4A3FI

Rna polymerase ii initial transcribing complex with a 6nt dna-rna hybrid and soaked with ampcpp
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
total genus 14
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3fI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3fI02
2KPIA 1Y1VS 1I3QI 3GKQA 4QTUA 3GTMS 3S1MI 4A3KI 2NVYI 3H3VJ 3HOYI 1ZB8A 1PFTA 4A3CI 1TWHI 3GCFA 5IP7I 3M3YI 5CM2M 4BXXI 4NBEA 1VLAA 1WCMI 2DE6A 4A3MI 3M4OI 1ZB9A 4X6AI 3ESWA 4NB8A 3GTPI 1I50I 3K7AI 4A3EI 2NVQI 3HOVI 3VMHA 3VMGA 4A3JI 4A3FI 2JA6I 1SFOI 3PO2I 1L1OC 4NB9A 3S16I 3H0GI 4XX2A 4BBRI 2B63I 4A93I 2K5RA 3RZOI 2PK7A 3U50C 4NBAA 2J6AA 5FLMI 3CQZI 2R92I 4NOZA 1RO4A 1R9TI 1QYPA 2F4OA 1K83I 1TFIA 3FKII 1Y1WI 2YU9I 3GTKI 3VMIA 1N2FA 3S14I 1DL6A 4A3II 4BY7I 5C44I 2JA7I 3I07A 1USPB 3GTGI 1YUAA 2R7ZI 2RBLA 4NBCA 1ML8A 1X3WA 4A3GI 5C3EI 2JR6A 3GTLI 2DE7A 3S15I 3HOXI 3RZDI 2E2JI 1LQLA 4NBFA 2NVXI 4BY1I 1NUIA 3GTJI 4NBBA 3GTOI 3PO3I 2F4MA 3S1QI 1TWFI 4NBHA 5IP9I 3D6WA 2E2II 3HOZI 1TWAI 2E2HI 3PO3S 3EERA 4Y7NI 4NBDA 2JNYA 1RLYA 4A3LI 5C4JI 2JS4A 2P3YA 3I4MI 3GTQI 3I4NI 2JA8I 3S2DI 4A3DI 3S1NI 3HOUI 2JA5I 4NBGA 3HOWI 1I6HI 2R93I 3Q87A 1USPA 4BBSI 3S2HI 1X3ZA 3LUSA 4MH4A 3VB9A 2HF1A 3S1RI 4QTTA 3S17I 2NVTI 1WW9A 2VUMI 2DE5A 1Y1VI 5C4XI 2BJOA 1TWCI 4Y52I 2AKLA 3GTMI 4A3BI 1TWGI
chains in the Genus database with same CATH superfamily
2VUGA 2IZ4A 1I3QI 2I3CA 3GKQA 1YJNZ 1VQL1 2G2KA 2QKDA 3HKZA 2QRDB 4MD8A 1VQN1 4BXXI 1RNIA 1Q812 1QVFZ 4NBEA 2V45A 3CCM1 4MD9A 5D1PA 3M4OI 2H85A 1ZB9A 1AA6A 3CXCY 3ESWA 3G71Z 2NVQI 3FQQA 4A3JI 4A3FI 1L1OC 5FLXb 2VPYA 3CC71 2QEXZ 1KQSY 2J6AA 1KD11 3CPWY 1R9TI 1QYPA 1WJ2A 2F4OA 3OW2Z 1VQP1 2QREB 2EGTA 4RVHA 3QWUA 3J81b 1WZNA 4E2WA 1QVGZ 2YU9I 3VMIA 1W2BZ 1K9M1 1VQ81 1YJW1 5C44I 2JA7I 3P5JB 3I07A 2JUBA 1YUAA 4NFRA 1X3WA 3BG0B 2ZAEB 1FDIA 4E2ZA 3RZDI 1LQLA 3CCU1 2NVXI 3CD6Z 1NUIA 3PO3I 2F4MA 2M48A 2OTL1 3HOZI 1TWAI 3CCSZ 3FQMA 3CC4Z 2OTJ1 1YIJZ 1KD12 1VQ9Z 1RLYA 1YITZ 3J7A4 2OOXB 4S1TA 2P3YA 3CMA1 1RO2A 2AYDA 1NP6A 4RS4A 1I6HI 1Y8CA 1K9M2 3CCR1 3T4NB 2Y0SA 3S2HI 3VB9A 1K731 2JIMA 4QTTA 4DK1A 2NVTI 1WW9A 4DGLA 2DE5A 1Y1VI 1TWCI 3CC21 3G6EZ 2AKLA 3GTMI 2W03A 1VQO1 2V3VA 3TDHB 2JIRA 1QXFA 1M1K1 5LL6f 2NVYI 3H3VJ 5T6BA 2DE6A 3MZLB 1VQM1 3J80b 1S721 5IT9b 1YI21 3CMEZ 1RO0A 3CCV1 3G4S1 3VMGA 3PO2I 2LEXA 3S16I 4XX2A 4BBRI 4HH4A 2V8KA 3I56Z 4A93I 2K5RA 3IF8A 4AYBA 3RZOI 3U50C 5FLXf 4RV9A 2QLVB 5FLMI 1K732 3CCEZ 3CCQZ 2JIPA 2VPXA 1K83I 4MRIA 1M1K2 1VQ61 2RT9A 2V8JA 3I55Z 4E30A 1Z03A 3JAMb 1QF8A 3S14I 1NJI1 3J81f 2YADA 2QA41 2JIOA 1YJ9Z 1JJ2Y 1ML8A 1VQ71 3CXCZ 3NH5A 2KI7B 2JR6A 1VQKZ 2DE7A 3CCJ1 3OW2Y 3S15I 4MD7A 4NBFA 3F3FC 4NBBA 2WAQA 3GTOI 3TE5B 4CL1A 1VQ41 1TWFI 3S1QI 5IP9I 3D6WA 5D1OB 3CCL1 1VQ51 2E2HI 3PO3S 1N8R1 2WB1A 1SIWA 2JNYA 1X0TA 1YHQ1 3CPWZ 3I4MI 4EWCA 4NH1C 3S1NI 3HOUI 2JA5I 2E7ZA 2R93I 2VPWA 1USPA 1ZH1A 5A2Qf 2O53A 2HF1A 3F3PC 3S17I 4Y52I 2BJOA 1VQNZ 3HOVI 2V8IA 4A3BI 1TWGI 5T67A 2KPIA 1Y1VS 2IZ3A 3CCMZ 3D2LA 3GTMS 3S1MI 4A3KI 3HOYI 1ZB8A 1Q16A 3GCFA 5IP7I 5CM2M 1VLAA 1YJN1 4A3MI 4X6AI 3GTPI 1N8R2 3K7AI 2GU2A 3CC7Z 1M901 2GTHA 1WIIA 3MONA 5AN9F 3J80f 5IT9f 3D9XA 2HU9A 1P9NA 4RVDA 3NH8A 4NB9A 3G711 3H0GI 2B63I 1VQPZ 2VF1A 2VPZA 2LIYA 4NOZA 2R92I 1FDOA 4E32A 2QEX1 2OZKA 1VQ8Z 1YJWZ 3VTNA 3FKII 3GTKI 1N2FA 1DL6A 4A3II 4BY7I 3KIHA 3BG1B 3JAMf 3MZKB 2RBLA 3IR7A 3CCUZ 2K3RA 1M902 4HGYA 4TNUA 1QVFY 1RQFA 5C3EI 2OTLZ 4DQYB 2OTJZ 3HOXI 4BY1I 3GTJI 2R6MA 1Q7Y2 4NBHA 3CMAZ 4Y7NI 4RVFA 2O4HA 3IX0A 3CD61 4A3LI 2JMOA 3CCRZ 5D1OA 2JIQA 4RVGA 2JS4A 3CCS1 2Q4ZA 3CC41 3I4NI 3S2DI 3CC2Z 1YIJ1 3NH4A 1YUKA 3HOWI 1VQ91 1YIT1 2Q51A 1VQOZ 3NDIA 3Q87A 1X3ZA 3LUSA 4MH4A 2GTIA 1QVGY 1W2BY 1Z01A 4QTUA 4MXUA 1VQMZ 1Q861 1JJ2Z 1S72Z 1Z02A 1PFTA 4A3CI 1TWHI 1YI2Z 1KQSZ 3CCVZ 3M3YI 3G6E1 1WCMI 3G4SZ 3NDJA 2RHBA 1K8A1 4NB8A 1I50I 1VQLZ 1KC81 1NJI2 2QR1B 4A3EI 2PMZA 3VMHA 2JA6I 1SFOI 4MONA 3CME1 2PK7A 2PM9A 4NBAA 1Q821 1VQ6Z 3CQZI 1RO4A 1KRLA 2QRCB 3I561 3IFUA 2QA4Z 1TFIA 1Q862 2W04A 1Y1WI 1VQ7Z 3CCE1 3CCQ1 5T64A 4E31A 4E33A 2LFUA 1JWHC 1K8A2 3CCJZ 1USPB 3GTGI 2R7ZI 4NBCA 3I551 1S7MA 1Q7Y1 5A2Qb 2P28A 4A3GI 1KC82 1VQ4Z 2E9HA 3CCLZ 1VQ5Z 3GTLI 1YJ91 2E2JI 1Q811 2RIQA 3KIFA 3EEDA 2E2II 1YHQZ 3EERA 1VQK1 1Q822 4NBDA 5C4JI 4E2YA 4E2XA 3GTQI 2NAPA 2JA8I 3NFZA 4A3DI 4HGZA 4NBGA 4BBSI 2RPRA 2OOYB 3S1RI 2VUMI 5C4XI 2M6NA 2IV2X
chains in the Genus database with same CATH topology
2VUGA 2IZ4A 1I3QI 2I3CA 3GKQA 1YJNZ 1VQL1 2G2KA 2QKDA 3HKZA 2QRDB 4MD8A 1VQN1 4BXXI 1RNIA 1Q812 1QVFZ 4NBEA 3CCM1 4MD9A 5D1PA 3M4OI 2H85A 1ZB9A 3CXCY 3ESWA 3G71Z 2NVQI 3FQQA 4A3JI 4A3FI 1L1OC 5FLXb 3CC71 2QEXZ 1KQSY 2J6AA 1KD11 3CPWY 1R9TI 1QYPA 2F4OA 3OW2Z 1VQP1 2QREB 2EGTA 4RVHA 3QWUA 3J81b 4E2WA 1QVGZ 2YU9I 3VMIA 1W2BZ 1K9M1 1VQ81 1YJW1 5C44I 2JA7I 3P5JB 3I07A 2JUBA 1YUAA 4NFRA 1X3WA 3BG0B 2ZAEB 3RZDI 4E2ZA 1LQLA 3CCU1 2NVXI 3CD6Z 1NUIA 3PO3I 2F4MA 2M48A 2OTL1 3HOZI 1TWAI 3CCSZ 3FQMA 3CC4Z 2OTJ1 1YIJZ 1KD12 1VQ9Z 1RLYA 1YITZ 3J7A4 2OOXB 4S1TA 2P3YA 3CMA1 1RO2A 1NP6A 4RS4A 1I6HI 1K9M2 3CCR1 3T4NB 2Y0SA 3S2HI 3VB9A 1K731 4QTTA 4DK1A 2NVTI 1WW9A 4DGLA 2DE5A 1Y1VI 1TWCI 3CC21 3G6EZ 2AKLA 3GTMI 2W03A 1VQO1 3TDHB 1M1K1 5LL6f 2NVYI 3H3VJ 5T6BA 2DE6A 3MZLB 1VQM1 3J80b 1S721 5IT9b 1YI21 3CMEZ 1RO0A 3CCV1 3G4S1 3VMGA 3PO2I 3S16I 4XX2A 4BBRI 4HH4A 2V8KA 3I56Z 4A93I 2K5RA 3IF8A 4AYBA 3RZOI 3U50C 5FLXf 4RV9A 2QLVB 5FLMI 1K732 3CCEZ 3CCQZ 1K83I 4MRIA 1M1K2 1VQ61 2RT9A 2V8JA 3I55Z 4E30A 1Z03A 3JAMb 1QF8A 3S14I 1NJI1 3J81f 2YADA 2QA41 1YJ9Z 1JJ2Y 1ML8A 1VQ71 3CXCZ 3NH5A 2KI7B 2JR6A 1VQKZ 2DE7A 3CCJ1 3OW2Y 3S15I 4MD7A 4NBFA 3F3FC 4NBBA 2WAQA 3GTOI 3TE5B 4CL1A 1VQ41 1TWFI 3S1QI 5IP9I 3D6WA 5D1OB 3CCL1 1VQ51 2E2HI 3PO3S 1N8R1 2WB1A 2JNYA 1X0TA 1YHQ1 3CPWZ 3I4MI 4EWCA 4NH1C 3S1NI 3HOUI 2JA5I 2R93I 1USPA 1ZH1A 5A2Qf 2O53A 2HF1A 3F3PC 3S17I 4Y52I 2BJOA 1VQNZ 3HOVI 2V8IA 4A3BI 1TWGI 5T67A 2KPIA 1Y1VS 2IZ3A 3CCMZ 3GTMS 3S1MI 4A3KI 3HOYI 1ZB8A 3GCFA 5IP7I 5CM2M 1VLAA 1YJN1 4A3MI 4X6AI 3GTPI 1N8R2 3K7AI 2GU2A 3CC7Z 1M901 2GTHA 1WIIA 3MONA 5AN9F 3J80f 5IT9f 3D9XA 2HU9A 1P9NA 4RVDA 3NH8A 4NB9A 3G711 3H0GI 2B63I 1VQPZ 2VF1A 2LIYA 4NOZA 2R92I 4E32A 2QEX1 2OZKA 1VQ8Z 1YJWZ 3VTNA 3FKII 3GTKI 1N2FA 1DL6A 4A3II 4BY7I 3KIHA 3BG1B 3JAMf 3MZKB 2RBLA 3CCUZ 2K3RA 1M902 4HGYA 4TNUA 1QVFY 1RQFA 5C3EI 2OTLZ 4DQYB 2OTJZ 3HOXI 4BY1I 3GTJI 2R6MA 1Q7Y2 4NBHA 3CMAZ 4Y7NI 4RVFA 2O4HA 3IX0A 3CD61 4A3LI 2JMOA 3CCRZ 5D1OA 4RVGA 2JS4A 3CCS1 2Q4ZA 3CC41 3I4NI 3S2DI 3CC2Z 1YIJ1 3NH4A 1YUKA 3HOWI 1VQ91 1YIT1 2Q51A 1VQOZ 3NDIA 3Q87A 1X3ZA 3LUSA 4MH4A 2GTIA 1QVGY 1W2BY 1Z01A 4QTUA 4MXUA 1VQMZ 1Q861 1JJ2Z 1S72Z 1Z02A 1PFTA 4A3CI 1TWHI 1YI2Z 1KQSZ 3CCVZ 3M3YI 3G6E1 1WCMI 3G4SZ 3NDJA 2RHBA 1K8A1 4NB8A 1I50I 1VQLZ 1KC81 1NJI2 2QR1B 4A3EI 2PMZA 3VMHA 2JA6I 1SFOI 4MONA 3CME1 2PK7A 2PM9A 4NBAA 1Q821 1VQ6Z 3CQZI 1RO4A 1KRLA 2QRCB 3I561 3IFUA 2QA4Z 1TFIA 1Q862 2W04A 1Y1WI 1VQ7Z 3CCE1 3CCQ1 5T64A 4E31A 4E33A 2LFUA 1JWHC 1K8A2 3CCJZ 1USPB 3GTGI 2R7ZI 4NBCA 3I551 1Q7Y1 5A2Qb 2P28A 4A3GI 1KC82 1VQ4Z 2E9HA 3CCLZ 1VQ5Z 3GTLI 1YJ91 2E2JI 1Q811 2RIQA 3KIFA 3EEDA 2E2II 1YHQZ 3EERA 1VQK1 1Q822 4NBDA 5C4JI 4E2YA 4E2XA 3GTQI 2JA8I 3NFZA 4A3DI 4HGZA 4NBGA 4BBSI 2RPRA 2OOYB 3S1RI 2VUMI 5C4XI 2M6NA 1S7MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KPI A;  1Y1V S;  1I3Q I;  3GKQ A;  4QTU A;  3GTM S;  3S1M I;  4A3K I;  2NVY I;  3H3V J;  3HOY I;  1ZB8 A;  1PFT A;  4A3C I;  1TWH I;  3GCF A;  5IP7 I;  3M3Y I;  5CM2 M;  4BXX I;  4NBE A;  1VLA A;  1WCM I;  2DE6 A;  4A3M I;  3M4O I;  1ZB9 A;  4X6A I;  3ESW A;  4NB8 A;  3GTP I;  1I50 I;  3K7A I;  4A3E I;  2NVQ I;  3HOV I;  3VMH A;  3VMG A;  4A3J I;  4A3F I;  2JA6 I;  1SFO I;  3PO2 I;  1L1O C;  4NB9 A;  3S16 I;  3H0G I;  4XX2 A;  4BBR I;  2B63 I;  4A93 I;  2K5R A;  3RZO I;  2PK7 A;  3U50 C;  4NBA A;  2J6A A;  5FLM I;  3CQZ I;  2R92 I;  4NOZ A;  1RO4 A;  1R9T I;  1QYP A;  2F4O A;  1K83 I;  1TFI A;  3FKI I;  1Y1W I;  2YU9 I;  3GTK I;  3VMI A;  1N2F A;  3S14 I;  1DL6 A;  4A3I I;  4BY7 I;  5C44 I;  2JA7 I;  3I07 A;  1USP B;  3GTG I;  1YUA A;  2R7Z I;  2RBL A;  4NBC A;  1ML8 A;  1X3W A;  4A3G I;  5C3E I;  2JR6 A;  3GTL I;  2DE7 A;  3S15 I;  3HOX I;  3RZD I;  2E2J I;  1LQL A;  4NBF A;  2NVX I;  4BY1 I;  1NUI A;  3GTJ I;  4NBB A;  3GTO I;  3PO3 I;  2F4M A;  3S1Q I;  1TWF I;  4NBH A;  5IP9 I;  3D6W A;  2E2I I;  3HOZ I;  1TWA I;  2E2H I;  3PO3 S;  3EER A;  4Y7N I;  4NBD A;  2JNY A;  1RLY A;  4A3L I;  5C4J I;  2JS4 A;  2P3Y A;  3I4M I;  3GTQ I;  3I4N I;  2JA8 I;  3S2D I;  4A3D I;  3S1N I;  3HOU I;  2JA5 I;  4NBG A;  3HOW I;  1I6H I;  2R93 I;  3Q87 A;  1USP A;  4BBS I;  3S2H I;  1X3Z A;  3LUS A;  4MH4 A;  3VB9 A;  2HF1 A;  3S1R I;  4QTT A;  3S17 I;  2NVT I;  1WW9 A;  2VUM I;  2DE5 A;  1Y1V I;  5C4X I;  2BJO A;  1TWC I;  4Y52 I;  2AKL A;  3GTM I;  4A3B I;  1TWG I; 
#chains in the Genus database with same CATH topology
 2VUG A;  2IZ4 A;  1I3Q I;  2I3C A;  3GKQ A;  1YJN Z;  1VQL 1;  2G2K A;  2QKD A;  3HKZ A;  2QRD B;  4MD8 A;  1VQN 1;  4BXX I;  1RNI A;  1Q81 2;  1QVF Z;  4NBE A;  2V45 A;  3CCM 1;  4MD9 A;  5D1P A;  3M4O I;  2H85 A;  1ZB9 A;  1AA6 A;  3CXC Y;  3ESW A;  3G71 Z;  2NVQ I;  3FQQ A;  4A3J I;  4A3F I;  1L1O C;  5FLX b;  2VPY A;  3CC7 1;  2QEX Z;  1KQS Y;  2J6A A;  1KD1 1;  3CPW Y;  1R9T I;  1QYP A;  1WJ2 A;  2F4O A;  3OW2 Z;  1VQP 1;  2QRE B;  2EGT A;  4RVH A;  3QWU A;  3J81 b;  1WZN A;  4E2W A;  1QVG Z;  2YU9 I;  3VMI A;  1W2B Z;  1K9M 1;  1VQ8 1;  1YJW 1;  5C44 I;  2JA7 I;  3P5J B;  3I07 A;  2JUB A;  1YUA A;  4NFR A;  1X3W A;  3BG0 B;  2ZAE B;  1FDI A;  4E2Z A;  3RZD I;  1LQL A;  3CCU 1;  2NVX I;  3CD6 Z;  1NUI A;  3PO3 I;  2F4M A;  2M48 A;  2OTL 1;  3HOZ I;  1TWA I;  3CCS Z;  3FQM A;  3CC4 Z;  2OTJ 1;  1YIJ Z;  1KD1 2;  1VQ9 Z;  1RLY A;  1YIT Z;  3J7A 4;  2OOX B;  4S1T A;  2P3Y A;  3CMA 1;  1RO2 A;  2AYD A;  1NP6 A;  4RS4 A;  1I6H I;  1Y8C A;  1K9M 2;  3CCR 1;  3T4N B;  2Y0S A;  3S2H I;  3VB9 A;  1K73 1;  2JIM A;  4QTT A;  4DK1 A;  2NVT I;  1WW9 A;  4DGL A;  2DE5 A;  1Y1V I;  1TWC I;  3CC2 1;  3G6E Z;  2AKL A;  3GTM I;  2W03 A;  1VQO 1;  2V3V A;  3TDH B;  2JIR A;  1QXF A;  1M1K 1;  5LL6 f;  2NVY I;  3H3V J;  5T6B A;  2DE6 A;  3MZL B;  1VQM 1;  3J80 b;  1S72 1;  5IT9 b;  1YI2 1;  3CME Z;  1RO0 A;  3CCV 1;  3G4S 1;  3VMG A;  3PO2 I;  2LEX A;  3S16 I;  4XX2 A;  4BBR I;  4HH4 A;  2V8K A;  3I56 Z;  4A93 I;  2K5R A;  3IF8 A;  4AYB A;  3RZO I;  3U50 C;  5FLX f;  4RV9 A;  2QLV B;  5FLM I;  1K73 2;  3CCE Z;  3CCQ Z;  2JIP A;  2VPX A;  1K83 I;  4MRI A;  1M1K 2;  1VQ6 1;  2RT9 A;  2V8J A;  3I55 Z;  4E30 A;  1Z03 A;  3JAM b;  1QF8 A;  3S14 I;  1NJI 1;  3J81 f;  2YAD A;  2QA4 1;  2JIO A;  1YJ9 Z;  1JJ2 Y;  1ML8 A;  1VQ7 1;  3CXC Z;  3NH5 A;  2KI7 B;  2JR6 A;  1VQK Z;  2DE7 A;  3CCJ 1;  3OW2 Y;  3S15 I;  4MD7 A;  4NBF A;  3F3F C;  4NBB A;  2WAQ A;  3GTO I;  3TE5 B;  4CL1 A;  1VQ4 1;  1TWF I;  3S1Q I;  5IP9 I;  3D6W A;  5D1O B;  3CCL 1;  1VQ5 1;  2E2H I;  3PO3 S;  1N8R 1;  2WB1 A;  1SIW A;  2JNY A;  1X0T A;  1YHQ 1;  3CPW Z;  3I4M I;  4EWC A;  4NH1 C;  3S1N I;  3HOU I;  2JA5 I;  2E7Z A;  2R93 I;  2VPW A;  1USP A;  1ZH1 A;  5A2Q f;  2O53 A;  2HF1 A;  3F3P C;  3S17 I;  4Y52 I;  2BJO A;  1VQN Z;  3HOV I;  2V8I A;  4A3B I;  1TWG I;  5T67 A;  2KPI A;  1Y1V S;  2IZ3 A;  3CCM Z;  3D2L A;  3GTM S;  3S1M I;  4A3K I;  3HOY I;  1ZB8 A;  1Q16 A;  3GCF A;  5IP7 I;  5CM2 M;  1VLA A;  1YJN 1;  4A3M I;  4X6A I;  3GTP I;  1N8R 2;  3K7A I;  2GU2 A;  3CC7 Z;  1M90 1;  2GTH A;  1WII A;  3MON A;  5AN9 F;  3J80 f;  5IT9 f;  3D9X A;  2HU9 A;  1P9N A;  4RVD A;  3NH8 A;  4NB9 A;  3G71 1;  3H0G I;  2B63 I;  1VQP Z;  2VF1 A;  2VPZ A;  2LIY A;  4NOZ A;  2R92 I;  1FDO A;  4E32 A;  2QEX 1;  2OZK A;  1VQ8 Z;  1YJW Z;  3VTN A;  3FKI I;  3GTK I;  1N2F A;  1DL6 A;  4A3I I;  4BY7 I;  3KIH A;  3BG1 B;  3JAM f;  3MZK B;  2RBL A;  3IR7 A;  3CCU Z;  2K3R A;  1M90 2;  4HGY A;  4TNU A;  1QVF Y;  1RQF A;  5C3E I;  2OTL Z;  4DQY B;  2OTJ Z;  3HOX I;  4BY1 I;  3GTJ I;  2R6M A;  1Q7Y 2;  4NBH A;  3CMA Z;  4Y7N I;  4RVF A;  2O4H A;  3IX0 A;  3CD6 1;  4A3L I;  2JMO A;  3CCR Z;  5D1O A;  2JIQ A;  4RVG A;  2JS4 A;  3CCS 1;  2Q4Z A;  3CC4 1;  3I4N I;  3S2D I;  3CC2 Z;  1YIJ 1;  3NH4 A;  1YUK A;  3HOW I;  1VQ9 1;  1YIT 1;  2Q51 A;  1VQO Z;  3NDI A;  3Q87 A;  1X3Z A;  3LUS A;  4MH4 A;  2GTI A;  1QVG Y;  1W2B Y;  1Z01 A;  4QTU A;  4MXU A;  1VQM Z;  1Q86 1;  1JJ2 Z;  1S72 Z;  1Z02 A;  1PFT A;  4A3C I;  1TWH I;  1YI2 Z;  1KQS Z;  3CCV Z;  3M3Y I;  3G6E 1;  1WCM I;  3G4S Z;  3NDJ A;  2RHB A;  1K8A 1;  4NB8 A;  1I50 I;  1VQL Z;  1KC8 1;  1NJI 2;  2QR1 B;  4A3E I;  2PMZ A;  3VMH A;  2JA6 I;  1SFO I;  4MON A;  3CME 1;  2PK7 A;  2PM9 A;  4NBA A;  1Q82 1;  1VQ6 Z;  3CQZ I;  1RO4 A;  1KRL A;  2QRC B;  3I56 1;  3IFU A;  2QA4 Z;  1TFI A;  1Q86 2;  2W04 A;  1Y1W I;  1VQ7 Z;  3CCE 1;  3CCQ 1;  5T64 A;  4E31 A;  4E33 A;  2LFU A;  1JWH C;  1K8A 2;  3CCJ Z;  1USP B;  3GTG I;  2R7Z I;  4NBC A;  3I55 1;  1S7M A;  1Q7Y 1;  5A2Q b;  2P28 A;  4A3G I;  1KC8 2;  1VQ4 Z;  2E9H A;  3CCL Z;  1VQ5 Z;  3GTL I;  1YJ9 1;  2E2J I;  1Q81 1;  2RIQ A;  3KIF A;  3EED A;  2E2I I;  1YHQ Z;  3EER A;  1VQK 1;  1Q82 2;  4NBD A;  5C4J I;  4E2Y A;  4E2X A;  3GTQ I;  2NAP A;  2JA8 I;  3NFZ A;  4A3D I;  4HGZ A;  4NBG A;  4BBS I;  2RPR A;  2OOY B;  3S1R I;  2VUM I;  5C4X I;  2M6N A;  2IV2 X; 
#chains in the Genus database with same CATH homology
 2VUG A;  2IZ4 A;  1I3Q I;  2I3C A;  3GKQ A;  1YJN Z;  1VQL 1;  2G2K A;  2QKD A;  3HKZ A;  2QRD B;  4MD8 A;  1VQN 1;  4BXX I;  1RNI A;  1Q81 2;  1QVF Z;  4NBE A;  3CCM 1;  4MD9 A;  5D1P A;  3M4O I;  2H85 A;  1ZB9 A;  3CXC Y;  3ESW A;  3G71 Z;  2NVQ I;  3FQQ A;  4A3J I;  4A3F I;  1L1O C;  5FLX b;  3CC7 1;  2QEX Z;  1KQS Y;  2J6A A;  1KD1 1;  3CPW Y;  1R9T I;  1QYP A;  2F4O A;  3OW2 Z;  1VQP 1;  2QRE B;  2EGT A;  4RVH A;  3QWU A;  3J81 b;  4E2W A;  1QVG Z;  2YU9 I;  3VMI A;  1W2B Z;  1K9M 1;  1VQ8 1;  1YJW 1;  5C44 I;  2JA7 I;  3P5J B;  3I07 A;  2JUB A;  1YUA A;  4NFR A;  1X3W A;  3BG0 B;  2ZAE B;  3RZD I;  4E2Z A;  1LQL A;  3CCU 1;  2NVX I;  3CD6 Z;  1NUI A;  3PO3 I;  2F4M A;  2M48 A;  2OTL 1;  3HOZ I;  1TWA I;  3CCS Z;  3FQM A;  3CC4 Z;  2OTJ 1;  1YIJ Z;  1KD1 2;  1VQ9 Z;  1RLY A;  1YIT Z;  3J7A 4;  2OOX B;  4S1T A;  2P3Y A;  3CMA 1;  1RO2 A;  1NP6 A;  4RS4 A;  1I6H I;  1K9M 2;  3CCR 1;  3T4N B;  2Y0S A;  3S2H I;  3VB9 A;  1K73 1;  4QTT A;  4DK1 A;  2NVT I;  1WW9 A;  4DGL A;  2DE5 A;  1Y1V I;  1TWC I;  3CC2 1;  3G6E Z;  2AKL A;  3GTM I;  2W03 A;  1VQO 1;  3TDH B;  1M1K 1;  5LL6 f;  2NVY I;  3H3V J;  5T6B A;  2DE6 A;  3MZL B;  1VQM 1;  3J80 b;  1S72 1;  5IT9 b;  1YI2 1;  3CME Z;  1RO0 A;  3CCV 1;  3G4S 1;  3VMG A;  3PO2 I;  3S16 I;  4XX2 A;  4BBR I;  4HH4 A;  2V8K A;  3I56 Z;  4A93 I;  2K5R A;  3IF8 A;  4AYB A;  3RZO I;  3U50 C;  5FLX f;  4RV9 A;  2QLV B;  5FLM I;  1K73 2;  3CCE Z;  3CCQ Z;  1K83 I;  4MRI A;  1M1K 2;  1VQ6 1;  2RT9 A;  2V8J A;  3I55 Z;  4E30 A;  1Z03 A;  3JAM b;  1QF8 A;  3S14 I;  1NJI 1;  3J81 f;  2YAD A;  2QA4 1;  1YJ9 Z;  1JJ2 Y;  1ML8 A;  1VQ7 1;  3CXC Z;  3NH5 A;  2KI7 B;  2JR6 A;  1VQK Z;  2DE7 A;  3CCJ 1;  3OW2 Y;  3S15 I;  4MD7 A;  4NBF A;  3F3F C;  4NBB A;  2WAQ A;  3GTO I;  3TE5 B;  4CL1 A;  1VQ4 1;  1TWF I;  3S1Q I;  5IP9 I;  3D6W A;  5D1O B;  3CCL 1;  1VQ5 1;  2E2H I;  3PO3 S;  1N8R 1;  2WB1 A;  2JNY A;  1X0T A;  1YHQ 1;  3CPW Z;  3I4M I;  4EWC A;  4NH1 C;  3S1N I;  3HOU I;  2JA5 I;  2R93 I;  1USP A;  1ZH1 A;  5A2Q f;  2O53 A;  2HF1 A;  3F3P C;  3S17 I;  4Y52 I;  2BJO A;  1VQN Z;  3HOV I;  2V8I A;  4A3B I;  1TWG I;  5T67 A;  2KPI A;  1Y1V S;  2IZ3 A;  3CCM Z;  3GTM S;  3S1M I;  4A3K I;  3HOY I;  1ZB8 A;  3GCF A;  5IP7 I;  5CM2 M;  1VLA A;  1YJN 1;  4A3M I;  4X6A I;  3GTP I;  1N8R 2;  3K7A I;  2GU2 A;  3CC7 Z;  1M90 1;  2GTH A;  1WII A;  3MON A;  5AN9 F;  3J80 f;  5IT9 f;  3D9X A;  2HU9 A;  1P9N A;  4RVD A;  3NH8 A;  4NB9 A;  3G71 1;  3H0G I;  2B63 I;  1VQP Z;  2VF1 A;  2LIY A;  4NOZ A;  2R92 I;  4E32 A;  2QEX 1;  2OZK A;  1VQ8 Z;  1YJW Z;  3VTN A;  3FKI I;  3GTK I;  1N2F A;  1DL6 A;  4A3I I;  4BY7 I;  3KIH A;  3BG1 B;  3JAM f;  3MZK B;  2RBL A;  3CCU Z;  2K3R A;  1M90 2;  4HGY A;  4TNU A;  1QVF Y;  1RQF A;  5C3E I;  2OTL Z;  4DQY B;  2OTJ Z;  3HOX I;  4BY1 I;  3GTJ I;  2R6M A;  1Q7Y 2;  4NBH A;  3CMA Z;  4Y7N I;  4RVF A;  2O4H A;  3IX0 A;  3CD6 1;  4A3L I;  2JMO A;  3CCR Z;  5D1O A;  4RVG A;  2JS4 A;  3CCS 1;  2Q4Z A;  3CC4 1;  3I4N I;  3S2D I;  3CC2 Z;  1YIJ 1;  3NH4 A;  1YUK A;  3HOW I;  1VQ9 1;  1YIT 1;  2Q51 A;  1VQO Z;  3NDI A;  3Q87 A;  1X3Z A;  3LUS A;  4MH4 A;  2GTI A;  1QVG Y;  1W2B Y;  1Z01 A;  4QTU A;  4MXU A;  1VQM Z;  1Q86 1;  1JJ2 Z;  1S72 Z;  1Z02 A;  1PFT A;  4A3C I;  1TWH I;  1YI2 Z;  1KQS Z;  3CCV Z;  3M3Y I;  3G6E 1;  1WCM I;  3G4S Z;  3NDJ A;  2RHB A;  1K8A 1;  4NB8 A;  1I50 I;  1VQL Z;  1KC8 1;  1NJI 2;  2QR1 B;  4A3E I;  2PMZ A;  3VMH A;  2JA6 I;  1SFO I;  4MON A;  3CME 1;  2PK7 A;  2PM9 A;  4NBA A;  1Q82 1;  1VQ6 Z;  3CQZ I;  1RO4 A;  1KRL A;  2QRC B;  3I56 1;  3IFU A;  2QA4 Z;  1TFI A;  1Q86 2;  2W04 A;  1Y1W I;  1VQ7 Z;  3CCE 1;  3CCQ 1;  5T64 A;  4E31 A;  4E33 A;  2LFU A;  1JWH C;  1K8A 2;  3CCJ Z;  1USP B;  3GTG I;  2R7Z I;  4NBC A;  3I55 1;  1Q7Y 1;  5A2Q b;  2P28 A;  4A3G I;  1KC8 2;  1VQ4 Z;  2E9H A;  3CCL Z;  1VQ5 Z;  3GTL I;  1YJ9 1;  2E2J I;  1Q81 1;  2RIQ A;  3KIF A;  3EED A;  2E2I I;  1YHQ Z;  3EER A;  1VQK 1;  1Q82 2;  4NBD A;  5C4J I;  4E2Y A;  4E2X A;  3GTQ I;  2JA8 I;  3NFZ A;  4A3D I;  4HGZ A;  4NBG A;  4BBS I;  2RPR A;  2OOY B;  3S1R I;  2VUM I;  5C4X I;  2M6N A;  1S7M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...