3FQMA

Crystal structure of a novel dimeric form of hcv ns5a domain i protein
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
160
structure length
160
Chain Sequence
LGVPFFSCQRGYKGVWRGDGIMQTTCPCGAQITGHVKNGSMRIVGPRTCSNTWHGTFPINAYTTGPCTPSPAPNYSRALWRVAAEEYVEVTRVGDFHYVTGMTTDNVKCPCQVPAPEFFTEVDGVRLHRYAPACKPLLREEVTFLVGLNQYLVGSQLPCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Non-structural protein 5A
publication title Crystal structure of a novel dimeric form of NS5A domain I protein from hepatitis C virus
pubmed doi rcsb
source organism Hepatitis c virus (isolate con1)
total genus 31
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08300 HCV_NS5a_1a Hepatitis C virus non-structural 5a zinc finger domain
A PF08301 HCV_NS5a_1b Hepatitis C virus non-structural 5a domain 1b
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.210 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3fqmA01
2.20.25.220 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3fqmA02
1ZH1A 3FQQA 4CL1A 3FQMA
chains in the Genus database with same CATH superfamily
1WW9A 3GTMS 3HOVI 2AYDA 1TWGI 4NBBA 2GTHA 4A3KI 4BY7I 4NB9A 1K83I 3CCL1 1RLYA 2GU2A 1USPA 3H0GI 1QXFA 1YITZ 3CC41 1QVFZ 3F3PC 1YIJZ 2JIQA 3CQZI 2JA6I 4E2XA 2P3YA 1Q822 1VQ8Z 1S7MA 3G6EZ 3HOXI 1RNIA 1LQLA 1QVGY 1VQOZ 1YIT1 1SFOI 1YIJ1 1I3QI 1VQKZ 3K7AI 4NBAA 1YI21 3M4OI 1VQ81 1FDOA 1DL6A 1X3ZA 1I50I 1VQ4Z 1WZNA 1NJI1 2E2HI 1KC82 2JUBA 1KD12 1VQK1 3HOYI 5A2Qf 1Q812 1JWHC 5FLXb 5IP9I 2QA4Z 2QRCB 2JIPA 2F4OA 2RT9A 4S1TA 4DK1A 4RVDA 2W04A 3CCQZ 3GTMI 3GTLI 2WAQA 1TWHI 3BG0B 4HGZA 3CCUZ 5IT9f 2QA41 1TWFI 2BJOA 1VQNZ 3GTGI 1RO0A 1ZB9A 4NB8A 4A3JI 3CCQ1 2Q4ZA 4RVHA 2LEXA 1ZB8A 3CCU1 3JAMb 2RPRA 3J80f 1VQN1 5LL6f 1P9NA 5T64A 3IF8A 2YU9I 4BXXI 3D6WA 1Z01A 3JAMf 3G71Z 2HU9A 3FQMA 2JA5I 3TE5B 2QRDB 4NH1C 3CD6Z 4MH4A 1WJ2A 2PK7A 3MZLB 3CMAZ 3I07A 5D1OB 3S1NI 1JJ2Y 3CC21 3S1QI 1Y1VS 3VB9A 1N2FA 3IX0A 1AA6A 5C44I 3OW2Z 5T67A 1X3WA 4E2YA 4NBFA 4MXUA 3CMA1 1I6HI 2V8JA 1M902 1NJI2 1QYPA 1ML8A 3CXCY 1VQ61 3RZOI 1QF8A 5FLMI 2NVXI 1VQLZ 1KQSY 2JS4A 4BBSI 5CM2M 3VMGA 5D1PA 4A3EI 2QEXZ 1FDIA 1K731 1W2BZ 1NUIA 2M48A 3S14I 2OTJZ 2QKDA 5AN9F 2R7ZI 1YJ9Z 2V3VA 2OTLZ 5IP7I 3GCFA 1Q7Y1 3QWUA 3I55Z 2JIMA 1QVGZ 2IV2X 2QEX1 4NBGA 5C3EI 3RZDI 1Q16A 4A3FI 4A3II 2NVQI 4E2WA 2JA8I 2OTJ1 3T4NB 3NH8A 1YJ91 3GTOI 2RBLA 2OTL1 2GTIA 3I551 3CCMZ 3PO3I 2NAPA 3NDJA 1RO2A 4E32A 2H85A 5C4JI 2R6MA 3G6E1 1QVFY 2K3RA 3HOWI 1Y1VI 1VQO1 1Y8CA 1TWAI 4QTTA 2G2KA 3IFUA 2E2JI 2V45A 4NBEA 4TNUA 3CCM1 3S16I 1RO4A 1L1OC 2DE6A 2Y0SA 3CPWY 1VQ41 3H3VJ 1R9TI 4HH4A 5FLXf 5D1OA 4BBRI 4A3GI 2LFUA 2IZ4A 3I56Z 3S2HI 2QREB 2F4MA 1M1K1 1TFIA 3G4SZ 2P28A 2WB1A 2DE7A 4CL1A 3GTJI 1Q861 2OZKA 3GTKI 3HKZA 2OOXB 1TWCI 1ZH1A 1YUAA 2E7ZA 3S2DI 3G4S1 3KIHA 1Y1WI 2V8IA 2O53A 3I4NI 3J81b 2VUMI 1Q821 1Q7Y2 2QR1B 1JJ2Z 1S72Z 3PO3S 4E31A 1K8A1 3MZKB 1YJNZ 3D9XA 2ZAEB 3G711 2NVTI 3MONA 3CC7Z 2Q51A 4E2ZA 3EEDA 1KRLA 1S721 1KC81 3CD61 3GTQI 2JA7I 3CXCZ 3VMHA 4MD8A 1VQMZ 1KQSZ 4E30A 4DQYB 3CC71 1SIWA 3PO2I 2VPZA 1VQ9Z 3M3YI 4EWCA 4MONA 4NBHA 1VQ5Z 3CCLZ 1VQL1 4AYBA 1YUKA 4QTUA 1M1K2 3VMIA 4A3MI 4NBDA 2AKLA 3LUSA 1Q862 1VQ91 3NH4A 3I4MI 2IZ3A 3HOUI 1VQ51 2VPYA 2YADA 3BG1B 4E33A 2M6NA 1W2BY 1VQPZ 3S15I 2RHBA 3CCEZ 1RQFA 3NDIA 1YI2Z 2R92I 3CCSZ 2OOYB 2DE5A 2J6AA 2JIOA 3CCRZ 2JR6A 3CPWZ 2B63I 4XX2A 3CMEZ 3CCVZ 1VQP1 1K8A2 1K9M1 1Z02A 4Y52I 3CCE1 2O4HA 1YJWZ 3GTPI 5C4XI 4NFRA 3CCS1 2KPIA 2VUGA 3HOZI 3CCR1 1M901 3GKQA 5A2Qb 3CME1 3CCV1 1N8R1 1YJW1 3D2LA 1USPB 2RIQA 1YHQZ 1NP6A 4X6AI 4DGLA 3I561 2VPWA 2EGTA 4Y7NI 3CCJZ 2LIYA 5IT9b 4MRIA 3S1RI 3J7A4 4MD9A 2VPXA 1K732 1VLAA 3EERA 4HGYA 1YHQ1 1Z03A 3NH5A 4A3DI 3U50C 2K5RA 4RVFA 3CCJ1 3TDHB 3ESWA 3J81f 3S17I 3S1MI 3FQQA 3J80b 1PFTA 3NFZA 4BY1I 2VF1A 4A93I 4MD7A 2NVYI 2JIRA 3CC2Z 2V8KA 2PM9A 1VQ7Z 1KD11 3IR7A 4A3CI 5T6BA 1YJN1 1Q811 2E2II 3F3FC 4RVGA 1X0TA 4NBCA 3FKII 1VQ71 4A3LI 2R93I 3KIFA 2JNYA 3P5JB 1K9M2 1VQ6Z 2E9HA 2HF1A 4A3BI 1WIIA 2JMOA 3OW2Y 2QLVB 1WCMI 1VQM1 4NOZA 2PMZA 4RV9A 2W03A 4RS4A 2I3CA 3Q87A 3CC4Z 2KI7B 3VTNA 1N8R2
chains in the Genus database with same CATH topology
1WW9A 3GTMS 3HOVI 1TWGI 4NBBA 2GTHA 4A3KI 4BY7I 4NB9A 1K83I 3CCL1 1RLYA 2GU2A 1USPA 3H0GI 1YITZ 3CC41 1QVFZ 3F3PC 1YIJZ 3CQZI 2JA6I 4E2XA 2P3YA 1Q822 1VQ8Z 1S7MA 3G6EZ 3HOXI 1RNIA 1LQLA 1QVGY 1VQOZ 1YIT1 1SFOI 1YIJ1 1I3QI 1VQKZ 3K7AI 4NBAA 1YI21 3M4OI 1VQ81 1DL6A 1X3ZA 1I50I 1VQ4Z 1NJI1 2E2HI 1KC82 2JUBA 1KD12 1VQK1 3HOYI 5A2Qf 1Q812 1JWHC 5FLXb 5IP9I 2QA4Z 2QRCB 2F4OA 2RT9A 4S1TA 4DK1A 4RVDA 2W04A 3CCQZ 3GTMI 3GTLI 2WAQA 1TWHI 3BG0B 4HGZA 3CCUZ 5IT9f 2QA41 1TWFI 2BJOA 1VQNZ 3GTGI 1RO0A 1ZB9A 4NB8A 4A3JI 3CCQ1 2Q4ZA 4RVHA 1ZB8A 3CCU1 3JAMb 2RPRA 3J80f 1VQN1 5LL6f 1P9NA 5T64A 3IF8A 2YU9I 4BXXI 3D6WA 1Z01A 3JAMf 3G71Z 2HU9A 3FQMA 2JA5I 3TE5B 2QRDB 4NH1C 3CD6Z 4MH4A 2PK7A 3MZLB 3CMAZ 3I07A 5D1OB 3S1NI 1JJ2Y 3CC21 3S1QI 1Y1VS 3VB9A 1N2FA 3IX0A 5C44I 3OW2Z 5T67A 1X3WA 4E2YA 4NBFA 4MXUA 3CMA1 1I6HI 2V8JA 1M902 1NJI2 1QYPA 1ML8A 3CXCY 1VQ61 3RZOI 1QF8A 5FLMI 2NVXI 1VQLZ 1KQSY 2JS4A 4BBSI 5CM2M 3VMGA 5D1PA 4A3EI 2QEXZ 1K731 1W2BZ 1NUIA 2M48A 3S14I 2OTJZ 2QKDA 5AN9F 2R7ZI 1YJ9Z 2OTLZ 5IP7I 3GCFA 1Q7Y1 3QWUA 3I55Z 1QVGZ 2QEX1 4NBGA 5C3EI 3RZDI 4A3FI 4A3II 2NVQI 4E2WA 2JA8I 2OTJ1 3T4NB 3NH8A 1YJ91 3GTOI 2RBLA 2OTL1 2GTIA 3I551 3CCMZ 3PO3I 3NDJA 1RO2A 4E32A 2H85A 5C4JI 2R6MA 3G6E1 1QVFY 2K3RA 3HOWI 1Y1VI 1VQO1 1TWAI 4QTTA 2G2KA 3IFUA 2E2JI 4NBEA 4TNUA 3CCM1 3S16I 1RO4A 1L1OC 2DE6A 2Y0SA 3CPWY 1VQ41 3H3VJ 1R9TI 4HH4A 5FLXf 5D1OA 4BBRI 4A3GI 2LFUA 2IZ4A 3I56Z 3S2HI 2QREB 2F4MA 1M1K1 1TFIA 3G4SZ 2P28A 2WB1A 2DE7A 4CL1A 3GTJI 1Q861 2OZKA 3GTKI 3HKZA 2OOXB 1TWCI 1ZH1A 1YUAA 3S2DI 3G4S1 3KIHA 1Y1WI 2V8IA 2O53A 3I4NI 3J81b 2VUMI 1Q821 1Q7Y2 2QR1B 1JJ2Z 1S72Z 3PO3S 4E31A 1K8A1 3MZKB 1YJNZ 3D9XA 2ZAEB 3G711 2NVTI 3MONA 3CC7Z 2Q51A 4E2ZA 3EEDA 1KRLA 1S721 1KC81 3CD61 3GTQI 2JA7I 3CXCZ 3VMHA 4MD8A 1VQMZ 1KQSZ 4E30A 4DQYB 3CC71 3PO2I 1VQ9Z 3M3YI 4EWCA 4MONA 4NBHA 1VQ5Z 3CCLZ 1VQL1 4AYBA 1YUKA 4QTUA 1M1K2 3VMIA 3VTNA 4NBDA 2AKLA 3LUSA 1Q862 1VQ91 3NH4A 3I4MI 2IZ3A 3HOUI 1VQ51 2YADA 3BG1B 4E33A 2M6NA 1W2BY 1VQPZ 3S15I 2RHBA 3CCEZ 1RQFA 3NDIA 1YI2Z 2R92I 3CCSZ 2OOYB 2DE5A 2J6AA 3CCRZ 2JR6A 3CPWZ 2B63I 4XX2A 3CMEZ 3CCVZ 1VQP1 1K8A2 1K9M1 1Z02A 4Y52I 3CCE1 2O4HA 1YJWZ 3GTPI 5C4XI 4NFRA 3CCS1 2KPIA 2VUGA 3HOZI 3CCR1 1M901 3GKQA 5A2Qb 3CME1 3CCV1 1N8R1 1YJW1 1USPB 2RIQA 1YHQZ 1NP6A 4X6AI 4DGLA 3I561 2EGTA 4Y7NI 3CCJZ 2LIYA 5IT9b 4MRIA 3S1RI 3J7A4 4MD9A 1K732 1VLAA 3EERA 4HGYA 1YHQ1 1Z03A 3NH5A 4A3DI 3U50C 2K5RA 4RVFA 3CCJ1 3TDHB 3ESWA 3J81f 3S17I 3S1MI 3FQQA 3J80b 1PFTA 3NFZA 4BY1I 2VF1A 4A93I 4MD7A 2NVYI 3CC2Z 2V8KA 2PM9A 1VQ7Z 1KD11 4A3CI 5T6BA 1YJN1 1Q811 2E2II 3F3FC 4RVGA 1X0TA 4NBCA 3FKII 1VQ71 4A3LI 2R93I 3KIFA 2JNYA 3P5JB 1K9M2 1VQ6Z 2E9HA 2HF1A 4A3BI 1WIIA 2JMOA 3OW2Y 2QLVB 1WCMI 1VQM1 4NOZA 2PMZA 4RV9A 2W03A 4RS4A 2I3CA 3Q87A 3CC4Z 2KI7B 4A3MI 1N8R2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZH1 A;  3FQQ A;  4CL1 A;  3FQM A; 
#chains in the Genus database with same CATH topology
 1WW9 A;  3GTM S;  3HOV I;  2AYD A;  1TWG I;  4NBB A;  2GTH A;  4A3K I;  4BY7 I;  4NB9 A;  1K83 I;  3CCL 1;  1RLY A;  2GU2 A;  1USP A;  3H0G I;  1QXF A;  1YIT Z;  3CC4 1;  1QVF Z;  3F3P C;  1YIJ Z;  2JIQ A;  3CQZ I;  2JA6 I;  4E2X A;  2P3Y A;  1Q82 2;  1VQ8 Z;  1S7M A;  3G6E Z;  3HOX I;  1RNI A;  1LQL A;  1QVG Y;  1VQO Z;  1YIT 1;  1SFO I;  1YIJ 1;  1I3Q I;  1VQK Z;  3K7A I;  4NBA A;  1YI2 1;  3M4O I;  1VQ8 1;  1FDO A;  1DL6 A;  1X3Z A;  1I50 I;  1VQ4 Z;  1WZN A;  1NJI 1;  2E2H I;  1KC8 2;  2JUB A;  1KD1 2;  1VQK 1;  3HOY I;  5A2Q f;  1Q81 2;  1JWH C;  5FLX b;  5IP9 I;  2QA4 Z;  2QRC B;  2JIP A;  2F4O A;  2RT9 A;  4S1T A;  4DK1 A;  4RVD A;  2W04 A;  3CCQ Z;  3GTM I;  3GTL I;  2WAQ A;  1TWH I;  3BG0 B;  4HGZ A;  3CCU Z;  5IT9 f;  2QA4 1;  1TWF I;  2BJO A;  1VQN Z;  3GTG I;  1RO0 A;  1ZB9 A;  4NB8 A;  4A3J I;  3CCQ 1;  2Q4Z A;  4RVH A;  2LEX A;  1ZB8 A;  3CCU 1;  3JAM b;  2RPR A;  3J80 f;  1VQN 1;  5LL6 f;  1P9N A;  5T64 A;  3IF8 A;  2YU9 I;  4BXX I;  3D6W A;  1Z01 A;  3JAM f;  3G71 Z;  2HU9 A;  3FQM A;  2JA5 I;  3TE5 B;  2QRD B;  4NH1 C;  3CD6 Z;  4MH4 A;  1WJ2 A;  2PK7 A;  3MZL B;  3CMA Z;  3I07 A;  5D1O B;  3S1N I;  1JJ2 Y;  3CC2 1;  3S1Q I;  1Y1V S;  3VB9 A;  1N2F A;  3IX0 A;  1AA6 A;  5C44 I;  3OW2 Z;  5T67 A;  1X3W A;  4E2Y A;  4NBF A;  4MXU A;  3CMA 1;  1I6H I;  2V8J A;  1M90 2;  1NJI 2;  1QYP A;  1ML8 A;  3CXC Y;  1VQ6 1;  3RZO I;  1QF8 A;  5FLM I;  2NVX I;  1VQL Z;  1KQS Y;  2JS4 A;  4BBS I;  5CM2 M;  3VMG A;  5D1P A;  4A3E I;  2QEX Z;  1FDI A;  1K73 1;  1W2B Z;  1NUI A;  2M48 A;  3S14 I;  2OTJ Z;  2QKD A;  5AN9 F;  2R7Z I;  1YJ9 Z;  2V3V A;  2OTL Z;  5IP7 I;  3GCF A;  1Q7Y 1;  3QWU A;  3I55 Z;  2JIM A;  1QVG Z;  2IV2 X;  2QEX 1;  4NBG A;  5C3E I;  3RZD I;  1Q16 A;  4A3F I;  4A3I I;  2NVQ I;  4E2W A;  2JA8 I;  2OTJ 1;  3T4N B;  3NH8 A;  1YJ9 1;  3GTO I;  2RBL A;  2OTL 1;  2GTI A;  3I55 1;  3CCM Z;  3PO3 I;  2NAP A;  3NDJ A;  1RO2 A;  4E32 A;  2H85 A;  5C4J I;  2R6M A;  3G6E 1;  1QVF Y;  2K3R A;  3HOW I;  1Y1V I;  1VQO 1;  1Y8C A;  1TWA I;  4QTT A;  2G2K A;  3IFU A;  2E2J I;  2V45 A;  4NBE A;  4TNU A;  3CCM 1;  3S16 I;  1RO4 A;  1L1O C;  2DE6 A;  2Y0S A;  3CPW Y;  1VQ4 1;  3H3V J;  1R9T I;  4HH4 A;  5FLX f;  5D1O A;  4BBR I;  4A3G I;  2LFU A;  2IZ4 A;  3I56 Z;  3S2H I;  2QRE B;  2F4M A;  1M1K 1;  1TFI A;  3G4S Z;  2P28 A;  2WB1 A;  2DE7 A;  4CL1 A;  3GTJ I;  1Q86 1;  2OZK A;  3GTK I;  3HKZ A;  2OOX B;  1TWC I;  1ZH1 A;  1YUA A;  2E7Z A;  3S2D I;  3G4S 1;  3KIH A;  1Y1W I;  2V8I A;  2O53 A;  3I4N I;  3J81 b;  2VUM I;  1Q82 1;  1Q7Y 2;  2QR1 B;  1JJ2 Z;  1S72 Z;  3PO3 S;  4E31 A;  1K8A 1;  3MZK B;  1YJN Z;  3D9X A;  2ZAE B;  3G71 1;  2NVT I;  3MON A;  3CC7 Z;  2Q51 A;  4E2Z A;  3EED A;  1KRL A;  1S72 1;  1KC8 1;  3CD6 1;  3GTQ I;  2JA7 I;  3CXC Z;  3VMH A;  4MD8 A;  1VQM Z;  1KQS Z;  4E30 A;  4DQY B;  3CC7 1;  1SIW A;  3PO2 I;  2VPZ A;  1VQ9 Z;  3M3Y I;  4EWC A;  4MON A;  4NBH A;  1VQ5 Z;  3CCL Z;  1VQL 1;  4AYB A;  1YUK A;  4QTU A;  1M1K 2;  3VMI A;  4A3M I;  4NBD A;  2AKL A;  3LUS A;  1Q86 2;  1VQ9 1;  3NH4 A;  3I4M I;  2IZ3 A;  3HOU I;  1VQ5 1;  2VPY A;  2YAD A;  3BG1 B;  4E33 A;  2M6N A;  1W2B Y;  1VQP Z;  3S15 I;  2RHB A;  3CCE Z;  1RQF A;  3NDI A;  1YI2 Z;  2R92 I;  3CCS Z;  2OOY B;  2DE5 A;  2J6A A;  2JIO A;  3CCR Z;  2JR6 A;  3CPW Z;  2B63 I;  4XX2 A;  3CME Z;  3CCV Z;  1VQP 1;  1K8A 2;  1K9M 1;  1Z02 A;  4Y52 I;  3CCE 1;  2O4H A;  1YJW Z;  3GTP I;  5C4X I;  4NFR A;  3CCS 1;  2KPI A;  2VUG A;  3HOZ I;  3CCR 1;  1M90 1;  3GKQ A;  5A2Q b;  3CME 1;  3CCV 1;  1N8R 1;  1YJW 1;  3D2L A;  1USP B;  2RIQ A;  1YHQ Z;  1NP6 A;  4X6A I;  4DGL A;  3I56 1;  2VPW A;  2EGT A;  4Y7N I;  3CCJ Z;  2LIY A;  5IT9 b;  4MRI A;  3S1R I;  3J7A 4;  4MD9 A;  2VPX A;  1K73 2;  1VLA A;  3EER A;  4HGY A;  1YHQ 1;  1Z03 A;  3NH5 A;  4A3D I;  3U50 C;  2K5R A;  4RVF A;  3CCJ 1;  3TDH B;  3ESW A;  3J81 f;  3S17 I;  3S1M I;  3FQQ A;  3J80 b;  1PFT A;  3NFZ A;  4BY1 I;  2VF1 A;  4A93 I;  4MD7 A;  2NVY I;  2JIR A;  3CC2 Z;  2V8K A;  2PM9 A;  1VQ7 Z;  1KD1 1;  3IR7 A;  4A3C I;  5T6B A;  1YJN 1;  1Q81 1;  2E2I I;  3F3F C;  4RVG A;  1X0T A;  4NBC A;  3FKI I;  1VQ7 1;  4A3L I;  2R93 I;  3KIF A;  2JNY A;  3P5J B;  1K9M 2;  1VQ6 Z;  2E9H A;  2HF1 A;  4A3B I;  1WII A;  2JMO A;  3OW2 Y;  2QLV B;  1WCM I;  1VQM 1;  4NOZ A;  2PMZ A;  4RV9 A;  2W03 A;  4RS4 A;  2I3C A;  3Q87 A;  3CC4 Z;  2KI7 B;  3VTN A;  1N8R 2; 
#chains in the Genus database with same CATH homology
 1WW9 A;  3GTM S;  3HOV I;  1TWG I;  4NBB A;  2GTH A;  4A3K I;  4BY7 I;  4NB9 A;  1K83 I;  3CCL 1;  1RLY A;  2GU2 A;  1USP A;  3H0G I;  1YIT Z;  3CC4 1;  1QVF Z;  3F3P C;  1YIJ Z;  3CQZ I;  2JA6 I;  4E2X A;  2P3Y A;  1Q82 2;  1VQ8 Z;  1S7M A;  3G6E Z;  3HOX I;  1RNI A;  1LQL A;  1QVG Y;  1VQO Z;  1YIT 1;  1SFO I;  1YIJ 1;  1I3Q I;  1VQK Z;  3K7A I;  4NBA A;  1YI2 1;  3M4O I;  1VQ8 1;  1DL6 A;  1X3Z A;  1I50 I;  1VQ4 Z;  1NJI 1;  2E2H I;  1KC8 2;  2JUB A;  1KD1 2;  1VQK 1;  3HOY I;  5A2Q f;  1Q81 2;  1JWH C;  5FLX b;  5IP9 I;  2QA4 Z;  2QRC B;  2F4O A;  2RT9 A;  4S1T A;  4DK1 A;  4RVD A;  2W04 A;  3CCQ Z;  3GTM I;  3GTL I;  2WAQ A;  1TWH I;  3BG0 B;  4HGZ A;  3CCU Z;  5IT9 f;  2QA4 1;  1TWF I;  2BJO A;  1VQN Z;  3GTG I;  1RO0 A;  1ZB9 A;  4NB8 A;  4A3J I;  3CCQ 1;  2Q4Z A;  4RVH A;  1ZB8 A;  3CCU 1;  3JAM b;  2RPR A;  3J80 f;  1VQN 1;  5LL6 f;  1P9N A;  5T64 A;  3IF8 A;  2YU9 I;  4BXX I;  3D6W A;  1Z01 A;  3JAM f;  3G71 Z;  2HU9 A;  3FQM A;  2JA5 I;  3TE5 B;  2QRD B;  4NH1 C;  3CD6 Z;  4MH4 A;  2PK7 A;  3MZL B;  3CMA Z;  3I07 A;  5D1O B;  3S1N I;  1JJ2 Y;  3CC2 1;  3S1Q I;  1Y1V S;  3VB9 A;  1N2F A;  3IX0 A;  5C44 I;  3OW2 Z;  5T67 A;  1X3W A;  4E2Y A;  4NBF A;  4MXU A;  3CMA 1;  1I6H I;  2V8J A;  1M90 2;  1NJI 2;  1QYP A;  1ML8 A;  3CXC Y;  1VQ6 1;  3RZO I;  1QF8 A;  5FLM I;  2NVX I;  1VQL Z;  1KQS Y;  2JS4 A;  4BBS I;  5CM2 M;  3VMG A;  5D1P A;  4A3E I;  2QEX Z;  1K73 1;  1W2B Z;  1NUI A;  2M48 A;  3S14 I;  2OTJ Z;  2QKD A;  5AN9 F;  2R7Z I;  1YJ9 Z;  2OTL Z;  5IP7 I;  3GCF A;  1Q7Y 1;  3QWU A;  3I55 Z;  1QVG Z;  2QEX 1;  4NBG A;  5C3E I;  3RZD I;  4A3F I;  4A3I I;  2NVQ I;  4E2W A;  2JA8 I;  2OTJ 1;  3T4N B;  3NH8 A;  1YJ9 1;  3GTO I;  2RBL A;  2OTL 1;  2GTI A;  3I55 1;  3CCM Z;  3PO3 I;  3NDJ A;  1RO2 A;  4E32 A;  2H85 A;  5C4J I;  2R6M A;  3G6E 1;  1QVF Y;  2K3R A;  3HOW I;  1Y1V I;  1VQO 1;  1TWA I;  4QTT A;  2G2K A;  3IFU A;  2E2J I;  4NBE A;  4TNU A;  3CCM 1;  3S16 I;  1RO4 A;  1L1O C;  2DE6 A;  2Y0S A;  3CPW Y;  1VQ4 1;  3H3V J;  1R9T I;  4HH4 A;  5FLX f;  5D1O A;  4BBR I;  4A3G I;  2LFU A;  2IZ4 A;  3I56 Z;  3S2H I;  2QRE B;  2F4M A;  1M1K 1;  1TFI A;  3G4S Z;  2P28 A;  2WB1 A;  2DE7 A;  4CL1 A;  3GTJ I;  1Q86 1;  2OZK A;  3GTK I;  3HKZ A;  2OOX B;  1TWC I;  1ZH1 A;  1YUA A;  3S2D I;  3G4S 1;  3KIH A;  1Y1W I;  2V8I A;  2O53 A;  3I4N I;  3J81 b;  2VUM I;  1Q82 1;  1Q7Y 2;  2QR1 B;  1JJ2 Z;  1S72 Z;  3PO3 S;  4E31 A;  1K8A 1;  3MZK B;  1YJN Z;  3D9X A;  2ZAE B;  3G71 1;  2NVT I;  3MON A;  3CC7 Z;  2Q51 A;  4E2Z A;  3EED A;  1KRL A;  1S72 1;  1KC8 1;  3CD6 1;  3GTQ I;  2JA7 I;  3CXC Z;  3VMH A;  4MD8 A;  1VQM Z;  1KQS Z;  4E30 A;  4DQY B;  3CC7 1;  3PO2 I;  1VQ9 Z;  3M3Y I;  4EWC A;  4MON A;  4NBH A;  1VQ5 Z;  3CCL Z;  1VQL 1;  4AYB A;  1YUK A;  4QTU A;  1M1K 2;  3VMI A;  3VTN A;  4NBD A;  2AKL A;  3LUS A;  1Q86 2;  1VQ9 1;  3NH4 A;  3I4M I;  2IZ3 A;  3HOU I;  1VQ5 1;  2YAD A;  3BG1 B;  4E33 A;  2M6N A;  1W2B Y;  1VQP Z;  3S15 I;  2RHB A;  3CCE Z;  1RQF A;  3NDI A;  1YI2 Z;  2R92 I;  3CCS Z;  2OOY B;  2DE5 A;  2J6A A;  3CCR Z;  2JR6 A;  3CPW Z;  2B63 I;  4XX2 A;  3CME Z;  3CCV Z;  1VQP 1;  1K8A 2;  1K9M 1;  1Z02 A;  4Y52 I;  3CCE 1;  2O4H A;  1YJW Z;  3GTP I;  5C4X I;  4NFR A;  3CCS 1;  2KPI A;  2VUG A;  3HOZ I;  3CCR 1;  1M90 1;  3GKQ A;  5A2Q b;  3CME 1;  3CCV 1;  1N8R 1;  1YJW 1;  1USP B;  2RIQ A;  1YHQ Z;  1NP6 A;  4X6A I;  4DGL A;  3I56 1;  2EGT A;  4Y7N I;  3CCJ Z;  2LIY A;  5IT9 b;  4MRI A;  3S1R I;  3J7A 4;  4MD9 A;  1K73 2;  1VLA A;  3EER A;  4HGY A;  1YHQ 1;  1Z03 A;  3NH5 A;  4A3D I;  3U50 C;  2K5R A;  4RVF A;  3CCJ 1;  3TDH B;  3ESW A;  3J81 f;  3S17 I;  3S1M I;  3FQQ A;  3J80 b;  1PFT A;  3NFZ A;  4BY1 I;  2VF1 A;  4A93 I;  4MD7 A;  2NVY I;  3CC2 Z;  2V8K A;  2PM9 A;  1VQ7 Z;  1KD1 1;  4A3C I;  5T6B A;  1YJN 1;  1Q81 1;  2E2I I;  3F3F C;  4RVG A;  1X0T A;  4NBC A;  3FKI I;  1VQ7 1;  4A3L I;  2R93 I;  3KIF A;  2JNY A;  3P5J B;  1K9M 2;  1VQ6 Z;  2E9H A;  2HF1 A;  4A3B I;  1WII A;  2JMO A;  3OW2 Y;  2QLV B;  1WCM I;  1VQM 1;  4NOZ A;  2PMZ A;  4RV9 A;  2W03 A;  4RS4 A;  2I3C A;  3Q87 A;  3CC4 Z;  2KI7 B;  4A3M I;  1N8R 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...