA 4OP4A 2PJAA 4NGTA 2QEX1 1S72Z 3B35A 4MHZA 2M48A 1YJN1 1ML8A 1K8A2 3GTJI 1TF8A 5AN9F 3K2KA 5T6BA 2Q4ZA 4NB9A 3HUVA 1ZG8A 3VH9A 2VUGA 4MCRA 1TWAI 4E30A 3S1RI 2BO9A 3S9LA 3CCLZ 1ZB8A 1VQMZ 4NBDA 3VMGA 4P4IA 1ARMA 3U50C 1W2BY 1M902 1I50I 2ZEMA 2VUMI 3IO1A 5LRKA 3VMHA 2PJ7A 3I55Z 1M1K2 3IFUA 2C1CA 4MONA 3D67A 1Q822 4UEFA 4ZX9A 4R7MA 1ZLIA 3FX6A 2OOTA 3MONA 4OC2A 4FAIA 2PVVA 4PQAA 4NBHA 2ZEGA 3HOXI 5D1OA 3VMIA 2XEIA 3WC7A 3D68A 4DQYB 1LANA 3PBBA 1YMEA 3HOZI 2PK7A 1N2FA 1YIT1 4DUKA 3IJ3A 1VGYA 1TWFI 1USPA 1BLLE 3LMSA 2QA41 5JGFA 5LYFA 2AFXA 5JM6A 4TNUA 3J80b 3CC71 5LYLA 5T64A 5I4MA 2ZEFA 4NBAA 4PXDA 7CPAA 4ZY2A 1TKFA 2EGTA 2YU9I 1VQK1 4LQGA 2XEFA 1SFOI 2ANPA 4H2KA 1Y7EA 1F2OA 3CMEZ 4NBBA 2V8DA 4RVDA 2PJ1A 3CCUZ 2PJ3A 4NGSA 3TDHB 1VQ5Z 3G71Z 2PE3A 1LAMA 3S17I 3SJFA 3WT4A 2QA4Z 5C44I 3BG1B 3CCV1 1FNOA 5LYIA 5K8OA 6CPAA 3EERA 1R9TI 2V77A 2NSMA 2PIYA 2IZ4A 2PCUA 1QVGZ 1TXRA 3FJUA 1LFWA 3KQZA 2EK8A 3P5JB 3PBEA 4UIBA 2F4MA 1L1OC 3H0GI 1NJI2 1CP6A 2Y0SA 4IHMA 1VQPZ 5ELYA 4ZY1A 4GM5A 1Z5RA 1ZH1A 5IP9I 3I1UA 4NGMA 3NH8A 1VQKZ 1TF9A 4E2ZA 2ZEOA 3PO2I 1XMBA 4HGZA 3SI1A 3CPWZ 5K8PA 2ABZA 3ISZA 1R3NA 2QRDB 4RS4A 1QVFZ 3CC7Z 3S1QI 2R7ZI 5F09A 2WZNA 3CCU1 1OBRA 3GUXA 2PJBA 4A3GI 2PJCA 2PVWA 4IK2A 3QWUA 2PRQA 1YLOA 4MCPA 4EMEA 1VQO1 3KHXA 3FMCA 1ZG9A 3FEDA 1YJNZ 3S14I 2LFUA 1Y1VI 2JA6I 2CF4A 3CCM1 3PB9X 3G711 3IEHA 1KD11 3RZOI 3ESWA 1YW6A 3D9XA 4CPAA 1Y0YA 4UEZA 1TKHA 4A37A 4A3KI 4FBEA 2PJ5A 3D7DA 3D66A 2V8VA 1HDQA 3CT9A 4B6ZA 1YJ9Z 2C6PA 5THWA 1Q7Y2 1Q811 1RLYA 2C6GA 3LWUA 1GYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BXM A;  2PJ4 A;  3RBU A;  4P6Y A;  3PB7 X;  3KGQ A;  3KAS A;  5DS0 A;  4X2T A;  4NJQ A;  3B3V A;  4EFD A;  3IWW A;  1LAP A;  1XJO A;  1XRY A;  2BOA A;  2DEA A;  2F8H A;  3KQX A;  3VAT A;  3WC5 A;  4A94 A;  2XEG A;  4O23 A;  3D7G A;  2ZEE A;  2PJ6 A;  5LRG A;  3B3T A;  4MCQ A;  3VAR A;  2PJ2 A;  5CBM A;  4ZX8 A;  4ZYQ A;  3N5F A;  4RUH A;  3FF3 A;  3PB6 X;  3H8E A;  1ELL P;  3D7H A;  4ZI6 A;  1Z2L A;  2ZEN A;  3NH5 A;  4JYW A;  3CDX A;  2IMO A;  4F8Z A;  4AXV A;  1CP7 A;  1ZG7 A;  4UIA A;  2PJ9 A;  1ELM P;  4MHY A;  4OID A;  4P4F A;  2POK A;  4W9Y A;  3RAM A;  3BHX A;  1ZLH A;  4K3N A;  3CPA A;  3WC6 A;  4F9V A;  3RZA A;  1H8L A;  3B3S A;  4P10 A;  5D8N A;  3FEC A;  3WAB A;  1YSJ A;  2CIJ A;  1CPS A;  4MMO A;  4FWU A;  2QVP A;  5CPA A;  1Q7L A;  3S9N A;  3NA6 A;  1TKJ A;  2GLF A;  1EE3 P;  3SJE A;  4G1P A;  1JQG A;  2JEW A;  1HDU A;  4MHP A;  3FEE A;  1LOK A;  2VL1 A;  2Q43 A;  5JH9 A;  3H8G A;  1R43 A;  4P44 A;  4NGR A;  2AFU A;  3IFE A;  5HXD A;  2JBK A;  2GU2 A;  2V8G A;  3BI1 A;  2ZEP A;  4YU9 A;  4DJL A;  3GLJ A;  2AFS A;  1QQ9 A;  1IY7 A;  4KSI A;  2WYR A;  2QJ8 A;  1KWM A;  4P4B A;  3KI9 A;  1LCP A;  2ZOF A;  3FH4 A;  1UWY A;  1F2P A;  3NH4 A;  4F9U A;  1VHE A;  4PPZ A;  4P4D A;  4OC0 A;  1PYT B;  3BI0 A;  2Q51 A;  3KZW A;  4MCS A;  1RTQ A;  4OKO A;  2QYV A;  1BPN A;  2IJZ A;  2AFO A;  5J1Q A;  2XEJ A;  4MXU A;  2F7V A;  4FUU A;  5LYD A;  4NJR A;  2GLJ A;  3SJG A;  3L2N A;  5K8N A;  1BPM A;  2O53 A;  2HB6 A;  2OR4 A;  1DE4 C;  3FVL A;  3D7F A;  3MRU A;  4OC4 A;  4YWY A;  1HEE A;  4NGN A;  4MRI A;  5D29 A;  5LRJ A;  4R6T A;  4A39 A;  4DYO A;  4UF4 A;  1VHO A;  2PJ0 A;  4OIW A;  2G9D A;  4NGQ A;  4MHN A;  3JRU A;  4WWV A;  1CX8 A;  1Y0R A;  3B7I A;  2RFH A;  1YW4 A;  4R76 A;  5HVF A;  3CPX A;  4OC3 A;  4X8I A;  3SI2 A;  2O4H A;  4P4E A;  2HC9 A;  3NFZ A;  4OME A;  3ISX A;  4ONW A;  4R8F A;  3K9T A;  1IGB A;  2C6C A;  2JBJ A;  1AMP A;  4TWE A;  1DTD A;  3IC1 A;  3KR5 A;  3PFO A;  3D4U A;  4ZY0 A;  2PJ8 A;  3B3C A;  4BD9 A;  3HLP A;  3V38 A;  4PXB A;  2V8H A;  1AYE A;  3H8F A;  3SI0 A;  1VIX A;  2ZOG A;  4OC1 A;  3IIB A;  1CG2 A;  4P4J A;  2ZED A;  4PXE A;  3PB4 X;  3KL9 A;  3KHZ A;  1XBU A;  2AFM A;  2CTC A;  3PRT A;  3TX8 A;  3PEI A;  4PXC A;  1ARL A;  2GRE A;  2EK9 A;  8CPA A;  1F57 A;  3PB8 X;  4Z65 A;  4IAV A;  1QMU A;  4P45 A;  4X3R A;  1XFO A;  4OC5 A;  3MN8 A;  2EWB A;  5LYI A;  1Z8L A;  3B3W A;  5IB9 A;  2AFW A;  2NYQ A;  2AFZ A;  4Q7A A;  2CTB A;  3T8W A;  2IQ6 A;  2ZEH A;  2J9A A;  3TC8 A;  3SJX A;  3GB0 A;  2ZEL A;  1CPX A;  4JZ0 A;  3DGV A;  1M4L A;  2BCO A;  3B2Y A;  4NGP A;  1PCA A;  3PFE A;  4NFR A;  4WJB A;  1BAV A;  2RB7 A;  1CBX A;  4EWT A;  2FVG A;  3S9M A;  4UEE A;  2I3C A;  3KR4 A;  5HVG A;  3DLJ A;  5HVH A;  5K8M A;  1NSA A;  4A38 A;  2PIZ A;  1FT7 A;  3V7Z A;  3QNV A;  4OP4 A;  2PJA A;  4NGT A;  3B35 A;  4MHZ A;  1TF8 A;  3K2K A;  2Q4Z A;  3HUV A;  1ZG8 A;  3VH9 A;  4MCR A;  2BO9 A;  3S9L A;  4P4I A;  1ARM A;  2ZEM A;  3IO1 A;  5LRK A;  2PJ7 A;  2C1C A;  3D67 A;  4UEF A;  4ZX9 A;  4R7M A;  3FX6 A;  1ZLI A;  2OOT A;  4FAI A;  4OC2 A;  2PVV A;  4PQA A;  2ZEG A;  2XEI A;  3WC7 A;  3D68 A;  3PBB A;  1LAN A;  1YME A;  4DUK A;  3IJ3 A;  1VGY A;  1BLL E;  3LMS A;  5JGF A;  5LYF A;  2AFX A;  5JM6 A;  4TNU A;  5LYL A;  5I4M A;  2ZEF A;  4PXD A;  7CPA A;  4ZY2 A;  1TKF A;  4LQG A;  2XEF A;  2ANP A;  4H2K A;  1Y7E A;  1F2O A;  2V8D A;  2PJ1 A;  2PJ3 A;  4NGS A;  2PE3 A;  1LAM A;  3SJF A;  3WT4 A;  1FNO A;  5K8O A;  6CPA A;  2V77 A;  2NSM A;  2PIY A;  2PCU A;  1TXR A;  3FJU A;  3PBE A;  1LFW A;  3KQZ A;  2EK8 A;  4UIB A;  1CP6 A;  4IHM A;  5ELY A;  4ZY1 A;  4GM5 A;  1Z5R A;  3I1U A;  4NGM A;  3NH8 A;  1TF9 A;  2ZEO A;  1XMB A;  3SI1 A;  5K8P A;  2ABZ A;  3ISZ A;  1R3N A;  5F09 A;  2WZN A;  1OBR A;  3GUX A;  2PJB A;  2PJC A;  2PVW A;  4IK2 A;  4MCP A;  2PRQ A;  1YLO A;  4EME A;  3KHX A;  3FMC A;  1ZG9 A;  3FED A;  2CF4 A;  3PB9 X;  3IEH A;  1YW6 A;  4CPA A;  1Y0Y A;  4UEZ A;  1TKH A;  4A37 A;  4FBE A;  2PJ5 A;  3D7D A;  3D66 A;  2V8V A;  1HDQ A;  3CT9 A;  4B6Z A;  2C6P A;  5THW A;  2C6G A;  3LWU A;  1GYT A; 
#chains in the Genus database with same CATH topology
 4Q36 A;  4E2Y A;  4B5P B;  4AYB A;  5IX3 A;  4X2T A;  3JAM f;  4EFD A;  1LAP A;  1XRY A;  3JAM b;  4KOR A;  3CCJ 1;  1YRE A;  4NBE A;  2ZEE A;  4EWC A;  4MCQ A;  3VTN A;  3CXP A;  2OTL 1;  1Y1W I;  4ZYQ A;  1U6M A;  4RUH A;  3FF3 A;  4CAW A;  2K3R A;  2QML A;  3F3P C;  2C27 A;  3D7H A;  4M6I A;  3EXN A;  5GCN A;  3CDX A;  4F8Z A;  3K7A I;  2Z3O A;  3Q87 A;  1CP7 A;  4CS0 B;  3CMA 1;  2PJ9 A;  3G4S Z;  4A2Z A;  4W9Y A;  2WAQ A;  3J81 b;  3J80 f;  3WC6 A;  4F9V A;  3IU1 A;  4CGP A;  2Z10 A;  3B3S A;  3S2H I;  1WWZ A;  4H89 A;  4UFV A;  4MD9 A;  2F4O A;  4MMO A;  1S7F A;  2QVP A;  3CCS Z;  5G1Z A;  4A3J I;  2EO8 A;  1JQG A;  2GTH A;  1YIT Z;  2B4D B;  3I3G A;  1LOK A;  2Q43 A;  5JH9 A;  4JXR A;  1NJI 1;  4LX9 A;  5IP7 I;  2VPY A;  4ZGY B;  3S15 I;  4OLL A;  1ON0 A;  5FLX f;  4YU9 A;  3EFA A;  3CD6 Z;  2AFS A;  3GCF A;  3LD2 A;  1IY7 A;  3GTQ I;  2QJ8 A;  2PM9 A;  3T4N B;  3KI9 A;  3MZL B;  1LCP A;  1YR0 A;  2QR1 B;  1AA6 A;  3NH4 A;  1F2P A;  2ZAE B;  4P4D A;  5H86 A;  2RT9 A;  1PYT B;  3BI0 A;  2Q51 A;  4KOT A;  1RTQ A;  4OKO A;  4MD7 A;  2QYV A;  2RPR A;  1P4N A;  2Z0Z A;  3P2H A;  3H3V J;  1IID A;  2G3A A;  2AFO A;  4CYN A;  4MXU A;  2F7V A;  1QF8 A;  2GLJ A;  2QKD A;  3L2N A;  3DNS A;  1BPM A;  4M85 A;  4KLW A;  1FDI A;  5ISV A;  3FVL A;  3F3F C;  3D7F A;  3BG0 B;  3JUW A;  4UFX A;  3I07 A;  1UFH A;  5LRJ A;  4L8A A;  1R57 A;  4UF4 A;  4OIW A;  1VQO Z;  3R9G A;  2R93 I;  3CCV Z;  2VI7 A;  2V3V A;  3R9E A;  2YNE A;  1WK4 A;  4WWV A;  4B10 A;  3PGP A;  4R76 A;  3TCV A;  3CPX A;  1VQL 1;  3PO3 I;  2HC9 A;  3NFZ A;  4E32 A;  4RVG A;  4OME A;  1YK3 A;  3BJ8 A;  4PK3 A;  1RO5 A;  2QRE B;  4FD7 A;  4B5O A;  1AMP A;  4OAE A;  1Q86 2;  3RNZ A;  4CRZ B;  3D4U A;  3WR7 A;  2G0B A;  2RBL A;  5A27 A;  4DK1 A;  3HLP A;  3V38 A;  4NBF A;  4YRH A;  3EED A;  3IIB A;  1TFI A;  1QXF A;  1QVG Y;  3NDI A;  4PXE A;  3PB4 X;  4CAX A;  1DL6 A;  3PRT A;  2JIM A;  5T67 A;  4CYQ A;  4CRY B;  4Z65 A;  4BIN A;  2R7H A;  3CXC Z;  4NH1 C;  4X3R A;  5AG6 A;  4A3I I;  1VQN Z;  2OTL Z;  2JMO A;  3I56 1;  4MY0 A;  2NVY I;  3D6W A;  2NYQ A;  4M6G A;  1VQN 1;  3SJX A;  3S1N I;  1CPX A;  4JZ0 A;  1YUA A;  1M4L A;  1YHQ Z;  4KUB A;  2BCO A;  1IIC A;  3QAY A;  3FIX A;  4NBG A;  1I3Q I;  4BBH A;  1BAV A;  3G6E 1;  3R96 A;  2Q04 A;  3S9M A;  1QYP A;  2W03 A;  5K8M A;  1KD1 2;  1KQS Z;  4MI4 A;  4A3B I;  1K9M 2;  5D1O B;  2PRB A;  3HOW I;  4QC6 A;  2PQ8 A;  4JJX A;  1K8A 2;  2REF A;  2ZW7 A;  2B5G B;  2JDC A;  1TWA I;  1S3Z A;  4NBD A;  3VMG A;  4AVB A;  1ARM A;  1M90 2;  3SHP A;  2Z3K A;  4UBR A;  4MON A;  3D67 A;  3MON A;  4OC2 A;  2PVV A;  1S7N A;  4R57 A;  5D1O A;  2XEI A;  1LAN A;  1YIT 1;  1VGY A;  1BLL E;  5LYF A;  2AFX A;  4XPD C;  3S6H A;  5LYL A;  1TKF A;  1VQK 1;  4LQG A;  3B8G A;  2ANP A;  1Y7E A;  3CME Z;  4NXY A;  2V8D A;  4RVD A;  3CCU Z;  4Y49 C;  5G22 A;  3WT4 A;  3BG1 B;  4HNX B;  6CPA A;  2QEC A;  3EER A;  2NSM A;  3PBE A;  1M4D A;  1LFW A;  2EK8 A;  2Z3L A;  1MJB A;  4IHM A;  3EO4 A;  1Z5R A;  5IP9 I;  3I1U A;  1A2Z A;  4HGZ A;  3SI1 A;  4CGM A;  1R3N A;  5CNP A;  2QRD B;  2JIP A;  2R7Z I;  2Q4Y A;  2ZW5 A;  3GUX A;  4EME A;  1IOI A;  4HKF A;  1CM0 A;  3FMC A;  4A33 A;  3E0K A;  2VZY A;  2CF4 A;  1XIX A;  3IEH A;  4F6A A;  4AVA A;  4UEZ A;  4A37 A;  3D66 A;  3GIU A;  2B4B A;  1Q7Y 2;  1Q81 1;  2C6G A;  3LWU A;  3NE7 A;  4KOU A;  2OTJ Z;  3RYO A;  3RBU A;  4NEX A;  2YND A;  2Q0Y A;  2Z3N A;  3PB7 X;  3V8I A;  3KAS A;  3GTP I;  2JR6 A;  3IWW A;  2F8H A;  1XJO A;  2DEA A;  1NSL A;  3VAT A;  3RZD I;  2XEG A;  3JVN A;  2OOY B;  3HKZ A;  3S16 I;  2PJ6 A;  5LRG A;  4E31 A;  2PJ2 A;  2J8R A;  3TFY A;  4BBR I;  3GKQ A;  2DE6 A;  1ELL P;  1NUI A;  5FLM I;  2HQY A;  3PZJ A;  4ZI6 A;  1XOV A;  1Z2L A;  2WB1 A;  2QLV B;  2Y0M A;  4JYW A;  2YNC C;  3IF8 A;  4AXV A;  3I4M I;  4UIA A;  2FE7 A;  4LQ6 A;  4XNH B;  1P9N A;  4HGY A;  1XE4 A;  2POK A;  3BHX A;  4K3N A;  2PR8 A;  2CXA A;  3DR6 A;  2WSA A;  1W2B Z;  2E2J I;  1H8L A;  3FQM A;  1K73 2;  2HV2 A;  1Z4R A;  5D8N A;  3FEC A;  1YLE A;  3F5B A;  4UCN A;  4QTT A;  2JDD A;  4UWJ A;  3IX0 A;  1B87 A;  5AGE A;  1Q7L A;  3S9N A;  4A3E I;  2ODF A;  3M3Y I;  4OAD A;  4AG9 A;  4RS2 A;  2JEW A;  1HDU A;  3KIH A;  2E9H A;  1XEB A;  3H8G A;  4BY1 I;  4F0X A;  2GIV A;  2EUI A;  1Q7Y 1;  1Q81 2;  1VQ7 1;  3GTG I;  2FL4 A;  3HOV I;  2V8G A;  2ZW4 A;  3BI1 A;  1X0T A;  2VBQ A;  1KUY A;  4KSI A;  1KWM A;  2FIW A;  2CNS A;  2VZZ A;  4Y7N I;  2BUE A;  1UWY A;  4F9U A;  1VHE A;  2IL4 A;  3G4S 1;  1BPN A;  4MBU A;  2IJZ A;  3D3S A;  1RO0 A;  4GS4 A;  4FUU A;  4MFP A;  2OTJ 1;  4R9M A;  1VQ6 Z;  3ZJ0 A;  1Y7R A;  2HB6 A;  4CGO A;  4RVH A;  2LIY A;  1Q2C A;  3MRU A;  4KS9 A;  4YWY A;  3R1K A;  3BJ7 A;  2H85 A;  4MRI A;  3FNC A;  1YIJ Z;  5D29 A;  2P0W A;  2BL1 A;  2W04 A;  1VHO A;  2PJ0 A;  2P6F A;  3IWE A;  1FY7 A;  4MHN A;  2R1I A;  1M90 1;  2GFQ A;  4MJ8 A;  1CX8 A;  1Y0R A;  2PSW A;  1YW4 A;  4XX2 A;  3GTK I;  4JD6 A;  3SI2 A;  4RN7 A;  2O4H A;  4R8F A;  1QST A;  1YVK A;  5HH1 A;  3K9T A;  5C4J I;  2V8I A;  1DTD A;  1VQ9 1;  3KR5 A;  3GKR A;  3D8P A;  4E33 A;  2LEX A;  2VQY A;  4PXB A;  2V8K A;  1VQ5 1;  4QVT A;  1PUA A;  4BXX I;  1LQL A;  3TE4 A;  4MFZ A;  2ZED A;  3W6X A;  2OOX B;  3KL9 A;  2AFM A;  1VQP 1;  1YJ9 1;  1M4I A;  4KLV A;  3S1M I;  1RNI A;  3PEI A;  1ARL A;  1Z8X A;  8CPA A;  1F57 A;  2CY2 A;  1X3Z A;  2BJO A;  4IAV A;  1TWC I;  2HF1 A;  4OC5 A;  3MN8 A;  3C26 A;  3CCR Z;  5LYI A;  2RHB A;  2R6M A;  2JA5 I;  2I79 A;  3T8W A;  1QVF Y;  5C3E I;  5JPH A;  3TC8 A;  2ZPA A;  1YJW 1;  2G3T A;  2KPI A;  3I4N I;  4KOX A;  4K30 A;  1VQL Z;  4NFR A;  3S2D I;  3PFE A;  4E2X A;  2ZXV A;  2FVG A;  2I3C A;  4AG7 A;  5HVG A;  4S1T A;  1VHS A;  3T9Y A;  3DLJ A;  2J8M A;  5IV0 A;  2VPZ A;  2QRC B;  4A38 A;  1Y9K A;  4MHD A;  4A3L I;  1M4G A;  2Z3M A;  1S72 Z;  4MHZ A;  3GTJ I;  4HPS A;  1TF8 A;  4XPK A;  5T6B A;  4B5P A;  2Q4Z A;  3VH9 A;  2OH1 A;  3S1R I;  2BO9 A;  3CCL Z;  1VQM Z;  2ZEM A;  2VUM I;  2PJ7 A;  3SXN A;  3IFU A;  4JLY A;  2C1C A;  4KZT A;  4ZX9 A;  2O28 A;  4MFJ A;  4A30 A;  3TTH A;  1QSN A;  2KCW A;  3HOX I;  3WC7 A;  2JLM A;  4DQY B;  3TOB A;  4NSQ A;  1USP A;  1KUV A;  2QA4 1;  5JGF A;  2WPX A;  3J80 b;  3CC7 1;  5T64 A;  5I4M A;  7CPA A;  4CYO A;  4KUA A;  1SFO I;  1F2O A;  4NBB A;  2PJ1 A;  3TDH B;  1VQ5 Z;  3G71 Z;  3N7Z A;  3SJF A;  3S17 I;  1IYK A;  5C44 I;  4NCZ A;  1Q16 A;  4MFL A;  5K8O A;  5JQ4 A;  3D2P A;  4A32 A;  2PCU A;  3FJU A;  3KQZ A;  1L1O C;  2Y0S A;  5J8C A;  5AG7 A;  4NGM A;  4E2Z A;  2ZEO A;  3PO2 I;  4ONU A;  3SXO A;  1X10 A;  3ISZ A;  4KVX A;  4RS4 A;  3CC7 Z;  3S1Q I;  2WZN A;  5FVJ A;  1MJ9 A;  3QWU A;  5H84 A;  1VQO 1;  2V45 A;  2B4D A;  2D4P A;  1YJN Z;  2LFU A;  1Y1V I;  2JA6 I;  5HMN A;  4C7H A;  3D9X A;  1Z9U A;  4FBE A;  2PJ5 A;  3D7D A;  1RLY A;  4M3S A;  1GYT A;  4B11 A;  2NMT A;  3BXM A;  3CCQ Z;  2DXQ A;  1XF8 A;  4P6Y A;  3KGQ A;  1N71 A;  1Y9W A;  5DS0 A;  4KVM E;  4NJQ A;  2JEV A;  4R3K A;  2DPT A;  3B3V A;  1S72 1;  2BOA A;  4J3G A;  3KQX A;  1WII A;  4O23 A;  3FBU A;  1JWQ A;  3VAR A;  5CBM A;  1SIW A;  3N5F A;  5EC4 A;  2J6A A;  5FLX b;  3H8E A;  2FT0 A;  4FD6 A;  3J7A 4;  1KZF A;  3D2M A;  1ZG7 A;  2G2K A;  2NVX I;  4CYP A;  2JNY A;  3P2F A;  1K9M 1;  3CME 1;  2REE A;  2AYD A;  1ZB9 A;  4P4F A;  5A28 A;  1J4J A;  3RAM A;  2VPW A;  2Z11 A;  3OWC A;  1VQ9 Z;  3UY5 A;  5D1P A;  4FD4 A;  3RZA A;  3F8K A;  1YSJ A;  1CPS A;  3LOD A;  1KQS Y;  3GTL I;  2P6E A;  4IF5 A;  4BMH A;  2GLF A;  4E2W A;  3SJE A;  2OZG A;  3S6K A;  2JIO A;  5EBV A;  2FCK A;  1WZN A;  1N8R 2;  1V0C A;  1R43 A;  4P44 A;  4X6A I;  5LL6 f;  3CQZ I;  2AFU A;  3IFE A;  5G20 A;  1S60 A;  4BY7 I;  2JBK A;  1Q2D A;  2GU2 A;  1YUK A;  3GLJ A;  1VQ6 1;  4M6H A;  1VQ4 Z;  1QQ9 A;  2B3U A;  2WYR A;  3CCR 1;  4CGL A;  4PK2 A;  1WW9 A;  3FH4 A;  1KUX A;  1VQ8 1;  4QB9 A;  3CCJ Z;  1RO2 A;  4PPZ A;  1I21 A;  2RIQ A;  1RO4 A;  4OC0 A;  2Q4V A;  3KZW A;  2P6G A;  4MCS A;  3HOY I;  5J1Q A;  2EBJ A;  4QUS A;  5LYD A;  1Z8W A;  5IT9 f;  1VQ8 Z;  4A93 I;  3SJG A;  5F49 A;  4II9 A;  3CC2 1;  2O53 A;  3CPW Y;  1DE4 C;  2B63 I;  1NP6 A;  2OZU A;  3CXS A;  2JUB A;  4OC4 A;  1HEE A;  4RV9 A;  2IZ3 A;  4NGN A;  1QSO A;  1I6H I;  3VWD A;  2GAN A;  4UCP A;  2G9D A;  2FIA A;  2VXK A;  3CCE Z;  3LAC A;  3BLN A;  3FXT A;  4X8I A;  3VB9 A;  5G21 A;  1K83 I;  2B5G A;  4P4E A;  2GTI A;  3CXC Y;  3I9S A;  2C6C A;  3FB3 A;  3D2L A;  1YJW Z;  3IC1 A;  1Y8C A;  4JXQ A;  4ZY0 A;  4BD9 A;  4B13 A;  2JA7 I;  3H8F A;  1VIX A;  2ZOG A;  3W6S A;  2DF5 A;  2R92 I;  3CCS 1;  3G3S A;  1VQM 1;  3KHZ A;  2CTC A;  2M6N A;  5A2Q b;  4U5Y A;  2AKL A;  1L0C A;  3TO7 A;  3PB8 X;  4P45 A;  1XFO A;  4NB8 A;  1YHQ 1;  1K73 1;  3B3W A;  4CGN A;  5IB9 A;  1M44 A;  2P3Y A;  4AVC A;  4Q7A A;  2ZEH A;  2J9A A;  4AB7 A;  1K8A 1;  2ZEL A;  3DGV A;  2PR1 A;  3B2Y A;  4IUS A;  2E2H I;  3PP9 A;  1IYL A;  1CBX A;  3CC4 1;  5C4X I;  3KR4 A;  5A2Q f;  1X12 A;  3HOU I;  5HVH A;  1BO4 A;  1NSA A;  1S7L A;  2PIZ A;  3V7Z A;  1FT7 A;  2VPX A;  3DR8 A;  4OP4 A;  4CAE A;  4NGT A;  2M48 A;  1YJN 1;  1ML8 A;  1FDO A;  1Z4E A;  4NB9 A;  3HUV A;  5F47 A;  2VUG A;  2VEZ A;  4MCR A;  4A95 A;  3U50 C;  5LRK A;  5E96 A;  3VMH A;  3I55 Z;  1WJ2 A;  3A9L A;  4PSW A;  4UEF A;  4R7M A;  3FX6 A;  2BSW A;  2YNC A;  4FAI A;  4EVY A;  4PQA A;  2PC1 A;  3D68 A;  1B6B A;  3HOZ I;  2PK7 A;  1N2F A;  4C68 A;  5IB0 A;  3LMS A;  1LRZ A;  2GE3 A;  1XMT A;  4TNU A;  2X7B A;  2ZEF A;  2EGT A;  2YU9 I;  2XEF A;  3F0A A;  2HUZ A;  2PJ3 A;  2R8V A;  4NGS A;  2R98 A;  2PE3 A;  1FNO A;  1R9T I;  4CAV A;  2PIY A;  2IZ4 A;  4UIB A;  2FS5 A;  3H0G I;  1NJI 2;  1CP6 A;  5ELY A;  4ZY1 A;  1Q2Y A;  1VQK Z;  1TF9 A;  3CPW Z;  5K8P A;  2ABZ A;  2QIR A;  1MK4 A;  1QVF Z;  5F09 A;  2PJC A;  2FXF A;  4IK2 A;  3KHX A;  5F46 A;  4QBJ A;  1ZG9 A;  3FED A;  4CAF A;  4C7I A;  3CCM 1;  3H4Q A;  4A31 A;  1KD1 1;  3RZO I;  3ESW A;  2F5I A;  3EC4 A;  1YW6 A;  1Y0Y A;  1TKH A;  4MY3 A;  1HDQ A;  1YJ9 Z;  5THW A;  2WUU A;  2CNT A;  2OZK A;  5DWM A;  1AUG A;  2PJ4 A;  3GTO I;  4MFK A;  2OB0 A;  4A3M I;  5EMI A;  1YI2 1;  4UFW A;  1QSM A;  1NE9 A;  4PSX A;  4A94 A;  3WC5 A;  1ZO0 A;  1VQ7 Z;  2E2I I;  3J81 f;  3D7G A;  1JJ2 Z;  4F0Y A;  3FKI I;  4XNH C;  4A3F I;  3B3T A;  3G8W A;  1BOB A;  4ZX8 A;  4UCM A;  3PB6 X;  1JJ2 Y;  1Y1V S;  1OZP A;  4MH4 A;  4HH4 A;  2JS4 A;  1KRL A;  3H5Z A;  1TWG I;  4CL1 A;  5CM2 M;  2ZEN A;  3NH5 A;  3IWG A;  2IMO A;  1TIQ A;  1Q82 1;  4NF1 A;  4GXH A;  3MZK B;  3CCM Z;  3NDJ A;  4U9Z A;  1ELM P;  4MHY A;  4OID A;  3CCE 1;  4A3C I;  2Q7B A;  1ZLH A;  2Z3P A;  4DGL A;  3CPA A;  3KKW A;  3GYA A;  4P10 A;  2ARH A;  3I56 Z;  3WAB A;  2CIJ A;  2HU9 A;  3MGD A;  3OW2 Y;  3TE5 B;  3DDD A;  4FWU A;  4R87 A;  4KOW A;  5CPA A;  3NA6 A;  2ATR A;  1TKJ A;  4UA3 A;  1VKC A;  1EE3 P;  4G1P A;  1RXT A;  4MHP A;  3FEE A;  1S5K A;  2VL1 A;  1WCM I;  4A3D I;  1IB1 E;  4NGR A;  2IV2 X;  1MJA A;  1KC8 1;  3DSB A;  3NE8 A;  5HXD A;  4MFQ A;  2QEX Z;  2ZEP A;  5IT9 b;  4DJL A;  2OZH A;  1M1K 1;  3CMA Z;  4MD8 A;  4Y49 B;  4QTU A;  2D4O A;  4P4B A;  2H5M A;  2ZOF A;  1VQ4 1;  4BBS I;  2DE7 A;  4LUA A;  2FSR A;  2Q7S A;  1YGH A;  2KI7 B;  3T90 A;  4L89 A;  3GTM I;  4ZBG A;  4NBC A;  3I55 1;  2K5T A;  2XEJ A;  2NVQ I;  1KC8 2;  4NJR A;  1RQF A;  3IGR A;  4Y52 I;  1S7M A;  3GTM S;  5K8N A;  3FYN A;  2OR4 A;  3IR7 A;  4XPL A;  2Q44 A;  3CC4 Z;  4RI1 A;  1PFT A;  4R6T A;  4A39 A;  1P0H A;  4DYO A;  4KOS A;  4NGQ A;  3R95 A;  3W91 A;  3S6G A;  1Z02 A;  2B58 A;  4YFJ A;  3JRU A;  3KIF A;  3B7I A;  3CCQ 1;  2RFH A;  5BWA B;  4Q38 A;  5KTD A;  5HVF A;  1YVO A;  4OC3 A;  1JWH C;  3CCL 1;  5I0C A;  3CC2 Z;  2DE5 A;  3PO3 S;  4KSA A;  3ISX A;  4ONW A;  1IGB A;  3QAH A;  3CD6 1;  3FQQ A;  2JBJ A;  4TWE A;  4HNW B;  1TWH I;  5F48 A;  2E7Z A;  3M4O I;  3PFO A;  4E2A A;  2PJ8 A;  3B3C A;  1VLA A;  4KSF A;  3R9F A;  2RC4 A;  2V8H A;  2K5R A;  1AYE A;  3SI0 A;  2JA8 I;  4OC1 A;  1Z03 A;  1CG2 A;  4P4J A;  4R3L A;  1USP B;  3TT2 A;  2ZW6 A;  4C2Y A;  2A4N A;  1XBU A;  3CZX A;  3TX8 A;  2V8J A;  4RVF A;  4PXC A;  2YAD A;  2GRE A;  2EK9 A;  5C82 A;  1QMU A;  4U9Y A;  2JIQ A;  1X3W A;  2EWB A;  5AG4 A;  1Z8L A;  2VF1 A;  4KVO E;  3S6F A;  2I00 A;  4C2Z A;  2AFW A;  2AFZ A;  2CTB A;  1Q86 1;  2IQ6 A;  5AG5 A;  3JTK A;  3GB0 A;  1YIJ 1;  3G6E Z;  2NAP A;  3OW2 Z;  1IOF A;  3GY9 A;  4NGP A;  5DWN A;  2PDO A;  2CNM A;  2PMZ A;  1PCA A;  2NVT I;  1K4J A;  4WJB A;  2RB7 A;  3IU2 A;  1N8R 1;  4EWT A;  4H6Z A;  2AJ6 A;  1Z01 A;  4UEE A;  1NMT A;  2WPW A;  3LUS A;  4E0A A;  4H6U A;  4X5K A;  2B3V A;  3ZZI A;  4JWP A;  2P28 A;  4NOZ A;  1YI2 Z;  3TO6 A;  3K9U A;  3QNV A;  5KTA A;  2PJA A;  2QEX 1;  3B35 A;  5AN9 F;  3K2K A;  3TOA A;  1ZG8 A;  5J8F A;  4E30 A;  3S9L A;  1ZB8 A;  4P4I A;  2JIR A;  1W2B Y;  1I50 I;  3IO1 A;  3TO9 A;  3RO0 A;  1M1K 2;  2EVN A;  4UWI A;  1M1D A;  3QB8 A;  1Q82 2;  1CJW A;  1ZLI A;  4KOY A;  2OOT A;  4NBH A;  2ZEG A;  3FRM A;  1PU9 A;  3VMI A;  3PBB A;  1YX0 A;  1YME A;  4DUK A;  3IJ3 A;  1TWF I;  3EY5 A;  4E8O A;  2OU2 A;  5JM6 A;  4NBA A;  4PXD A;  4ZY2 A;  1IU8 A;  1I1D A;  4H2K A;  4B12 A;  1GHE A;  4HNY B;  2DPS A;  1LAM A;  2QA4 Z;  1YQE A;  4FD5 A;  4C2X A;  3CCV 1;  4KOV A;  2YGW A;  2V77 A;  1QVG Z;  1TXR A;  3P5J B;  2F4M A;  1S7K A;  1VQP Z;  4DNC A;  4GM5 A;  1ZH1 A;  1Z8T A;  3NH8 A;  1XMB A;  4YGO A;  2J8N A;  4I49 A;  4B14 A;  2BEI A;  3CCU 1;  1OBR A;  2PJB A;  4A3G I;  2PVW A;  4MCP A;  4PV6 A;  2PRQ A;  1YLO A;  1SQH A;  3S14 I;  3PB9 X;  3G71 1;  1I12 A;  3VWE A;  3CXQ A;  5C88 A;  1QSR A;  4XPD B;  4CPA A;  5KTC A;  4A3K I;  4ORF A;  2AE6 A;  2V8V A;  3CT9 A;  4B6Z A;  2C6P A; 
#chains in the Genus database with same CATH homology
 2OZK A;  3BXM A;  2PJ4 A;  4E2Y A;  2OTJ Z;  3CCQ Z;  3RBU A;  3GTO I;  4P6Y A;  3PB7 X;  4AYB A;  3KGQ A;  4A3M I;  3KAS A;  1YI2 1;  5DS0 A;  4X2T A;  4NJQ A;  3JAM f;  3B3V A;  3GTP I;  2JR6 A;  3IWW A;  4EFD A;  1S72 1;  1LAP A;  1XJO A;  1XRY A;  2BOA A;  3JAM b;  2DEA A;  2F8H A;  3RZD I;  3KQX A;  3CCJ 1;  3VAT A;  3WC5 A;  2XEG A;  1VQ7 Z;  1WII A;  2E2I I;  4O23 A;  2OOY B;  3J81 f;  3D7G A;  1JJ2 Z;  3HKZ A;  4NBE A;  3S16 I;  3FKI I;  2ZEE A;  2PJ6 A;  5LRG A;  4A3F I;  3B3T A;  4EWC A;  4MCQ A;  4E31 A;  3VTN A;  3VAR A;  2PJ2 A;  5CBM A;  4ZX8 A;  2OTL 1;  1Y1W I;  4ZYQ A;  3N5F A;  4BBR I;  4RUH A;  3GKQ A;  3FF3 A;  2J6A A;  2DE6 A;  3PB6 X;  5FLX b;  3H8E A;  1ELL P;  1JJ2 Y;  1NUI A;  1Y1V S;  4MH4 A;  4HH4 A;  2K3R A;  5FLM I;  2JS4 A;  1KRL A;  3F3P C;  3D7H A;  1TWG I;  4ZI6 A;  4CL1 A;  5CM2 M;  3J7A 4;  2WB1 A;  1Z2L A;  2ZEN A;  3NH5 A;  2QLV B;  4JYW A;  3IF8 A;  3CDX A;  2IMO A;  4F8Z A;  3K7A I;  1Q82 1;  3Q87 A;  4AXV A;  3MZK B;  3I4M I;  3CCM Z;  1CP7 A;  2G2K A;  3CMA 1;  1ZG7 A;  3NDJ A;  2PJ9 A;  4UIA A;  2NVX I;  3G4S Z;  2JNY A;  1K9M 1;  3CME 1;  1ELM P;  4MHY A;  4OID A;  1P9N A;  4HGY A;  4P4F A;  1ZB9 A;  2POK A;  4W9Y A;  2WAQ A;  3J81 b;  3CCE 1;  4A3C I;  3RAM A;  3BHX A;  1ZLH A;  4DGL A;  4K3N A;  3J80 f;  3CPA A;  3WC6 A;  1VQ9 Z;  4F9V A;  5D1P A;  1W2B Z;  2E2J I;  3RZA A;  1H8L A;  3FQM A;  3B3S A;  1K73 2;  4P10 A;  5D8N A;  3I56 Z;  3FEC A;  3S2H I;  3WAB A;  1YSJ A;  2CIJ A;  2HU9 A;  4MD9 A;  4QTT A;  2F4O A;  3OW2 Y;  1CPS A;  3TE5 B;  4MMO A;  4FWU A;  3IX0 A;  2QVP A;  3CCS Z;  1KQS Y;  3GTL I;  5CPA A;  1Q7L A;  3S9N A;  4A3J I;  3NA6 A;  4A3E I;  1TKJ A;  2GLF A;  1EE3 P;  4E2W A;  3M3Y I;  3SJE A;  4G1P A;  1JQG A;  2GTH A;  1YIT Z;  1HDU A;  3KIH A;  2JEW A;  4MHP A;  3FEE A;  1LOK A;  2VL1 A;  1N8R 2;  2E9H A;  2Q43 A;  3H8G A;  1WCM I;  5JH9 A;  1R43 A;  4P44 A;  4A3D I;  5LL6 f;  4X6A I;  4NGR A;  4BY1 I;  3CQZ I;  2AFU A;  1Q7Y 1;  1Q81 2;  3IFE A;  1NJI 1;  1KC8 1;  1VQ7 1;  4BY7 I;  3GTG I;  5IP7 I;  5HXD A;  2JBK A;  2GU2 A;  1YUK A;  3HOV I;  2QEX Z;  3S15 I;  2V8G A;  1X0T A;  2ZEP A;  3BI1 A;  5FLX f;  5IT9 b;  4YU9 A;  4DJL A;  3GLJ A;  1M1K 1;  1VQ6 1;  3CMA Z;  3CD6 Z;  2AFS A;  3GCF A;  1VQ4 Z;  4MD8 A;  1QQ9 A;  1IY7 A;  4KSI A;  2WYR A;  4QTU A;  3GTQ I;  2QJ8 A;  2PM9 A;  1KWM A;  3T4N B;  3CCR 1;  4P4B A;  3KI9 A;  3MZL B;  1LCP A;  2ZOF A;  1VQ4 1;  4BBS I;  1WW9 A;  4Y7N I;  2QR1 B;  2DE7 A;  3FH4 A;  1VQ8 1;  1UWY A;  3NH4 A;  1F2P A;  4F9U A;  2ZAE B;  3CCJ Z;  1RO2 A;  1VHE A;  4PPZ A;  2KI7 B;  4P4D A;  2RIQ A;  1RO4 A;  4OC0 A;  2RT9 A;  3GTM I;  1PYT B;  3G4S 1;  2Q51 A;  3BI0 A;  3KZW A;  4MCS A;  3HOY I;  1RTQ A;  4NBC A;  4OKO A;  4MD7 A;  2QYV A;  1BPN A;  2RPR A;  3I55 1;  3H3V J;  2IJZ A;  2AFO A;  5J1Q A;  1RO0 A;  2XEJ A;  4MXU A;  2F7V A;  1QF8 A;  4FUU A;  2NVQ I;  2OTJ 1;  5LYD A;  1KC8 2;  2GLJ A;  4NJR A;  2QKD A;  1RQF A;  5IT9 f;  1VQ8 Z;  4A93 I;  4Y52 I;  3SJG A;  3L2N A;  1S7M A;  1VQ6 Z;  3GTM S;  5K8N A;  3CC2 1;  1BPM A;  2O53 A;  2HB6 A;  2OR4 A;  3CPW Y;  1DE4 C;  2B63 I;  4RVH A;  1NP6 A;  2LIY A;  3FVL A;  3F3F C;  3D7F A;  3MRU A;  3BG0 B;  4OC4 A;  2JUB A;  4YWY A;  1HEE A;  4RV9 A;  2IZ3 A;  2H85 A;  4NGN A;  4MRI A;  3CC4 Z;  1I6H I;  3I07 A;  1YIJ Z;  5D29 A;  5LRJ A;  1PFT A;  4R6T A;  4A39 A;  4DYO A;  2W04 A;  4UF4 A;  1VHO A;  2PJ0 A;  4OIW A;  2G9D A;  1VQO Z;  2R93 I;  4NGQ A;  3CCV Z;  1Z02 A;  4MHN A;  3CCE Z;  1M90 1;  3JRU A;  3KIF A;  4WWV A;  1CX8 A;  1Y0R A;  3B7I A;  3CCQ 1;  2RFH A;  1YW4 A;  4R76 A;  5HVF A;  3CPX A;  1JWH C;  4XX2 A;  4OC3 A;  4X8I A;  3GTK I;  3VB9 A;  3SI2 A;  1VQL 1;  3CCL 1;  1K83 I;  3PO3 I;  2O4H A;  4P4E A;  3CC2 Z;  2DE5 A;  3NFZ A;  2HC9 A;  4E32 A;  4RVG A;  3PO3 S;  4OME A;  2GTI A;  3ISX A;  3CXC Y;  4ONW A;  4R8F A;  2QRE B;  3K9T A;  5C4J I;  1IGB A;  2C6C A;  3CD6 1;  2V8I A;  3FQQ A;  2JBJ A;  1AMP A;  1YJW Z;  4TWE A;  1TWH I;  1Q86 2;  1DTD A;  3IC1 A;  1VQ9 1;  3M4O I;  3KR5 A;  3PFO A;  3D4U A;  4ZY0 A;  2PJ8 A;  4E33 A;  3B3C A;  2RBL A;  4BD9 A;  1VLA A;  4DK1 A;  3HLP A;  3V38 A;  4PXB A;  2JA7 I;  2V8H A;  2K5R A;  4NBF A;  1AYE A;  3H8F A;  2V8K A;  3SI0 A;  1VQ5 1;  1VIX A;  2ZOG A;  2JA8 I;  3EED A;  4OC1 A;  1Z03 A;  1TFI A;  3IIB A;  2R92 I;  4BXX I;  1LQL A;  1CG2 A;  4P4J A;  1QVG Y;  3CCS 1;  3NDI A;  2ZED A;  1USP B;  4PXE A;  3PB4 X;  1VQM 1;  2OOX B;  1DL6 A;  3KL9 A;  3KHZ A;  1XBU A;  2AFM A;  2CTC A;  2M6N A;  3PRT A;  5A2Q b;  1VQP 1;  1YJ9 1;  5T67 A;  2AKL A;  3TX8 A;  2V8J A;  3S1M I;  1RNI A;  3PEI A;  4RVF A;  4PXC A;  1ARL A;  2YAD A;  2GRE A;  2EK9 A;  8CPA A;  1F57 A;  3PB8 X;  4Z65 A;  1X3Z A;  2BJO A;  4IAV A;  1TWC I;  2HF1 A;  1QMU A;  3CXC Z;  4NH1 C;  4P45 A;  4X3R A;  1XFO A;  4OC5 A;  1X3W A;  3MN8 A;  2EWB A;  3CCR Z;  4NB8 A;  4A3I I;  1YHQ 1;  1VQN Z;  1K73 1;  2RHB A;  2OTL Z;  2JMO A;  2R6M A;  2VF1 A;  1Z8L A;  3B3W A;  2JA5 I;  3I56 1;  2NVY I;  5IB9 A;  2AFW A;  2P3Y A;  3D6W A;  2NYQ A;  2AFZ A;  4Q7A A;  2CTB A;  1Q86 1;  1VQN 1;  3T8W A;  2IQ6 A;  1QVF Y;  2ZEH A;  2J9A A;  5C3E I;  1K8A 1;  3TC8 A;  3SJX A;  3S1N I;  3GB0 A;  2ZEL A;  1CPX A;  3DGV A;  1YIJ 1;  1YUA A;  4JZ0 A;  1M4L A;  1YHQ Z;  2BCO A;  3G6E Z;  3B2Y A;  3OW2 Z;  2E2H I;  1YJW 1;  4NGP A;  2KPI A;  3I4N I;  4NBG A;  2PMZ A;  1PCA A;  2NVT I;  1I3Q I;  1VQL Z;  4NFR A;  3S2D I;  1BAV A;  3G6E 1;  2RB7 A;  3PFE A;  4E2X A;  4WJB A;  1N8R 1;  1CBX A;  4EWT A;  4A94 A;  2FVG A;  3S9M A;  1Z01 A;  3CC4 1;  5C4X I;  4UEE A;  2I3C A;  3KR4 A;  5HVG A;  3LUS A;  5A2Q f;  4S1T A;  1QYP A;  3HOU I;  3DLJ A;  5HVH A;  2W03 A;  5K8M A;  1KD1 2;  1KQS Z;  2QRC B;  4A3B I;  1NSA A;  4A38 A;  2PIZ A;  1K9M 2;  2P28 A;  4A3L I;  4NOZ A;  1FT7 A;  3V7Z A;  1YI2 Z;  5D1O B;  3HOW I;  3QNV A;  4OP4 A;  2PJA A;  4NGT A;  2QEX 1;  1S72 Z;  3B35 A;  4MHZ A;  2M48 A;  1YJN 1;  1ML8 A;  1K8A 2;  3GTJ I;  1TF8 A;  5AN9 F;  3K2K A;  5T6B A;  2Q4Z A;  4NB9 A;  3HUV A;  1ZG8 A;  3VH9 A;  2VUG A;  4MCR A;  1TWA I;  4E30 A;  3S1R I;  2BO9 A;  3S9L A;  3CCL Z;  1ZB8 A;  1VQM Z;  4NBD A;  3VMG A;  4P4I A;  1ARM A;  3U50 C;  1W2B Y;  1M90 2;  1I50 I;  2ZEM A;  2VUM I;  3IO1 A;  5LRK A;  3VMH A;  2PJ7 A;  3I55 Z;  1M1K 2;  3IFU A;  2C1C A;  4MON A;  3D67 A;  1Q82 2;  4UEF A;  4ZX9 A;  4R7M A;  1ZLI A;  3FX6 A;  2OOT A;  3MON A;  4OC2 A;  4FAI A;  2PVV A;  4PQA A;  4NBH A;  2ZEG A;  3HOX I;  5D1O A;  3VMI A;  2XEI A;  3WC7 A;  3D68 A;  4DQY B;  1LAN A;  3PBB A;  1YME A;  3HOZ I;  2PK7 A;  1N2F A;  1YIT 1;  4DUK A;  3IJ3 A;  1VGY A;  1TWF I;  1USP A;  1BLL E;  3LMS A;  2QA4 1;  5JGF A;  5LYF A;  2AFX A;  5JM6 A;  4TNU A;  3J80 b;  3CC7 1;  5LYL A;  5T64 A;  5I4M A;  2ZEF A;  4NBA A;  4PXD A;  7CPA A;  4ZY2 A;  1TKF A;  2EGT A;  2YU9 I;  1VQK 1;  4LQG A;  2XEF A;  1SFO I;  2ANP A;  4H2K A;  1Y7E A;  1F2O A;  3CME Z;  4NBB A;  2V8D A;  4RVD A;  2PJ1 A;  3CCU Z;  2PJ3 A;  4NGS A;  3TDH B;  1VQ5 Z;  3G71 Z;  2PE3 A;  1LAM A;  3S17 I;  3SJF A;  3WT4 A;  2QA4 Z;  5C44 I;  3BG1 B;  3CCV 1;  1FNO A;  5LYI A;  5K8O A;  6CPA A;  3EER A;  1R9T I;  2V77 A;  2NSM A;  2PIY A;  2IZ4 A;  2PCU A;  1QVG Z;  1TXR A;  3FJU A;  1LFW A;  3KQZ A;  2EK8 A;  3P5J B;  3PBE A;  4UIB A;  2F4M A;  1L1O C;  3H0G I;  1NJI 2;  1CP6 A;  2Y0S A;  4IHM A;  1VQP Z;  5ELY A;  4ZY1 A;  4GM5 A;  1Z5R A;  1ZH1 A;  5IP9 I;  3I1U A;  4NGM A;  3NH8 A;  1VQK Z;  1TF9 A;  4E2Z A;  2ZEO A;  3PO2 I;  1XMB A;  4HGZ A;  3SI1 A;  3CPW Z;  5K8P A;  2ABZ A;  3ISZ A;  1R3N A;  2QRD B;  4RS4 A;  1QVF Z;  3CC7 Z;  3S1Q I;  2R7Z I;  5F09 A;  2WZN A;  3CCU 1;  1OBR A;  3GUX A;  2PJB A;  4A3G I;  2PJC A;  2PVW A;  4IK2 A;  3QWU A;  2PRQ A;  1YLO A;  4MCP A;  4EME A;  1VQO 1;  3KHX A;  3FMC A;  1ZG9 A;  3FED A;  1YJN Z;  3S14 I;  2LFU A;  1Y1V I;  2JA6 I;  2CF4 A;  3CCM 1;  3PB9 X;  3G71 1;  3IEH A;  1KD1 1;  3RZO I;  3ESW A;  1YW6 A;  3D9X A;  4CPA A;  1Y0Y A;  4UEZ A;  1TKH A;  4A37 A;  4A3K I;  4FBE A;  2PJ5 A;  3D7D A;  3D66 A;  2V8V A;  1HDQ A;  3CT9 A;  4B6Z A;  1YJ9 Z;  2C6P A;  5THW A;  1Q7Y 2;  1Q81 1;  1RLY A;  2C6G A;  3LWU A;  1GYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...