3FQMA

Crystal structure of a novel dimeric form of hcv ns5a domain i protein
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
160
structure length
160
Chain Sequence
LGVPFFSCQRGYKGVWRGDGIMQTTCPCGAQITGHVKNGSMRIVGPRTCSNTWHGTFPINAYTTGPCTPSPAPNYSRALWRVAAEEYVEVTRVGDFHYVTGMTTDNVKCPCQVPAPEFFTEVDGVRLHRYAPACKPLLREEVTFLVGLNQYLVGSQLPCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 5A
publication title Crystal structure of a novel dimeric form of NS5A domain I protein from hepatitis C virus
pubmed doi rcsb
source organism Hepatitis c virus (isolate con1)
molecule tags Metal binding protein
total genus 31
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08300 HCV_NS5a_1a Hepatitis C virus non-structural 5a zinc finger domain
A PF08301 HCV_NS5a_1b Hepatitis C virus non-structural 5a domain 1b
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.210 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3fqmA01
2.20.25.220 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3fqmA02
3FQQA 4CL1A 1ZH1A 3FQMA
chains in the Genus database with same CATH superfamily
2QA4Z 4NBBA 3CCUZ 1TWFI 1VQ71 4A3EI 2DE6A 2OZKA 3CXCZ 2V3VA 4E30A 3GTLI 3G4S1 2AYDA 3P5JB 1W2BZ 3D2LA 3RZOI 3M4OI 2QLVB 3VMIA 1YJN1 1S721 1Y8CA 5C3EI 1VQO1 2GTHA 3M3YI 2LIYA 3J80f 2VUMI 1WZNA 3S1RI 1YIJ1 3GTKI 2VPYA 3CPWZ 3I55Z 1FDOA 3S1QI 1VQ7Z 3CME1 5D1PA 3PO3S 1VQ6Z 3NDJA 1X3ZA 1R9TI 3GTPI 4NOZA 4RVFA 3S14I 1QVGZ 4E2YA 3BG0B 2Q4ZA 4NFRA 5A2Qb 1YJNZ 1YITZ 3S15I 2RHBA 1VQOZ 2OOYB 3HOWI 5IT9b 1M902 1YIJZ 2I3CA 2JIRA 3J81b 3GTJI 1M901 4BY7I 2OTJ1 4A3JI 4TNUA 4A3FI 1AA6A 2Q51A 3CMEZ 5T64A 1NP6A 3GCFA 4AYBA 3HOYI 3PO3I 4RVHA 2RPRA 3OW2Y 3NH4A 1KRLA 1JJ2Z 4RV9A 2O53A 2JIOA 1K9M2 2LFUA 2RT9A 2AKLA 1K9M1 5A2Qf 2M6NA 3G711 3VMGA 2BJOA 3J7A4 3CCS1 2IZ4A 3F3FC 1M1K2 1VQK1 4A3II 4E2WA 4A3LI 1VQP1 1M1K1 1NUIA 1LQLA 3FKII 3J81f 1KC82 2JUBA 1KC81 1Z01A 1WIIA 2VPZA 1VQ41 2EGTA 1RO2A 4MD7A 5T6BA 2JA8I 5D1OB 3I551 3GTQI 2JMOA 2E2II 3LUSA 2QR1B 4NBEA 4A3BI 1QXFA 2PK7A 3QWUA 4BBSI 5CM2M 2P3YA 1YJ91 3G71Z 1VQ61 1ZH1A 3CC41 4A3KI 2E2HI 3CCSZ 3GTGI 5LL6f 4NBFA 1VQKZ 3HOUI 3GTMI 1VQPZ 1I3QI 1PFTA 1YUAA 4E31A 1YIT1 1VQ4Z 4E2XA 4NBGA 2NAPA 4BY1I 1KQSY 1X3WA 2PM9A 1Q16A 2QEX1 3KIHA 1YI21 1I6HI 1ML8A 2JR6A 2JIQA 4E2ZA 4BXXI 2O4HA 1VQM1 1P9NA 4E32A 1WJ2A 2K5RA 1YJ9Z 3OW2Z 3CD61 4MD9A 3GTOI 1Q7Y2 4A93I 4A3MI 3CC4Z 1QYPA 4MD8A 1USPA 1VQ51 1Q7Y1 2NVQI 1NJI2 1Z03A 4RVDA 1NJI1 4DQYB 2YADA 2R7ZI 3S17I 4X6AI 2W04A 1VQN1 3RZDI 3HOZI 3EERA 3S1NI 5FLMI 2QEXZ 1WCMI 3CXCY 2F4MA 1YI2Z 2V45A 3K7AI 1DL6A 4MONA 4NH1C 2V8JA 2P28A 2G2KA 1K8A2 1VQMZ 3S2HI 1RNIA 3CD6Z 3NFZA 4A3CI 3NH5A 1VQ5Z 2KI7B 3GKQA 2VUGA 3JAMb 3CMA1 3I4MI 2KPIA 1VQ81 1VQNZ 3MZKB 1SIWA 1K732 1Y1WI 3G6E1 2VF1A 1K731 5IT9f 1K83I 4HGZA 4NBHA 3S1MI 3NH8A 1JWHC 5FLXb 2VPWA 2B63I 3TDHB 1N2FA 1ZB9A 4Y7NI 2RIQA 3I561 1KQSZ 1RO0A 3D9XA 2IV2X 3Q87A 2E9HA 2LEXA 2QREB 3CC21 2JS4A 3EEDA 3CCQ1 1TWGI 2F4OA 4MRIA 3IR7A 3CMAZ 3VTNA 4NB8A 5D1OA 3CCV1 1ZB8A 3FQMA 1VQ8Z 4HGYA 3CCR1 1SFOI 4MXUA 5C44I 3HOXI 3PO2I 3I07A 3CCM1 2QKDA 3G6EZ 2M48A 1VQL1 2JNYA 1QVFY 1TWCI 4CL1A 2NVTI 2W03A 2JA5I 3TE5B 1RLYA 5FLXf 3I56Z 3IX0A 1JJ2Y 4BBRI 4NBDA 3IFUA 4DGLA 2GU2A 1L1OC 4E33A 4DK1A 3CC2Z 3CCE1 2V8IA 3KIFA 3CCQZ 3CC71 2QRDB 1KD12 2DE7A 3CCVZ 1YJWZ 1KD11 3CCRZ 2JA6I 4RVGA 5C4JI 1YHQ1 1RO4A 3CCMZ 4QTUA 1VQLZ 2VPXA 2QRCB 2Y0SA 2DE5A 1N8R2 4HH4A 2IZ3A 1RQFA 1N8R1 3FQQA 1VQ91 1USPB 3HKZA 1Q862 5C4XI 1Q861 3CCL1 3VB9A 2WB1A 2HF1A 1Y1VS 2R93I 2ZAEB 3G4SZ 4A3DI 3VMHA 3CCEZ 2H85A 1W2BY 2E7ZA 1S72Z 4Y52I 3MONA 3ESWA 3CCJ1 3F3PC 3CC7Z 1K8A1 3H3VJ 2JIPA 2NVYI 1YHQZ 2NVXI 5IP9I 1VLAA 2OTL1 1WW9A 3I4NI 4NBCA 2V8KA 2WAQA 1YUKA 2GTIA 3CPWY 3BG1B 4S1TA 1VQ9Z 2E2JI 5AN9F 2YU9I 3MZLB 1FDIA 3H0GI 3CCLZ 3S2DI 1TWHI 1QVFZ 4XX2A 2K3RA 3D6WA 2J6AA 3T4NB 1Y1VI 4NB9A 4NBAA 3NDIA 2QA41 2R92I 3CCU1 1QVGY 1TWAI 1S7MA 3CCJZ 5T67A 1Q822 2OOXB 1Q821 3U50C 1Z02A 3GTMS 2HU9A 2OTLZ 3CQZI 4MH4A 3HOVI 2JIMA 1I50I 2JA7I 3JAMf 2OTJZ 3IF8A 4QTTA 1QF8A 3J80b 1YJW1 2RBLA 2R6MA 4EWCA 2PMZA 5IP7I 3S16I 1Q812 4RS4A 1X0TA 1Q811 4A3GI 1TFIA
chains in the Genus database with same CATH topology
2QA4Z 4NBBA 3CCUZ 1TWFI 1VQ71 4A3EI 2DE6A 2OZKA 3CXCZ 4E30A 3GTLI 3G4S1 3P5JB 1W2BZ 3RZOI 3M4OI 2QLVB 3VMIA 1YJN1 1S721 5C3EI 1VQO1 2GTHA 3M3YI 2LIYA 3J80f 2VUMI 3S1RI 1YIJ1 3GTKI 3CPWZ 3I55Z 3S1QI 1VQ7Z 3CME1 5D1PA 3PO3S 1VQ6Z 3NDJA 1X3ZA 1R9TI 3GTPI 4NOZA 4RVFA 3S14I 1QVGZ 4E2YA 3BG0B 2Q4ZA 4NFRA 5A2Qb 1YJNZ 1YITZ 3S15I 2RHBA 1VQOZ 2OOYB 3HOWI 5IT9b 1M902 1YIJZ 2I3CA 3J81b 3GTJI 1M901 4BY7I 2OTJ1 4A3JI 4TNUA 4A3FI 2Q51A 3CMEZ 5T64A 1NP6A 3GCFA 4AYBA 3HOYI 3PO3I 4RVHA 2RPRA 3OW2Y 3NH4A 1KRLA 1JJ2Z 4RV9A 2O53A 1K9M2 2LFUA 2RT9A 2AKLA 1K9M1 5A2Qf 2M6NA 3G711 3VMGA 2BJOA 3J7A4 3CCS1 2IZ4A 3F3FC 1M1K2 1VQK1 4A3II 4E2WA 4A3LI 1VQP1 1M1K1 1NUIA 1LQLA 3FKII 3J81f 1KC82 2JUBA 1KC81 1Z01A 1WIIA 1VQ41 2EGTA 1RO2A 4MD7A 5T6BA 2JA8I 5D1OB 3I551 3GTQI 2JMOA 2E2II 3LUSA 2QR1B 4NBEA 4A3BI 2PK7A 3QWUA 4BBSI 5CM2M 2P3YA 1YJ91 3G71Z 1VQ61 1ZH1A 3CC41 4A3KI 2E2HI 3CCSZ 3GTGI 5LL6f 4NBFA 1VQKZ 3HOUI 3GTMI 1VQPZ 1I3QI 1PFTA 1YUAA 4E31A 1YIT1 1VQ4Z 4E2XA 4NBGA 4BY1I 1KQSY 1X3WA 2PM9A 2QEX1 3KIHA 1YI21 1I6HI 1ML8A 2JR6A 4E2ZA 4BXXI 2O4HA 1VQM1 1P9NA 4E32A 2K5RA 1YJ9Z 3OW2Z 3CD61 4MD9A 3GTOI 1Q7Y2 4A93I 4A3MI 3CC4Z 1QYPA 4MD8A 1USPA 1VQ51 1Q7Y1 2NVQI 1NJI2 1Z03A 4RVDA 1NJI1 4DQYB 2YADA 2R7ZI 3S17I 4X6AI 2W04A 1VQN1 3RZDI 3HOZI 3EERA 3S1NI 5FLMI 2QEXZ 1WCMI 3CXCY 2F4MA 1YI2Z 3K7AI 1DL6A 4MONA 4NH1C 2V8JA 2P28A 2G2KA 1K8A2 1VQMZ 3S2HI 1RNIA 3CD6Z 3NFZA 4A3CI 3NH5A 1VQ5Z 2KI7B 3GKQA 2VUGA 3JAMb 3CMA1 3I4MI 2KPIA 1VQ81 1VQNZ 3MZKB 1K732 1Y1WI 3G6E1 2VF1A 1K731 5IT9f 1K83I 4HGZA 4NBHA 3S1MI 3NH8A 1JWHC 5FLXb 2B63I 3TDHB 1N2FA 1ZB9A 4Y7NI 2RIQA 3I561 1KQSZ 1RO0A 3D9XA 3Q87A 2E9HA 2QREB 3CC21 2JS4A 3EEDA 3CCQ1 1TWGI 2F4OA 4MRIA 3CMAZ 3VTNA 4NB8A 5D1OA 3CCV1 3FQMA 1VQ8Z 1ZB8A 4HGYA 3CCR1 1SFOI 4MXUA 5C44I 3HOXI 3PO2I 3I07A 3CCM1 2QKDA 3G6EZ 2M48A 1VQL1 2JNYA 1QVFY 1TWCI 4CL1A 2NVTI 2W03A 2JA5I 3TE5B 1RLYA 5FLXf 3I56Z 3IX0A 1JJ2Y 4BBRI 4NBDA 3IFUA 4DGLA 2GU2A 1L1OC 4E33A 4DK1A 3CC2Z 3CCE1 2V8IA 3KIFA 3CCQZ 3CC71 2QRDB 1KD12 2DE7A 3CCVZ 1YJWZ 1KD11 3CCRZ 2JA6I 4RVGA 5C4JI 1YHQ1 1RO4A 3CCMZ 4QTUA 1VQLZ 2QRCB 2Y0SA 2DE5A 1N8R2 4HH4A 2IZ3A 1RQFA 1N8R1 3FQQA 1VQ91 1USPB 3HKZA 1Q862 5C4XI 1Q861 3CCL1 3VB9A 2WB1A 2HF1A 1Y1VS 2R93I 2ZAEB 3G4SZ 4A3DI 3VMHA 3CCEZ 2H85A 1W2BY 1S72Z 4Y52I 3MONA 3ESWA 3CCJ1 3F3PC 3CC7Z 1K8A1 3H3VJ 2NVYI 1YHQZ 2NVXI 5IP9I 1VLAA 2OTL1 1WW9A 3I4NI 4NBCA 2V8KA 2WAQA 1YUKA 2GTIA 3CPWY 3BG1B 4S1TA 1VQ9Z 2E2JI 5AN9F 2YU9I 3MZLB 3H0GI 3CCLZ 3S2DI 1TWHI 1QVFZ 4XX2A 2K3RA 3D6WA 2J6AA 1Y1VI 3T4NB 4NB9A 4NBAA 3NDIA 2QA41 2R92I 3CCU1 1QVGY 1TWAI 1S7MA 3CCJZ 5T67A 1Q822 2OOXB 1Q821 3U50C 1Z02A 3GTMS 2HU9A 2OTLZ 3CQZI 4MH4A 3HOVI 1I50I 2JA7I 3JAMf 2OTJZ 3IF8A 4QTTA 1QF8A 3J80b 1YJW1 2RBLA 2R6MA 4EWCA 2PMZA 5IP7I 3S16I 1Q812 4RS4A 1X0TA 1Q811 4A3GI 1TFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FQQ A;  4CL1 A;  1ZH1 A;  3FQM A; 
#chains in the Genus database with same CATH topology
 2QA4 Z;  4NBB A;  3CCU Z;  1TWF I;  1VQ7 1;  4A3E I;  2DE6 A;  2OZK A;  3CXC Z;  2V3V A;  4E30 A;  3GTL I;  3G4S 1;  2AYD A;  3P5J B;  1W2B Z;  3D2L A;  3RZO I;  3M4O I;  2QLV B;  3VMI A;  1YJN 1;  1S72 1;  1Y8C A;  5C3E I;  1VQO 1;  2GTH A;  3M3Y I;  2LIY A;  3J80 f;  2VUM I;  1WZN A;  3S1R I;  1YIJ 1;  3GTK I;  2VPY A;  3CPW Z;  3I55 Z;  1FDO A;  3S1Q I;  1VQ7 Z;  3CME 1;  5D1P A;  3PO3 S;  1VQ6 Z;  3NDJ A;  1X3Z A;  1R9T I;  3GTP I;  4NOZ A;  4RVF A;  3S14 I;  1QVG Z;  4E2Y A;  3BG0 B;  2Q4Z A;  4NFR A;  5A2Q b;  1YJN Z;  1YIT Z;  3S15 I;  2RHB A;  1VQO Z;  2OOY B;  3HOW I;  5IT9 b;  1M90 2;  1YIJ Z;  2I3C A;  2JIR A;  3J81 b;  3GTJ I;  1M90 1;  4BY7 I;  2OTJ 1;  4A3J I;  4TNU A;  4A3F I;  1AA6 A;  2Q51 A;  3CME Z;  5T64 A;  1NP6 A;  3GCF A;  4AYB A;  3HOY I;  3PO3 I;  4RVH A;  2RPR A;  3OW2 Y;  3NH4 A;  1KRL A;  1JJ2 Z;  4RV9 A;  2O53 A;  2JIO A;  1K9M 2;  2LFU A;  2RT9 A;  2AKL A;  1K9M 1;  5A2Q f;  2M6N A;  3G71 1;  3VMG A;  2BJO A;  3J7A 4;  3CCS 1;  2IZ4 A;  3F3F C;  1M1K 2;  1VQK 1;  4A3I I;  4E2W A;  4A3L I;  1VQP 1;  1M1K 1;  1NUI A;  1LQL A;  3FKI I;  3J81 f;  1KC8 2;  2JUB A;  1KC8 1;  1Z01 A;  1WII A;  2VPZ A;  1VQ4 1;  2EGT A;  1RO2 A;  4MD7 A;  5T6B A;  2JA8 I;  5D1O B;  3I55 1;  3GTQ I;  2JMO A;  2E2I I;  3LUS A;  2QR1 B;  4NBE A;  4A3B I;  1QXF A;  2PK7 A;  3QWU A;  4BBS I;  5CM2 M;  2P3Y A;  1YJ9 1;  3G71 Z;  1VQ6 1;  1ZH1 A;  3CC4 1;  4A3K I;  2E2H I;  3CCS Z;  3GTG I;  5LL6 f;  4NBF A;  1VQK Z;  3HOU I;  3GTM I;  1VQP Z;  1I3Q I;  1PFT A;  1YUA A;  4E31 A;  1YIT 1;  1VQ4 Z;  4E2X A;  4NBG A;  2NAP A;  4BY1 I;  1KQS Y;  1X3W A;  2PM9 A;  1Q16 A;  2QEX 1;  3KIH A;  1YI2 1;  1I6H I;  1ML8 A;  2JR6 A;  2JIQ A;  4E2Z A;  4BXX I;  2O4H A;  1VQM 1;  1P9N A;  4E32 A;  1WJ2 A;  2K5R A;  1YJ9 Z;  3OW2 Z;  3CD6 1;  4MD9 A;  3GTO I;  1Q7Y 2;  4A93 I;  4A3M I;  3CC4 Z;  1QYP A;  4MD8 A;  1USP A;  1VQ5 1;  1Q7Y 1;  2NVQ I;  1NJI 2;  1Z03 A;  4RVD A;  1NJI 1;  4DQY B;  2YAD A;  2R7Z I;  3S17 I;  4X6A I;  2W04 A;  1VQN 1;  3RZD I;  3HOZ I;  3EER A;  3S1N I;  5FLM I;  2QEX Z;  1WCM I;  3CXC Y;  2F4M A;  1YI2 Z;  2V45 A;  3K7A I;  1DL6 A;  4MON A;  4NH1 C;  2V8J A;  2P28 A;  2G2K A;  1K8A 2;  1VQM Z;  3S2H I;  1RNI A;  3CD6 Z;  3NFZ A;  4A3C I;  3NH5 A;  1VQ5 Z;  2KI7 B;  3GKQ A;  2VUG A;  3JAM b;  3CMA 1;  3I4M I;  2KPI A;  1VQ8 1;  1VQN Z;  3MZK B;  1SIW A;  1K73 2;  1Y1W I;  3G6E 1;  2VF1 A;  1K73 1;  5IT9 f;  1K83 I;  4HGZ A;  4NBH A;  3S1M I;  3NH8 A;  1JWH C;  5FLX b;  2VPW A;  2B63 I;  3TDH B;  1N2F A;  1ZB9 A;  4Y7N I;  2RIQ A;  3I56 1;  1KQS Z;  1RO0 A;  3D9X A;  2IV2 X;  3Q87 A;  2E9H A;  2LEX A;  2QRE B;  3CC2 1;  2JS4 A;  3EED A;  3CCQ 1;  1TWG I;  2F4O A;  4MRI A;  3IR7 A;  3CMA Z;  3VTN A;  4NB8 A;  5D1O A;  3CCV 1;  1ZB8 A;  3FQM A;  1VQ8 Z;  4HGY A;  3CCR 1;  1SFO I;  4MXU A;  5C44 I;  3HOX I;  3PO2 I;  3I07 A;  3CCM 1;  2QKD A;  3G6E Z;  2M48 A;  1VQL 1;  2JNY A;  1QVF Y;  1TWC I;  4CL1 A;  2NVT I;  2W03 A;  2JA5 I;  3TE5 B;  1RLY A;  5FLX f;  3I56 Z;  3IX0 A;  1JJ2 Y;  4BBR I;  4NBD A;  3IFU A;  4DGL A;  2GU2 A;  1L1O C;  4E33 A;  4DK1 A;  3CC2 Z;  3CCE 1;  2V8I A;  3KIF A;  3CCQ Z;  3CC7 1;  2QRD B;  1KD1 2;  2DE7 A;  3CCV Z;  1YJW Z;  1KD1 1;  3CCR Z;  2JA6 I;  4RVG A;  5C4J I;  1YHQ 1;  1RO4 A;  3CCM Z;  4QTU A;  1VQL Z;  2VPX A;  2QRC B;  2Y0S A;  2DE5 A;  1N8R 2;  4HH4 A;  2IZ3 A;  1RQF A;  1N8R 1;  3FQQ A;  1VQ9 1;  1USP B;  3HKZ A;  1Q86 2;  5C4X I;  1Q86 1;  3CCL 1;  3VB9 A;  2WB1 A;  2HF1 A;  1Y1V S;  2R93 I;  2ZAE B;  3G4S Z;  4A3D I;  3VMH A;  3CCE Z;  2H85 A;  1W2B Y;  2E7Z A;  1S72 Z;  4Y52 I;  3MON A;  3ESW A;  3CCJ 1;  3F3P C;  3CC7 Z;  1K8A 1;  3H3V J;  2JIP A;  2NVY I;  1YHQ Z;  2NVX I;  5IP9 I;  1VLA A;  2OTL 1;  1WW9 A;  3I4N I;  4NBC A;  2V8K A;  2WAQ A;  1YUK A;  2GTI A;  3CPW Y;  3BG1 B;  4S1T A;  1VQ9 Z;  2E2J I;  5AN9 F;  2YU9 I;  3MZL B;  1FDI A;  3H0G I;  3CCL Z;  3S2D I;  1TWH I;  1QVF Z;  4XX2 A;  2K3R A;  3D6W A;  2J6A A;  3T4N B;  1Y1V I;  4NB9 A;  4NBA A;  3NDI A;  2QA4 1;  2R92 I;  3CCU 1;  1QVG Y;  1TWA I;  1S7M A;  3CCJ Z;  5T67 A;  1Q82 2;  2OOX B;  1Q82 1;  3U50 C;  1Z02 A;  3GTM S;  2HU9 A;  2OTL Z;  3CQZ I;  4MH4 A;  3HOV I;  2JIM A;  1I50 I;  2JA7 I;  3JAM f;  2OTJ Z;  3IF8 A;  4QTT A;  1QF8 A;  3J80 b;  1YJW 1;  2RBL A;  2R6M A;  4EWC A;  2PMZ A;  5IP7 I;  3S16 I;  1Q81 2;  4RS4 A;  1X0T A;  1Q81 1;  4A3G I;  1TFI A; 
#chains in the Genus database with same CATH homology
 2QA4 Z;  4NBB A;  3CCU Z;  1TWF I;  1VQ7 1;  4A3E I;  2DE6 A;  2OZK A;  3CXC Z;  4E30 A;  3GTL I;  3G4S 1;  3P5J B;  1W2B Z;  3RZO I;  3M4O I;  2QLV B;  3VMI A;  1YJN 1;  1S72 1;  5C3E I;  1VQO 1;  2GTH A;  3M3Y I;  2LIY A;  3J80 f;  2VUM I;  3S1R I;  1YIJ 1;  3GTK I;  3CPW Z;  3I55 Z;  3S1Q I;  1VQ7 Z;  3CME 1;  5D1P A;  3PO3 S;  1VQ6 Z;  3NDJ A;  1X3Z A;  1R9T I;  3GTP I;  4NOZ A;  4RVF A;  3S14 I;  1QVG Z;  4E2Y A;  3BG0 B;  2Q4Z A;  4NFR A;  5A2Q b;  1YJN Z;  1YIT Z;  3S15 I;  2RHB A;  1VQO Z;  2OOY B;  3HOW I;  5IT9 b;  1M90 2;  1YIJ Z;  2I3C A;  3J81 b;  3GTJ I;  1M90 1;  4BY7 I;  2OTJ 1;  4A3J I;  4TNU A;  4A3F I;  2Q51 A;  3CME Z;  5T64 A;  1NP6 A;  3GCF A;  4AYB A;  3HOY I;  3PO3 I;  4RVH A;  2RPR A;  3OW2 Y;  3NH4 A;  1KRL A;  1JJ2 Z;  4RV9 A;  2O53 A;  1K9M 2;  2LFU A;  2RT9 A;  2AKL A;  1K9M 1;  5A2Q f;  2M6N A;  3G71 1;  3VMG A;  2BJO A;  3J7A 4;  3CCS 1;  2IZ4 A;  3F3F C;  1M1K 2;  1VQK 1;  4A3I I;  4E2W A;  4A3L I;  1VQP 1;  1M1K 1;  1NUI A;  1LQL A;  3FKI I;  3J81 f;  1KC8 2;  2JUB A;  1KC8 1;  1Z01 A;  1WII A;  1VQ4 1;  2EGT A;  1RO2 A;  4MD7 A;  5T6B A;  2JA8 I;  5D1O B;  3I55 1;  3GTQ I;  2JMO A;  2E2I I;  3LUS A;  2QR1 B;  4NBE A;  4A3B I;  2PK7 A;  3QWU A;  4BBS I;  5CM2 M;  2P3Y A;  1YJ9 1;  3G71 Z;  1VQ6 1;  1ZH1 A;  3CC4 1;  4A3K I;  2E2H I;  3CCS Z;  3GTG I;  5LL6 f;  4NBF A;  1VQK Z;  3HOU I;  3GTM I;  1VQP Z;  1I3Q I;  1PFT A;  1YUA A;  4E31 A;  1YIT 1;  1VQ4 Z;  4E2X A;  4NBG A;  4BY1 I;  1KQS Y;  1X3W A;  2PM9 A;  2QEX 1;  3KIH A;  1YI2 1;  1I6H I;  1ML8 A;  2JR6 A;  4E2Z A;  4BXX I;  2O4H A;  1VQM 1;  1P9N A;  4E32 A;  2K5R A;  1YJ9 Z;  3OW2 Z;  3CD6 1;  4MD9 A;  3GTO I;  1Q7Y 2;  4A93 I;  4A3M I;  3CC4 Z;  1QYP A;  4MD8 A;  1USP A;  1VQ5 1;  1Q7Y 1;  2NVQ I;  1NJI 2;  1Z03 A;  4RVD A;  1NJI 1;  4DQY B;  2YAD A;  2R7Z I;  3S17 I;  4X6A I;  2W04 A;  1VQN 1;  3RZD I;  3HOZ I;  3EER A;  3S1N I;  5FLM I;  2QEX Z;  1WCM I;  3CXC Y;  2F4M A;  1YI2 Z;  3K7A I;  1DL6 A;  4MON A;  4NH1 C;  2V8J A;  2P28 A;  2G2K A;  1K8A 2;  1VQM Z;  3S2H I;  1RNI A;  3CD6 Z;  3NFZ A;  4A3C I;  3NH5 A;  1VQ5 Z;  2KI7 B;  3GKQ A;  2VUG A;  3JAM b;  3CMA 1;  3I4M I;  2KPI A;  1VQ8 1;  1VQN Z;  3MZK B;  1K73 2;  1Y1W I;  3G6E 1;  2VF1 A;  1K73 1;  5IT9 f;  1K83 I;  4HGZ A;  4NBH A;  3S1M I;  3NH8 A;  1JWH C;  5FLX b;  2B63 I;  3TDH B;  1N2F A;  1ZB9 A;  4Y7N I;  2RIQ A;  3I56 1;  1KQS Z;  1RO0 A;  3D9X A;  3Q87 A;  2E9H A;  2QRE B;  3CC2 1;  2JS4 A;  3EED A;  3CCQ 1;  1TWG I;  2F4O A;  4MRI A;  3CMA Z;  3VTN A;  4NB8 A;  5D1O A;  3CCV 1;  3FQM A;  1VQ8 Z;  1ZB8 A;  4HGY A;  3CCR 1;  1SFO I;  4MXU A;  5C44 I;  3HOX I;  3PO2 I;  3I07 A;  3CCM 1;  2QKD A;  3G6E Z;  2M48 A;  1VQL 1;  2JNY A;  1QVF Y;  1TWC I;  4CL1 A;  2NVT I;  2W03 A;  2JA5 I;  3TE5 B;  1RLY A;  5FLX f;  3I56 Z;  3IX0 A;  1JJ2 Y;  4BBR I;  4NBD A;  3IFU A;  4DGL A;  2GU2 A;  1L1O C;  4E33 A;  4DK1 A;  3CC2 Z;  3CCE 1;  2V8I A;  3KIF A;  3CCQ Z;  3CC7 1;  2QRD B;  1KD1 2;  2DE7 A;  3CCV Z;  1YJW Z;  1KD1 1;  3CCR Z;  2JA6 I;  4RVG A;  5C4J I;  1YHQ 1;  1RO4 A;  3CCM Z;  4QTU A;  1VQL Z;  2QRC B;  2Y0S A;  2DE5 A;  1N8R 2;  4HH4 A;  2IZ3 A;  1RQF A;  1N8R 1;  3FQQ A;  1VQ9 1;  1USP B;  3HKZ A;  1Q86 2;  5C4X I;  1Q86 1;  3CCL 1;  3VB9 A;  2WB1 A;  2HF1 A;  1Y1V S;  2R93 I;  2ZAE B;  3G4S Z;  4A3D I;  3VMH A;  3CCE Z;  2H85 A;  1W2B Y;  1S72 Z;  4Y52 I;  3MON A;  3ESW A;  3CCJ 1;  3F3P C;  3CC7 Z;  1K8A 1;  3H3V J;  2NVY I;  1YHQ Z;  2NVX I;  5IP9 I;  1VLA A;  2OTL 1;  1WW9 A;  3I4N I;  4NBC A;  2V8K A;  2WAQ A;  1YUK A;  2GTI A;  3CPW Y;  3BG1 B;  4S1T A;  1VQ9 Z;  2E2J I;  5AN9 F;  2YU9 I;  3MZL B;  3H0G I;  3CCL Z;  3S2D I;  1TWH I;  1QVF Z;  4XX2 A;  2K3R A;  3D6W A;  2J6A A;  1Y1V I;  3T4N B;  4NB9 A;  4NBA A;  3NDI A;  2QA4 1;  2R92 I;  3CCU 1;  1QVG Y;  1TWA I;  1S7M A;  3CCJ Z;  5T67 A;  1Q82 2;  2OOX B;  1Q82 1;  3U50 C;  1Z02 A;  3GTM S;  2HU9 A;  2OTL Z;  3CQZ I;  4MH4 A;  3HOV I;  1I50 I;  2JA7 I;  3JAM f;  2OTJ Z;  3IF8 A;  4QTT A;  1QF8 A;  3J80 b;  1YJW 1;  2RBL A;  2R6M A;  4EWC A;  2PMZ A;  5IP7 I;  3S16 I;  1Q81 2;  4RS4 A;  1X0T A;  1Q81 1;  4A3G I;  1TFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...