4A3FI

Rna polymerase ii initial transcribing complex with a 6nt dna-rna hybrid and soaked with ampcpp
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 14
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3fI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3fI02
3U50C 4A93I 3GTPI 4NBGA 3CQZI 5C4JI 4BBRI 4NBEA 3I4MI 5C4XI 4Y52I 5C44I 1X3ZA 1TWHI 2JA5I 4XX2A 1DL6A 1VLAA 1YUAA 4A3MI 3GTKI 3S16I 3VMHA 3VB9A 5C3EI 1RO4A 4MH4A 2JA6I 3VMGA 2NVTI 3GCFA 1SFOI 1X3WA 3S2HI 3RZOI 1TFIA 4A3EI 2DE5A 3GTLI 3S2DI 1TWAI 4A3LI 3ESWA 1I50I 2E2JI 2E2II 1NUIA 2JA8I 3HOYI 4Y7NI 1TWCI 2RBLA 4BBSI 2JR6A 1WW9A 3PO2I 4BY7I 4A3JI 2KPIA 2DE6A 3S1RI 2P3YA 3HOUI 2F4MA 2AKLA 3EERA 1ML8A 1I3QI 4NBFA 3PO3S 3H3VJ 4NB9A 2NVQI 2PK7A 3M4OI 4BY1I 3S14I 2BJOA 2R92I 1ZB8A 1PFTA 4A3GI 3K7AI 3VMIA 1L1OC 4NB8A 4NBDA 3HOXI 5CM2M 2J6AA 2R7ZI 3S1MI 1ZB9A 4A3KI 3S17I 4A3II 3H0GI 2E2HI 4NBHA 3GTMS 3GTGI 4NBAA 2F4OA 3S1NI 3Q87A 2VUMI 1TWGI 2NVXI 4QTTA 4X6AI 3S15I 3I4NI 5IP9I 3HOVI 1Y1WI 1K83I 4A3CI 3D6WA 2R93I 1R9TI 1N2FA 2JA7I 3RZDI 3FKII 2NVYI 3I07A 2DE7A 4QTUA 1QYPA 1WCMI 2JS4A 3PO3I 1TWFI 3S1QI 1USPA 2HF1A 5FLMI 3GKQA 2YU9I 1Y1VS 1LQLA 4NBBA 2JNYA 3HOWI 3M3YI 3GTJI 3GTQI 1I6HI 2B63I 3LUSA 1USPB 2K5RA 4A3DI 5IP7I 4BXXI 3GTOI 4A3FI 3HOZI 1Y1VI 3GTMI 4A3BI 1RLYA 4NOZA 4NBCA
chains in the Genus database with same CATH superfamily
3CQZI 4BBRI 3JAMb 5C4XI 3T4NB 5LL6f 1VQLZ 3GTKI 1Z02A 1M1K1 3VMHA 4HGYA 1RO4A 4DK1A 1QVFZ 3CME1 3BG0B 3G711 1VQ6Z 3J80b 4MRIA 2QKDA 2VPZA 3GTLI 1TWAI 1I50I 1S7MA 1RO0A 4RV9A 1NUIA 3HOYI 4S1TA 2VPXA 2RBLA 1W2BZ 1YJN1 1N8R1 3TE5B 3PO2I 2WB1A 2DE6A 2IZ3A 3HOUI 3EEDA 1ML8A 3CXCY 1Q862 2NAPA 2KI7B 1YITZ 1ZB8A 4HH4A 3VMIA 1L1OC 2Q51A 4EWCA 1FDIA 4DQYB 3CMA1 1QVGY 5CM2M 2J6AA 1KQSY 1VQO1 2WAQA 3GTMS 3CCMZ 3S1NI 5T67A 5IT9f 4E31A 1VQN1 3S15I 1AA6A 1VQ9Z 2QEXZ 2K3RA 3D6WA 3D9XA 4MD9A 3RZDI 1QF8A 2NVYI 2RPRA 2DE7A 2OOYB 2ZAEB 3PO3I 1WZNA 3P5JB 3S1QI 2OZKA 1USPA 3GKQA 2YU9I 3FQMA 3M3YI 2W04A 3GTJI 3GTQI 5IT9b 5FLXb 1VQM1 4MD7A 1S72Z 5IP7I 3NH4A 3GTOI 4A3FI 4NH1C 3KIFA 5D1OA 3CCR1 3NH8A 1WJ2A 2E7ZA 1RLYA 1Q16A 5C44I 1TWHI 2JA5I 1DL6A 2IV2X 1YUAA 2M48A 3CPWY 4RVFA 1VQ7Z 5C3EI 3VB9A 3QWUA 3I56Z 1YJW1 2OTJ1 4RS4A 3CD61 3F3PC 1X3WA 1K8A1 3NH5A 1TFIA 4A3EI 2AYDA 1VQPZ 1YI2Z 2DE5A 1YIJZ 3CC4Z 4E2WA 2E2JI 1Q811 2H85A 3CCU1 2JA8I 1KD12 2OOXB 3NDIA 1K732 4NBFA 4NB9A 2NVQI 4BY1I 3S14I 2BJOA 3J81f 2RIQA 3G6E1 4RVHA 3TDHB 4TNUA 3CXCZ 4E2XA 2QREB 3S17I 3CCQZ 4A3II 1VQ4Z 4E30A 1VQ81 1TWGI 1QVGZ 2NVXI 3CCV1 4QTTA 1VQ5Z 4X6AI 3J81b 1KQSZ 1VQNZ 2OTLZ 3CCJ1 2GU2A 1Y1WI 2YADA 1RNIA 5AN9F 1QVFY 1P9NA 4QTUA 4RVDA 1WCMI 1X0TA 1N8R2 4AYBA 1VQL1 5FLMI 2JIPA 2LIYA 1Y1VS 4NBBA 2JNYA 3D2LA 1ZH1A 1VQ61 5T6BA 1W2BY 4E2YA 2B63I 3LUSA 1USPB 1VQMZ 2PMZA 1YHQZ 3CCEZ 1K9M1 2GTIA 1Q822 3IFUA 3MONA 1Y1VI 3GTMI 3OW2Y 4A3BI 3G4S1 3KIHA 4A93I 4NBGA 2QRDB 4NBEA 3I4MI 4Y52I 1X3ZA 5D1OB 3CC2Z 3S16I 5T64A 2QA41 2P28A 1YIT1 2JA6I 3VMGA 2NVTI 3I55Z 3MZKB 1SFOI 3RZOI 3CD6Z 2EGTA 2G2KA 3IX0A 3ESWA 5D1PA 3CC7Z 3CCSZ 2E2II 1VQKZ 1TWCI 2JR6A 1JJ2Y 1WW9A 4A3JI 2KPIA 2P3YA 2V3VA 2AKLA 2HU9A 2JIOA 3EERA 2QLVB 1RQFA 1Q7Y2 3H3VJ 1M902 1VQ91 3M4OI 2QEX1 3CCL1 2RHBA 1JWHC 2R92I 3CMEZ 3G71Z 1PFTA 4E32A 3K7AI 2Q4ZA 2Y0SA 3VTNA 1KD11 1KC82 1NJI2 2IZ4A 3H0GI 1YJNZ 1KRLA 4NFRA 1K731 1YJ91 1Z03A 3Q87A 2VUMI 1S721 1K8A2 2PM9A 3HOVI 2I3CA 1K83I 4A3CI 3IF8A 2R93I 1N2FA 2JA7I 2W03A 3I07A 2JMOA 4CL1A 3CMAZ 2JS4A 1TWFI 4MXUA 1VQ71 1NP6A 2JUBA 3I561 2JIMA 2HF1A 1YUKA 4E2ZA 1M1K2 1VQOZ 2O53A 2V8KA 1VQP1 1YI21 1Q861 2K5RA 1SIWA 2GTHA 3FQQA 1YIJ1 4RVGA 3CC41 4BXXI 3J7A4 4DGLA 1FDOA 2VPYA 2JIQA 4NOZA 4NBCA 1WIIA 3U50C 3G4SZ 3GTPI 5C4JI 3IR7A 2LEXA 4XX2A 1VLAA 2VF1A 4A3MI 2VPWA 4MH4A 3OW2Z 3BG1B 2QA4Z 3GCFA 3S2HI 2QRCB 2V45A 3S2DI 1Q821 4A3LI 3CCQ1 1VQ41 2R6MA 3CCRZ 4Y7NI 4BBSI 1Z01A 4BY7I 3S1RI 2F4MA 1Y8CA 5FLXf 1VQ51 1I3QI 3PO3S 3F3FC 2OTL1 2PK7A 1YJWZ 2OTJZ 1K9M2 3CCLZ 5A2Qf 1JJ2Z 2V8JA 4A3GI 4NB8A 3CPWZ 1QXFA 2V8IA 4NBDA 3HOXI 2R7ZI 3S1MI 1ZB9A 1RO2A 4A3KI 3CCUZ 2E2HI 4NBHA 3CCM1 3GTGI 4NBAA 2F4OA 2LFUA 2QR1B 2M6NA 1YHQ1 1Q7Y1 1YJ9Z 4MD8A 1M901 3CCE1 3MZLB 3I4NI 5IP9I 5A2Qb 2O4HA 1R9TI 3G6EZ 2RT9A 3FKII 2VUGA 1QYPA 3NDJA 3JAMf 1KC81 4E33A 1NJI1 3CC21 3NFZA 1LQLA 2E9HA 3I551 3HOWI 4MONA 2JIRA 1I6HI 4HGZA 1VQ8Z 3J80f 3CCVZ 4A3DI 3HOZI 3CC71 3CCS1 1VQK1 3CCJZ 3HKZA 1Q812
chains in the Genus database with same CATH topology
3CQZI 4BBRI 3JAMb 5C4XI 3T4NB 5LL6f 1VQLZ 3GTKI 1Z02A 1M1K1 3VMHA 4HGYA 1RO4A 4DK1A 1QVFZ 3CME1 3BG0B 3G711 1VQ6Z 3J80b 4MRIA 2QKDA 3GTLI 1TWAI 1I50I 1S7MA 1RO0A 4RV9A 1NUIA 3HOYI 4S1TA 2RBLA 1W2BZ 1YJN1 1N8R1 3TE5B 3PO2I 2WB1A 2DE6A 2IZ3A 3HOUI 3EEDA 1ML8A 3CXCY 1Q862 2KI7B 1YITZ 1ZB8A 4HH4A 3VMIA 1L1OC 2Q51A 4EWCA 4DQYB 3CMA1 1QVGY 5CM2M 2J6AA 1KQSY 1VQO1 2WAQA 3GTMS 3CCMZ 3S1NI 5T67A 5IT9f 4E31A 1VQN1 3S15I 1VQ9Z 2QEXZ 2K3RA 3D6WA 3D9XA 4MD9A 3RZDI 1QF8A 2NVYI 2RPRA 2DE7A 2OOYB 2ZAEB 3PO3I 3P5JB 3S1QI 2OZKA 1USPA 3GKQA 2YU9I 3FQMA 3M3YI 2W04A 3GTJI 3GTQI 5IT9b 5FLXb 1VQM1 4MD7A 1S72Z 5IP7I 3NH4A 3GTOI 4A3FI 4NH1C 3KIFA 5D1OA 3CCR1 3NH8A 1RLYA 5C44I 1TWHI 2JA5I 1DL6A 1YUAA 2M48A 3CPWY 4RVFA 1VQ7Z 5C3EI 3VB9A 3QWUA 3I56Z 1YJW1 2OTJ1 4RS4A 3CD61 3F3PC 1X3WA 1K8A1 3NH5A 1TFIA 4A3EI 1VQPZ 1YI2Z 2DE5A 1YIJZ 3CC4Z 4E2WA 2E2JI 1Q811 2H85A 3CCU1 2JA8I 1KD12 2OOXB 3NDIA 1K732 4NBFA 4NB9A 2NVQI 4BY1I 3S14I 2BJOA 3J81f 2RIQA 3G6E1 4RVHA 3TDHB 4TNUA 3CXCZ 4E2XA 2QREB 3S17I 3CCQZ 4A3II 1VQ4Z 4E30A 1VQ81 1TWGI 1QVGZ 2NVXI 3CCV1 4QTTA 1VQ5Z 4X6AI 3J81b 1KQSZ 1VQNZ 2OTLZ 3CCJ1 2GU2A 1Y1WI 2YADA 1RNIA 5AN9F 1QVFY 1P9NA 4QTUA 4RVDA 1WCMI 1X0TA 1N8R2 4AYBA 1VQL1 5FLMI 2LIYA 1Y1VS 4NBBA 2JNYA 1ZH1A 1VQ61 5T6BA 1W2BY 4E2YA 2B63I 3LUSA 1USPB 1VQMZ 2PMZA 1YHQZ 3CCEZ 1K9M1 2GTIA 1Q822 3IFUA 3MONA 1Y1VI 3GTMI 3OW2Y 4A3BI 3G4S1 3KIHA 4A93I 4NBGA 2QRDB 4NBEA 3I4MI 4Y52I 1X3ZA 5D1OB 3CC2Z 3S16I 5T64A 2QA41 2P28A 1YIT1 2JA6I 3VMGA 2NVTI 3I55Z 3MZKB 1SFOI 3RZOI 3CD6Z 2EGTA 2G2KA 3IX0A 3ESWA 5D1PA 3CC7Z 3CCSZ 2E2II 1VQKZ 1TWCI 2JR6A 1JJ2Y 1WW9A 4A3JI 2KPIA 2P3YA 2AKLA 2HU9A 3EERA 2QLVB 1RQFA 1Q7Y2 3H3VJ 1M902 1VQ91 3M4OI 2QEX1 3CCL1 2RHBA 1JWHC 2R92I 3CMEZ 3G71Z 1PFTA 4E32A 3K7AI 2Q4ZA 2Y0SA 3VTNA 1KD11 1KC82 1NJI2 2IZ4A 3H0GI 1YJNZ 1KRLA 4NFRA 1K731 1YJ91 1Z03A 3Q87A 2VUMI 1S721 1K8A2 2PM9A 3HOVI 2I3CA 1K83I 4A3CI 3IF8A 2R93I 1N2FA 2JA7I 2W03A 3I07A 2JMOA 4CL1A 3CMAZ 2JS4A 1TWFI 4MXUA 1VQ71 1NP6A 2JUBA 3I561 2HF1A 1YUKA 4E2ZA 1M1K2 1VQOZ 2O53A 2V8KA 1VQP1 1YI21 1Q861 2K5RA 2GTHA 3FQQA 1YIJ1 4RVGA 3CC41 4BXXI 3J7A4 4DGLA 4NOZA 4NBCA 1WIIA 3U50C 3G4SZ 3GTPI 5C4JI 4XX2A 1VLAA 2VF1A 4A3MI 4MH4A 3OW2Z 3BG1B 2QA4Z 3GCFA 3S2HI 2QRCB 3S2DI 1Q821 4A3LI 3CCQ1 1VQ41 2R6MA 3CCRZ 4Y7NI 4BBSI 1Z01A 4BY7I 3S1RI 2F4MA 5FLXf 1VQ51 1I3QI 3PO3S 3F3FC 2OTL1 2PK7A 1YJWZ 2OTJZ 1K9M2 3CCLZ 5A2Qf 1JJ2Z 2V8JA 4A3GI 4NB8A 3CPWZ 2V8IA 4NBDA 3HOXI 2R7ZI 3S1MI 1ZB9A 1RO2A 4A3KI 3CCUZ 2E2HI 4NBHA 3CCM1 3GTGI 4NBAA 2F4OA 2LFUA 2QR1B 2M6NA 1YHQ1 1Q7Y1 1YJ9Z 4MD8A 1M901 3CCE1 3MZLB 3I4NI 5IP9I 5A2Qb 2O4HA 1R9TI 3G6EZ 2RT9A 3FKII 2VUGA 1QYPA 3NDJA 3JAMf 1KC81 4E33A 1NJI1 3CC21 3NFZA 1LQLA 2E9HA 3I551 3HOWI 4MONA 1I6HI 4HGZA 1VQ8Z 3J80f 3CCVZ 4A3DI 3HOZI 3CC71 3CCS1 1VQK1 3CCJZ 3HKZA 1Q812
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U50 C;  4A93 I;  3GTP I;  4NBG A;  3CQZ I;  5C4J I;  4BBR I;  4NBE A;  3I4M I;  5C4X I;  4Y52 I;  5C44 I;  1X3Z A;  1TWH I;  2JA5 I;  4XX2 A;  1DL6 A;  1VLA A;  1YUA A;  4A3M I;  3GTK I;  3S16 I;  3VMH A;  3VB9 A;  5C3E I;  1RO4 A;  4MH4 A;  2JA6 I;  3VMG A;  2NVT I;  3GCF A;  1SFO I;  1X3W A;  3S2H I;  3RZO I;  1TFI A;  4A3E I;  2DE5 A;  3GTL I;  3S2D I;  1TWA I;  4A3L I;  3ESW A;  1I50 I;  2E2J I;  2E2I I;  1NUI A;  2JA8 I;  3HOY I;  4Y7N I;  1TWC I;  2RBL A;  4BBS I;  2JR6 A;  1WW9 A;  3PO2 I;  4BY7 I;  4A3J I;  2KPI A;  2DE6 A;  3S1R I;  2P3Y A;  3HOU I;  2F4M A;  2AKL A;  3EER A;  1ML8 A;  1I3Q I;  4NBF A;  3PO3 S;  3H3V J;  4NB9 A;  2NVQ I;  2PK7 A;  3M4O I;  4BY1 I;  3S14 I;  2BJO A;  2R92 I;  1ZB8 A;  1PFT A;  4A3G I;  3K7A I;  3VMI A;  1L1O C;  4NB8 A;  4NBD A;  3HOX I;  5CM2 M;  2J6A A;  2R7Z I;  3S1M I;  1ZB9 A;  4A3K I;  3S17 I;  4A3I I;  3H0G I;  2E2H I;  4NBH A;  3GTM S;  3GTG I;  4NBA A;  2F4O A;  3S1N I;  3Q87 A;  2VUM I;  1TWG I;  2NVX I;  4QTT A;  4X6A I;  3S15 I;  3I4N I;  5IP9 I;  3HOV I;  1Y1W I;  1K83 I;  4A3C I;  3D6W A;  2R93 I;  1R9T I;  1N2F A;  2JA7 I;  3RZD I;  3FKI I;  2NVY I;  3I07 A;  2DE7 A;  4QTU A;  1QYP A;  1WCM I;  2JS4 A;  3PO3 I;  1TWF I;  3S1Q I;  1USP A;  2HF1 A;  5FLM I;  3GKQ A;  2YU9 I;  1Y1V S;  1LQL A;  4NBB A;  2JNY A;  3HOW I;  3M3Y I;  3GTJ I;  3GTQ I;  1I6H I;  2B63 I;  3LUS A;  1USP B;  2K5R A;  4A3D I;  5IP7 I;  4BXX I;  3GTO I;  4A3F I;  3HOZ I;  1Y1V I;  3GTM I;  4A3B I;  1RLY A;  4NOZ A;  4NBC A; 
#chains in the Genus database with same CATH topology
 3CQZ I;  4BBR I;  3JAM b;  5C4X I;  3T4N B;  5LL6 f;  1VQL Z;  3GTK I;  1Z02 A;  1M1K 1;  3VMH A;  4HGY A;  1RO4 A;  4DK1 A;  1QVF Z;  3CME 1;  3BG0 B;  3G71 1;  1VQ6 Z;  3J80 b;  4MRI A;  2QKD A;  2VPZ A;  3GTL I;  1TWA I;  1I50 I;  1S7M A;  1RO0 A;  4RV9 A;  1NUI A;  3HOY I;  4S1T A;  2VPX A;  2RBL A;  1W2B Z;  1YJN 1;  1N8R 1;  3TE5 B;  3PO2 I;  2WB1 A;  2DE6 A;  2IZ3 A;  3HOU I;  3EED A;  1ML8 A;  3CXC Y;  1Q86 2;  2NAP A;  2KI7 B;  1YIT Z;  1ZB8 A;  4HH4 A;  3VMI A;  1L1O C;  2Q51 A;  4EWC A;  1FDI A;  4DQY B;  3CMA 1;  1QVG Y;  5CM2 M;  2J6A A;  1KQS Y;  1VQO 1;  2WAQ A;  3GTM S;  3CCM Z;  3S1N I;  5T67 A;  5IT9 f;  4E31 A;  1VQN 1;  3S15 I;  1AA6 A;  1VQ9 Z;  2QEX Z;  2K3R A;  3D6W A;  3D9X A;  4MD9 A;  3RZD I;  1QF8 A;  2NVY I;  2RPR A;  2DE7 A;  2OOY B;  2ZAE B;  3PO3 I;  1WZN A;  3P5J B;  3S1Q I;  2OZK A;  1USP A;  3GKQ A;  2YU9 I;  3FQM A;  3M3Y I;  2W04 A;  3GTJ I;  3GTQ I;  5IT9 b;  5FLX b;  1VQM 1;  4MD7 A;  1S72 Z;  5IP7 I;  3NH4 A;  3GTO I;  4A3F I;  4NH1 C;  3KIF A;  5D1O A;  3CCR 1;  3NH8 A;  1WJ2 A;  2E7Z A;  1RLY A;  1Q16 A;  5C44 I;  1TWH I;  2JA5 I;  1DL6 A;  2IV2 X;  1YUA A;  2M48 A;  3CPW Y;  4RVF A;  1VQ7 Z;  5C3E I;  3VB9 A;  3QWU A;  3I56 Z;  1YJW 1;  2OTJ 1;  4RS4 A;  3CD6 1;  3F3P C;  1X3W A;  1K8A 1;  3NH5 A;  1TFI A;  4A3E I;  2AYD A;  1VQP Z;  1YI2 Z;  2DE5 A;  1YIJ Z;  3CC4 Z;  4E2W A;  2E2J I;  1Q81 1;  2H85 A;  3CCU 1;  2JA8 I;  1KD1 2;  2OOX B;  3NDI A;  1K73 2;  4NBF A;  4NB9 A;  2NVQ I;  4BY1 I;  3S14 I;  2BJO A;  3J81 f;  2RIQ A;  3G6E 1;  4RVH A;  3TDH B;  4TNU A;  3CXC Z;  4E2X A;  2QRE B;  3S17 I;  3CCQ Z;  4A3I I;  1VQ4 Z;  4E30 A;  1VQ8 1;  1TWG I;  1QVG Z;  2NVX I;  3CCV 1;  4QTT A;  1VQ5 Z;  4X6A I;  3J81 b;  1KQS Z;  1VQN Z;  2OTL Z;  3CCJ 1;  2GU2 A;  1Y1W I;  2YAD A;  1RNI A;  5AN9 F;  1QVF Y;  1P9N A;  4QTU A;  4RVD A;  1WCM I;  1X0T A;  1N8R 2;  4AYB A;  1VQL 1;  5FLM I;  2JIP A;  2LIY A;  1Y1V S;  4NBB A;  2JNY A;  3D2L A;  1ZH1 A;  1VQ6 1;  5T6B A;  1W2B Y;  4E2Y A;  2B63 I;  3LUS A;  1USP B;  1VQM Z;  2PMZ A;  1YHQ Z;  3CCE Z;  1K9M 1;  2GTI A;  1Q82 2;  3IFU A;  3MON A;  1Y1V I;  3GTM I;  3OW2 Y;  4A3B I;  3G4S 1;  3KIH A;  4A93 I;  4NBG A;  2QRD B;  4NBE A;  3I4M I;  4Y52 I;  1X3Z A;  5D1O B;  3CC2 Z;  3S16 I;  5T64 A;  2QA4 1;  2P28 A;  1YIT 1;  2JA6 I;  3VMG A;  2NVT I;  3I55 Z;  3MZK B;  1SFO I;  3RZO I;  3CD6 Z;  2EGT A;  2G2K A;  3IX0 A;  3ESW A;  5D1P A;  3CC7 Z;  3CCS Z;  2E2I I;  1VQK Z;  1TWC I;  2JR6 A;  1JJ2 Y;  1WW9 A;  4A3J I;  2KPI A;  2P3Y A;  2V3V A;  2AKL A;  2HU9 A;  2JIO A;  3EER A;  2QLV B;  1RQF A;  1Q7Y 2;  3H3V J;  1M90 2;  1VQ9 1;  3M4O I;  2QEX 1;  3CCL 1;  2RHB A;  1JWH C;  2R92 I;  3CME Z;  3G71 Z;  1PFT A;  4E32 A;  3K7A I;  2Q4Z A;  2Y0S A;  3VTN A;  1KD1 1;  1KC8 2;  1NJI 2;  2IZ4 A;  3H0G I;  1YJN Z;  1KRL A;  4NFR A;  1K73 1;  1YJ9 1;  1Z03 A;  3Q87 A;  2VUM I;  1S72 1;  1K8A 2;  2PM9 A;  3HOV I;  2I3C A;  1K83 I;  4A3C I;  3IF8 A;  2R93 I;  1N2F A;  2JA7 I;  2W03 A;  3I07 A;  2JMO A;  4CL1 A;  3CMA Z;  2JS4 A;  1TWF I;  4MXU A;  1VQ7 1;  1NP6 A;  2JUB A;  3I56 1;  2JIM A;  2HF1 A;  1YUK A;  4E2Z A;  1M1K 2;  1VQO Z;  2O53 A;  2V8K A;  1VQP 1;  1YI2 1;  1Q86 1;  2K5R A;  1SIW A;  2GTH A;  3FQQ A;  1YIJ 1;  4RVG A;  3CC4 1;  4BXX I;  3J7A 4;  4DGL A;  1FDO A;  2VPY A;  2JIQ A;  4NOZ A;  4NBC A;  1WII A;  3U50 C;  3G4S Z;  3GTP I;  5C4J I;  3IR7 A;  2LEX A;  4XX2 A;  1VLA A;  2VF1 A;  4A3M I;  2VPW A;  4MH4 A;  3OW2 Z;  3BG1 B;  2QA4 Z;  3GCF A;  3S2H I;  2QRC B;  2V45 A;  3S2D I;  1Q82 1;  4A3L I;  3CCQ 1;  1VQ4 1;  2R6M A;  3CCR Z;  4Y7N I;  4BBS I;  1Z01 A;  4BY7 I;  3S1R I;  2F4M A;  1Y8C A;  5FLX f;  1VQ5 1;  1I3Q I;  3PO3 S;  3F3F C;  2OTL 1;  2PK7 A;  1YJW Z;  2OTJ Z;  1K9M 2;  3CCL Z;  5A2Q f;  1JJ2 Z;  2V8J A;  4A3G I;  4NB8 A;  3CPW Z;  1QXF A;  2V8I A;  4NBD A;  3HOX I;  2R7Z I;  3S1M I;  1ZB9 A;  1RO2 A;  4A3K I;  3CCU Z;  2E2H I;  4NBH A;  3CCM 1;  3GTG I;  4NBA A;  2F4O A;  2LFU A;  2QR1 B;  2M6N A;  1YHQ 1;  1Q7Y 1;  1YJ9 Z;  4MD8 A;  1M90 1;  3CCE 1;  3MZL B;  3I4N I;  5IP9 I;  5A2Q b;  2O4H A;  1R9T I;  3G6E Z;  2RT9 A;  3FKI I;  2VUG A;  1QYP A;  3NDJ A;  3JAM f;  1KC8 1;  4E33 A;  1NJI 1;  3CC2 1;  3NFZ A;  1LQL A;  2E9H A;  3I55 1;  3HOW I;  4MON A;  2JIR A;  1I6H I;  4HGZ A;  1VQ8 Z;  3J80 f;  3CCV Z;  4A3D I;  3HOZ I;  3CC7 1;  3CCS 1;  1VQK 1;  3CCJ Z;  3HKZ A;  1Q81 2; 
#chains in the Genus database with same CATH homology
 3CQZ I;  4BBR I;  3JAM b;  5C4X I;  3T4N B;  5LL6 f;  1VQL Z;  3GTK I;  1Z02 A;  1M1K 1;  3VMH A;  4HGY A;  1RO4 A;  4DK1 A;  1QVF Z;  3CME 1;  3BG0 B;  3G71 1;  1VQ6 Z;  3J80 b;  4MRI A;  2QKD A;  3GTL I;  1TWA I;  1I50 I;  1S7M A;  1RO0 A;  4RV9 A;  1NUI A;  3HOY I;  4S1T A;  2RBL A;  1W2B Z;  1YJN 1;  1N8R 1;  3TE5 B;  3PO2 I;  2WB1 A;  2DE6 A;  2IZ3 A;  3HOU I;  3EED A;  1ML8 A;  3CXC Y;  1Q86 2;  2KI7 B;  1YIT Z;  1ZB8 A;  4HH4 A;  3VMI A;  1L1O C;  2Q51 A;  4EWC A;  4DQY B;  3CMA 1;  1QVG Y;  5CM2 M;  2J6A A;  1KQS Y;  1VQO 1;  2WAQ A;  3GTM S;  3CCM Z;  3S1N I;  5T67 A;  5IT9 f;  4E31 A;  1VQN 1;  3S15 I;  1VQ9 Z;  2QEX Z;  2K3R A;  3D6W A;  3D9X A;  4MD9 A;  3RZD I;  1QF8 A;  2NVY I;  2RPR A;  2DE7 A;  2OOY B;  2ZAE B;  3PO3 I;  3P5J B;  3S1Q I;  2OZK A;  1USP A;  3GKQ A;  2YU9 I;  3FQM A;  3M3Y I;  2W04 A;  3GTJ I;  3GTQ I;  5IT9 b;  5FLX b;  1VQM 1;  4MD7 A;  1S72 Z;  5IP7 I;  3NH4 A;  3GTO I;  4A3F I;  4NH1 C;  3KIF A;  5D1O A;  3CCR 1;  3NH8 A;  1RLY A;  5C44 I;  1TWH I;  2JA5 I;  1DL6 A;  1YUA A;  2M48 A;  3CPW Y;  4RVF A;  1VQ7 Z;  5C3E I;  3VB9 A;  3QWU A;  3I56 Z;  1YJW 1;  2OTJ 1;  4RS4 A;  3CD6 1;  3F3P C;  1X3W A;  1K8A 1;  3NH5 A;  1TFI A;  4A3E I;  1VQP Z;  1YI2 Z;  2DE5 A;  1YIJ Z;  3CC4 Z;  4E2W A;  2E2J I;  1Q81 1;  2H85 A;  3CCU 1;  2JA8 I;  1KD1 2;  2OOX B;  3NDI A;  1K73 2;  4NBF A;  4NB9 A;  2NVQ I;  4BY1 I;  3S14 I;  2BJO A;  3J81 f;  2RIQ A;  3G6E 1;  4RVH A;  3TDH B;  4TNU A;  3CXC Z;  4E2X A;  2QRE B;  3S17 I;  3CCQ Z;  4A3I I;  1VQ4 Z;  4E30 A;  1VQ8 1;  1TWG I;  1QVG Z;  2NVX I;  3CCV 1;  4QTT A;  1VQ5 Z;  4X6A I;  3J81 b;  1KQS Z;  1VQN Z;  2OTL Z;  3CCJ 1;  2GU2 A;  1Y1W I;  2YAD A;  1RNI A;  5AN9 F;  1QVF Y;  1P9N A;  4QTU A;  4RVD A;  1WCM I;  1X0T A;  1N8R 2;  4AYB A;  1VQL 1;  5FLM I;  2LIY A;  1Y1V S;  4NBB A;  2JNY A;  1ZH1 A;  1VQ6 1;  5T6B A;  1W2B Y;  4E2Y A;  2B63 I;  3LUS A;  1USP B;  1VQM Z;  2PMZ A;  1YHQ Z;  3CCE Z;  1K9M 1;  2GTI A;  1Q82 2;  3IFU A;  3MON A;  1Y1V I;  3GTM I;  3OW2 Y;  4A3B I;  3G4S 1;  3KIH A;  4A93 I;  4NBG A;  2QRD B;  4NBE A;  3I4M I;  4Y52 I;  1X3Z A;  5D1O B;  3CC2 Z;  3S16 I;  5T64 A;  2QA4 1;  2P28 A;  1YIT 1;  2JA6 I;  3VMG A;  2NVT I;  3I55 Z;  3MZK B;  1SFO I;  3RZO I;  3CD6 Z;  2EGT A;  2G2K A;  3IX0 A;  3ESW A;  5D1P A;  3CC7 Z;  3CCS Z;  2E2I I;  1VQK Z;  1TWC I;  2JR6 A;  1JJ2 Y;  1WW9 A;  4A3J I;  2KPI A;  2P3Y A;  2AKL A;  2HU9 A;  3EER A;  2QLV B;  1RQF A;  1Q7Y 2;  3H3V J;  1M90 2;  1VQ9 1;  3M4O I;  2QEX 1;  3CCL 1;  2RHB A;  1JWH C;  2R92 I;  3CME Z;  3G71 Z;  1PFT A;  4E32 A;  3K7A I;  2Q4Z A;  2Y0S A;  3VTN A;  1KD1 1;  1KC8 2;  1NJI 2;  2IZ4 A;  3H0G I;  1YJN Z;  1KRL A;  4NFR A;  1K73 1;  1YJ9 1;  1Z03 A;  3Q87 A;  2VUM I;  1S72 1;  1K8A 2;  2PM9 A;  3HOV I;  2I3C A;  1K83 I;  4A3C I;  3IF8 A;  2R93 I;  1N2F A;  2JA7 I;  2W03 A;  3I07 A;  2JMO A;  4CL1 A;  3CMA Z;  2JS4 A;  1TWF I;  4MXU A;  1VQ7 1;  1NP6 A;  2JUB A;  3I56 1;  2HF1 A;  1YUK A;  4E2Z A;  1M1K 2;  1VQO Z;  2O53 A;  2V8K A;  1VQP 1;  1YI2 1;  1Q86 1;  2K5R A;  2GTH A;  3FQQ A;  1YIJ 1;  4RVG A;  3CC4 1;  4BXX I;  3J7A 4;  4DGL A;  4NOZ A;  4NBC A;  1WII A;  3U50 C;  3G4S Z;  3GTP I;  5C4J I;  4XX2 A;  1VLA A;  2VF1 A;  4A3M I;  4MH4 A;  3OW2 Z;  3BG1 B;  2QA4 Z;  3GCF A;  3S2H I;  2QRC B;  3S2D I;  1Q82 1;  4A3L I;  3CCQ 1;  1VQ4 1;  2R6M A;  3CCR Z;  4Y7N I;  4BBS I;  1Z01 A;  4BY7 I;  3S1R I;  2F4M A;  5FLX f;  1VQ5 1;  1I3Q I;  3PO3 S;  3F3F C;  2OTL 1;  2PK7 A;  1YJW Z;  2OTJ Z;  1K9M 2;  3CCL Z;  5A2Q f;  1JJ2 Z;  2V8J A;  4A3G I;  4NB8 A;  3CPW Z;  2V8I A;  4NBD A;  3HOX I;  2R7Z I;  3S1M I;  1ZB9 A;  1RO2 A;  4A3K I;  3CCU Z;  2E2H I;  4NBH A;  3CCM 1;  3GTG I;  4NBA A;  2F4O A;  2LFU A;  2QR1 B;  2M6N A;  1YHQ 1;  1Q7Y 1;  1YJ9 Z;  4MD8 A;  1M90 1;  3CCE 1;  3MZL B;  3I4N I;  5IP9 I;  5A2Q b;  2O4H A;  1R9T I;  3G6E Z;  2RT9 A;  3FKI I;  2VUG A;  1QYP A;  3NDJ A;  3JAM f;  1KC8 1;  4E33 A;  1NJI 1;  3CC2 1;  3NFZ A;  1LQL A;  2E9H A;  3I55 1;  3HOW I;  4MON A;  1I6H I;  4HGZ A;  1VQ8 Z;  3J80 f;  3CCV Z;  4A3D I;  3HOZ I;  3CC7 1;  3CCS 1;  1VQK 1;  3CCJ Z;  3HKZ A;  1Q81 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...