4A3FI

Rna polymerase ii initial transcribing complex with a 6nt dna-rna hybrid and soaked with ampcpp
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 14
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3fI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3fI02
2JNYA 1RLYA 3HOVI 4NB8A 3VMHA 3S1QI 3FKII 3M3YI 3S1MI 4A3GI 1I6HI 1X3ZA 3I4MI 1RO4A 4QTTA 2R92I 1L1OC 2HF1A 3M4OI 4A3DI 2VUMI 2AKLA 3GKQA 5C3EI 2NVTI 4A3KI 3GTMI 2JA7I 2KPIA 4Y7NI 3GTMS 2J6AA 5IP7I 1USPA 5FLMI 2E2JI 2NVXI 1DL6A 3GTJI 3S17I 4A3BI 3VMIA 2RBLA 4NOZA 3GCFA 2E2II 2DE7A 2BJOA 1PFTA 4A3II 3U50C 4XX2A 2K5RA 4MH4A 4QTUA 3S14I 2R7ZI 3I4NI 4A93I 4NB9A 1USPB 4NBCA 2F4MA 3H3VJ 1I50I 5C4XI 1X3WA 4A3CI 1Y1VI 3LUSA 1QYPA 5C44I 2JS4A 2B63I 4A3EI 3GTPI 5CM2M 4X6AI 1Y1VS 1I3QI 1N2FA 1TWAI 2F4OA 1SFOI 2JA8I 3S1NI 3S15I 3HOWI 3GTOI 1ZB8A 1ML8A 3HOXI 2R93I 1VLAA 3HOZI 1TWCI 2DE5A 3VB9A 1LQLA 3PO3S 4A3JI 3CQZI 4NBHA 5C4JI 3VMGA 3GTGI 3S2DI 4BY1I 4A3LI 1TFIA 1TWFI 4NBFA 2DE6A 1TWGI 4A3MI 4BBRI 3ESWA 2E2HI 3GTLI 3I07A 1K83I 3S16I 5IP9I 1WW9A 3PO3I 3Q87A 3HOYI 2JA5I 3HOUI 4BY7I 1NUIA 4A3FI 3GTKI 3PO2I 3RZOI 4NBGA 4Y52I 3EERA 4NBEA 2NVYI 3S1RI 1ZB9A 3H0GI 4BXXI 3D6WA 4NBAA 1TWHI 2JR6A 2YU9I 1R9TI 1YUAA 1WCMI 4BBSI 1Y1WI 2JA6I 3RZDI 2P3YA 3GTQI 3K7AI 2NVQI 3S2HI 2PK7A 4NBBA 4NBDA
chains in the Genus database with same CATH superfamily
1RLYA 1KQSY 3G6EZ 3VMHA 3G6E1 1X0TA 3M3YI 3VTNA 1X3ZA 3CCR1 2R92I 3NH4A 1L1OC 2HF1A 5C3EI 3OW2Z 1YIJZ 4Y7NI 4MONA 2LEXA 2EGTA 3GTMS 4DK1A 2VPXA 3KIHA 2O4HA 1JJ2Y 3GTJI 4RVDA 2Y0SA 4NOZA 4NH1C 2LIYA 1YJWZ 1YJW1 4TNUA 4A93I 4NB9A 2QEXZ 2QEX1 1USPB 4NBCA 3QWUA 3H3VJ 3CC71 3NDJA 4A3CI 3LUSA 2B63I 5CM2M 1I3QI 4HGZA 2JA8I 3MONA 1VQP1 1VQPZ 1QF8A 3HOWI 3GTOI 3HOXI 1Z02A 4CL1A 3HOZI 1VQNZ 2DE5A 1NJI1 2JIPA 3IX0A 4A3JI 3JAMb 1YI2Z 1YI21 4NBHA 3GTGI 1WJ2A 1FDIA 1TWFI 4RV9A 2DE6A 2M48A 2ZAEB 1QVGZ 4BBRI 1S7MA 4MD7A 3ESWA 1K8A1 3CCM1 1VQ7Z 1VQ71 3P5JB 3I56Z 5IP9I 3PO3I 3HOYI 1VQ4Z 2W03A 4BY7I 3CC21 4HH4A 1YITZ 3RZOI 1VQLZ 1VQL1 4Y52I 3JAMf 1NJI2 2NVYI 3NH8A 1RNIA 3S1RI 1Q16A 5IT9b 1WZNA 1ZB9A 3CD6Z 3CD61 1TWHI 1KC81 1VQ9Z 1VQ91 3CCUZ 3GTQI 3HKZA 3CMEZ 3CCQZ 3CME1 3CCQ1 2VF1A 1K8A2 1Z01A 2JNYA 2QKDA 3J81b 4NB8A 3S1QI 2JUBA 4RVGA 1K9M1 3S1MI 1Q811 3CXCY 1RO4A 4QTTA 1QVFY 1VQMZ 2AKLA 2NVTI 4A3KI 2KPIA 1Q861 5FLXb 2Q51A 5IP7I 1USPA 2RBLA 4E30A 2V3VA 3CCS1 2E2II 2JIRA 1KC82 2H85A 2BJOA 2IZ3A 4A3II 1YHQZ 4XX2A 4QTUA 3CPWZ 3I4NI 1M901 3D2LA 3J81f 2LFUA 3F3FC 1I50I 1X3WA 1Y1VI 1K9M2 1Q812 2W04A 1Z03A 5C44I 1YIJ1 3IF8A 4E32A 4X6AI 2F4OA 1SFOI 2O53A 1KRLA 1ZB8A 1Q862 2PMZA 2OZKA 1VLAA 2NAPA 4E33A 1TWCI 2VUGA 3FQQA 3PO3S 3MZKB 2QREB 2JIOA 1Y8CA 3VMGA 2AYDA 2P28A 4BY1I 4E2WA 1M902 3MZLB 4A3MI 5AN9F 2E2HI 3I07A 1K83I 3S16I 1WW9A 1VQ5Z 3KIFA 3Q87A 1QXFA 3CCJZ 3CCJ1 2RT9A 1W2BZ 3CCEZ 1VQN1 3G4SZ 3G4S1 1YJ91 1YJ9Z 3PO2I 2OTLZ 3G71Z 3G711 3I55Z 3I551 4NBAA 1FDOA 2JR6A 4RS4A 4BBSI 1VQKZ 2V45A 3K7AI 3I561 4HGYA 1S72Z 2VPYA 5T6BA 1VQ41 3FKII 1YIT1 1YJNZ 1YJN1 2JIMA 1VQ6Z 1VQ61 4RVHA 1NP6A 4S1TA 3M4OI 2VUMI 2RHBA 3GKQA 3GTMI 3J80b 2QR1B 1DL6A 2J6AA 2E2JI 4E2ZA 2Q4ZA 3VMIA 3CCU1 3GCFA 2DE7A 1QVGY 2QRCB 3FQMA 1PFTA 2OOXB 3S14I 2R7ZI 2OTJZ 4E2YA 2OTJ1 3D9XA 5C4XI 4MXUA 1QYPA 4DGLA 1KQSZ 2QRDB 1N2FA 1TWAI 5IT9f 3NH5A 3S15I 5D1PA 2RIQA 3CCLZ 4DQYB 2R93I 2HU9A 2I3CA 2OOYB 1YHQ1 1RO0A 3CQZI 4MRIA 5D1OB 4E31A 1JJ2Z 2GTIA 5C4JI 1AA6A 2JIQA 4A3LI 1TFIA 2WB1A 3TDHB 3NDIA 4RVFA 2KI7B 3GTLI 5A2Qb 5FLXf 2K3RA 3CCVZ 2JA5I 3HOUI 1NUIA 3GTKI 3CCRZ 4NBGA 3EERA 5T67A 1N8R1 1P9NA 3IR7A 3H0GI 4BXXI 2YU9I 1R9TI 3CPWY 1SIWA 1YUAA 1WCMI 2JMOA 2V8JA 3RZDI 2M6NA 2P3YA 2NVQI 3S2HI 3CMAZ 3CMA1 5A2Qf 3BG0B 1VQ51 3OW2Y 3CCE1 3HOVI 5T64A 4A3GI 1I6HI 3I4MI 1ZH1A 3CC7Z 2OTL1 4A3DI 1VQOZ 2IZ4A 1VQO1 1M1K1 2JA7I 3F3PC 5FLMI 1N8R2 4NFRA 2NVXI 3CC4Z 3CC41 3S17I 4A3BI 3IFUA 1VQK1 4EWCA 1S721 3U50C 2K5RA 4MH4A 5LL6f 2VPZA 3NFZA 2G2KA 2F4MA 2GTHA 2V8IA 2RPRA 1W2BY 2JS4A 4A3EI 3GTPI 1Y1VS 5D1OA 3CCMZ 1VQ8Z 1M1K2 1VQ81 3S1NI 3J7A4 3T4NB 3CXCZ 2E7ZA 1QVFZ 1ML8A 1KD11 1JWHC 1YUKA 2VPWA 3CC2Z 3VB9A 1LQLA 2QLVB 1K731 2E9HA 3S2DI 4MD9A 4NBFA 1TWGI 1Q821 4AYBA 1WIIA 1Q7Y1 3EEDA 3J80f 3CCL1 2R6MA 4A3FI 3BG1B 1KD12 1RO2A 2WAQA 3TE5B 4NBEA 1VQM1 4MD8A 1K732 3D6WA 2QA4Z 2QA41 2PM9A 2YADA 2V8KA 2GU2A 2IV2X 1Y1WI 2JA6I 3CCSZ 1Q822 2PK7A 4NBBA 4NBDA 1Q7Y2 4E2XA 1RQFA 3CCV1
chains in the Genus database with same CATH topology
1RLYA 1KQSY 3G6EZ 3VMHA 3G6E1 1X0TA 3M3YI 3VTNA 1X3ZA 3CCR1 2R92I 3NH4A 1L1OC 2HF1A 5C3EI 3OW2Z 1YIJZ 4Y7NI 4MONA 2EGTA 3GTMS 4DK1A 3KIHA 2O4HA 1JJ2Y 3GTJI 4RVDA 2Y0SA 4NOZA 4NH1C 2LIYA 1YJWZ 1YJW1 4TNUA 4A93I 4NB9A 2QEXZ 2QEX1 1USPB 4NBCA 3QWUA 3H3VJ 3CC71 3NDJA 4A3CI 3LUSA 2B63I 5CM2M 1I3QI 4HGZA 2JA8I 3MONA 1VQP1 1VQPZ 1QF8A 3HOWI 3GTOI 3HOXI 1Z02A 4CL1A 3HOZI 1VQNZ 2DE5A 1NJI1 3IX0A 4A3JI 3JAMb 1YI2Z 1YI21 4NBHA 3GTGI 1TWFI 4RV9A 2DE6A 2M48A 2ZAEB 1QVGZ 4BBRI 1S7MA 4MD7A 3ESWA 1K8A1 3CCM1 1VQ7Z 1VQ71 3P5JB 3I56Z 5IP9I 3PO3I 3HOYI 1VQ4Z 2W03A 4BY7I 3CC21 4HH4A 1YITZ 3RZOI 1VQLZ 1VQL1 4Y52I 3JAMf 1NJI2 2NVYI 3NH8A 1RNIA 3S1RI 5IT9b 1ZB9A 3CD6Z 3CD61 1TWHI 1KC81 1VQ9Z 1VQ91 3CCUZ 3GTQI 3HKZA 3CMEZ 3CCQZ 3CME1 3CCQ1 2VF1A 1K8A2 1Z01A 2JNYA 2QKDA 3J81b 4NB8A 3S1QI 2JUBA 4RVGA 1K9M1 3S1MI 1Q811 3CXCY 1RO4A 4QTTA 1QVFY 2AKLA 2NVTI 4A3KI 2KPIA 1Q861 5FLXb 2Q51A 5IP7I 1USPA 2RBLA 4E30A 3CCS1 2E2II 1KC82 2H85A 2BJOA 2IZ3A 4A3II 1YHQZ 4XX2A 4QTUA 3CPWZ 3I4NI 1M901 3J81f 2LFUA 3F3FC 1I50I 1X3WA 1Y1VI 1K9M2 1Q812 2W04A 1Z03A 5C44I 1YIJ1 3IF8A 4E32A 4X6AI 2F4OA 1SFOI 2O53A 1KRLA 1ZB8A 1Q862 2PMZA 2OZKA 1VLAA 4E33A 1TWCI 2VUGA 3FQQA 3PO3S 3MZKB 2QREB 3VMGA 2P28A 4BY1I 4E2WA 1M902 3MZLB 4A3MI 5AN9F 2E2HI 3I07A 1K83I 3S16I 1WW9A 1VQ5Z 3KIFA 3Q87A 3CCJZ 3CCJ1 2RT9A 1W2BZ 3CCEZ 1VQN1 3G4SZ 3G4S1 1YJ91 1YJ9Z 3PO2I 2OTLZ 3G71Z 3G711 3I55Z 3I551 4NBAA 2JR6A 4RS4A 4BBSI 1VQKZ 3K7AI 3I561 4HGYA 1S72Z 5T6BA 1VQ41 3FKII 1YIT1 1YJNZ 1YJN1 1VQ6Z 1VQ61 4RVHA 1NP6A 4S1TA 3M4OI 2VUMI 2RHBA 3GKQA 3GTMI 3J80b 2QR1B 1DL6A 2J6AA 2E2JI 4E2ZA 2Q4ZA 3VMIA 3CCU1 3GCFA 2DE7A 1QVGY 2QRCB 3FQMA 1PFTA 2OOXB 3S14I 2R7ZI 2OTJZ 4E2YA 2OTJ1 3D9XA 5C4XI 4MXUA 1QYPA 4DGLA 1KQSZ 2QRDB 1N2FA 1TWAI 5IT9f 3NH5A 3S15I 5D1PA 2RIQA 3CCLZ 4DQYB 2R93I 2HU9A 2I3CA 2OOYB 1YHQ1 1RO0A 3CQZI 4MRIA 5D1OB 4E31A 1JJ2Z 2GTIA 5C4JI 4A3LI 1TFIA 2WB1A 3TDHB 3NDIA 4RVFA 2KI7B 3GTLI 5A2Qb 5FLXf 2K3RA 3CCVZ 2JA5I 3HOUI 1NUIA 3GTKI 3CCRZ 4NBGA 3EERA 5T67A 4E2XA 1N8R1 1P9NA 3H0GI 4BXXI 2YU9I 1R9TI 3CPWY 1YUAA 1WCMI 2JMOA 2V8JA 3RZDI 2M6NA 2P3YA 2NVQI 3S2HI 3CMAZ 3CMA1 5A2Qf 3BG0B 1VQ51 3OW2Y 3CCE1 3HOVI 5T64A 4A3GI 1I6HI 3I4MI 1ZH1A 3CC7Z 2OTL1 4A3DI 1VQOZ 2IZ4A 1VQO1 1M1K1 2JA7I 3F3PC 5FLMI 1N8R2 4NFRA 2NVXI 3CC4Z 3CC41 3S17I 4A3BI 3IFUA 1VQK1 4EWCA 1S721 3U50C 2K5RA 4MH4A 5LL6f 3NFZA 2G2KA 2F4MA 2GTHA 2V8IA 2RPRA 1W2BY 2JS4A 4A3EI 3GTPI 1Y1VS 5D1OA 3CCMZ 1VQ8Z 1M1K2 1VQ81 3S1NI 3J7A4 3T4NB 3CXCZ 1QVFZ 1ML8A 1KD11 1JWHC 1YUKA 3VB9A 3CC2Z 1LQLA 2QLVB 1K731 2E9HA 3S2DI 4MD9A 4NBFA 1TWGI 1Q821 4AYBA 1WIIA 1Q7Y1 3EEDA 3J80f 3CCL1 2R6MA 4A3FI 3BG1B 1KD12 1RO2A 2WAQA 3TE5B 4NBEA 1VQM1 4MD8A 1K732 3D6WA 2QA4Z 2QA41 2PM9A 2YADA 2V8KA 2GU2A 1Y1WI 2JA6I 3CCSZ 1Q822 2PK7A 4NBBA 4NBDA 1Q7Y2 1VQMZ 1RQFA 3CCV1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JNY A;  1RLY A;  3HOV I;  4NB8 A;  3VMH A;  3S1Q I;  3FKI I;  3M3Y I;  3S1M I;  4A3G I;  1I6H I;  1X3Z A;  3I4M I;  1RO4 A;  4QTT A;  2R92 I;  1L1O C;  2HF1 A;  3M4O I;  4A3D I;  2VUM I;  2AKL A;  3GKQ A;  5C3E I;  2NVT I;  4A3K I;  3GTM I;  2JA7 I;  2KPI A;  4Y7N I;  3GTM S;  2J6A A;  5IP7 I;  1USP A;  5FLM I;  2E2J I;  2NVX I;  1DL6 A;  3GTJ I;  3S17 I;  4A3B I;  3VMI A;  2RBL A;  4NOZ A;  3GCF A;  2E2I I;  2DE7 A;  2BJO A;  1PFT A;  4A3I I;  3U50 C;  4XX2 A;  2K5R A;  4MH4 A;  4QTU A;  3S14 I;  2R7Z I;  3I4N I;  4A93 I;  4NB9 A;  1USP B;  4NBC A;  2F4M A;  3H3V J;  1I50 I;  5C4X I;  1X3W A;  4A3C I;  1Y1V I;  3LUS A;  1QYP A;  5C44 I;  2JS4 A;  2B63 I;  4A3E I;  3GTP I;  5CM2 M;  4X6A I;  1Y1V S;  1I3Q I;  1N2F A;  1TWA I;  2F4O A;  1SFO I;  2JA8 I;  3S1N I;  3S15 I;  3HOW I;  3GTO I;  1ZB8 A;  1ML8 A;  3HOX I;  2R93 I;  1VLA A;  3HOZ I;  1TWC I;  2DE5 A;  3VB9 A;  1LQL A;  3PO3 S;  4A3J I;  3CQZ I;  4NBH A;  5C4J I;  3VMG A;  3GTG I;  3S2D I;  4BY1 I;  4A3L I;  1TFI A;  1TWF I;  4NBF A;  2DE6 A;  1TWG I;  4A3M I;  4BBR I;  3ESW A;  2E2H I;  3GTL I;  3I07 A;  1K83 I;  3S16 I;  5IP9 I;  1WW9 A;  3PO3 I;  3Q87 A;  3HOY I;  2JA5 I;  3HOU I;  4BY7 I;  1NUI A;  4A3F I;  3GTK I;  3PO2 I;  3RZO I;  4NBG A;  4Y52 I;  3EER A;  4NBE A;  2NVY I;  3S1R I;  1ZB9 A;  3H0G I;  4BXX I;  3D6W A;  4NBA A;  1TWH I;  2JR6 A;  2YU9 I;  1R9T I;  1YUA A;  1WCM I;  4BBS I;  1Y1W I;  2JA6 I;  3RZD I;  2P3Y A;  3GTQ I;  3K7A I;  2NVQ I;  3S2H I;  2PK7 A;  4NBB A;  4NBD A; 
#chains in the Genus database with same CATH topology
 1RLY A;  1KQS Y;  3G6E Z;  3VMH A;  3G6E 1;  1X0T A;  3M3Y I;  3VTN A;  1X3Z A;  3CCR 1;  2R92 I;  3NH4 A;  1L1O C;  2HF1 A;  5C3E I;  3OW2 Z;  1YIJ Z;  4Y7N I;  4MON A;  2LEX A;  2EGT A;  3GTM S;  4DK1 A;  2VPX A;  3KIH A;  2O4H A;  1JJ2 Y;  3GTJ I;  4RVD A;  2Y0S A;  4NOZ A;  4NH1 C;  2LIY A;  1YJW Z;  1YJW 1;  4TNU A;  4A93 I;  4NB9 A;  2QEX Z;  2QEX 1;  1USP B;  4NBC A;  3QWU A;  3H3V J;  3CC7 1;  3NDJ A;  4A3C I;  3LUS A;  2B63 I;  5CM2 M;  1I3Q I;  4HGZ A;  2JA8 I;  3MON A;  1VQP 1;  1VQP Z;  1QF8 A;  3HOW I;  3GTO I;  3HOX I;  1Z02 A;  4CL1 A;  3HOZ I;  1VQN Z;  2DE5 A;  1NJI 1;  2JIP A;  3IX0 A;  4A3J I;  3JAM b;  1YI2 Z;  1YI2 1;  4NBH A;  3GTG I;  1WJ2 A;  1FDI A;  1TWF I;  4RV9 A;  2DE6 A;  2M48 A;  2ZAE B;  1QVG Z;  4BBR I;  1S7M A;  4MD7 A;  3ESW A;  1K8A 1;  3CCM 1;  1VQ7 Z;  1VQ7 1;  3P5J B;  3I56 Z;  5IP9 I;  3PO3 I;  3HOY I;  1VQ4 Z;  2W03 A;  4BY7 I;  3CC2 1;  4HH4 A;  1YIT Z;  3RZO I;  1VQL Z;  1VQL 1;  4Y52 I;  3JAM f;  1NJI 2;  2NVY I;  3NH8 A;  1RNI A;  3S1R I;  1Q16 A;  5IT9 b;  1WZN A;  1ZB9 A;  3CD6 Z;  3CD6 1;  1TWH I;  1KC8 1;  1VQ9 Z;  1VQ9 1;  3CCU Z;  3GTQ I;  3HKZ A;  3CME Z;  3CCQ Z;  3CME 1;  3CCQ 1;  2VF1 A;  1K8A 2;  1Z01 A;  2JNY A;  2QKD A;  3J81 b;  4NB8 A;  3S1Q I;  2JUB A;  4RVG A;  1K9M 1;  3S1M I;  1Q81 1;  3CXC Y;  1RO4 A;  4QTT A;  1QVF Y;  1VQM Z;  2AKL A;  2NVT I;  4A3K I;  2KPI A;  1Q86 1;  5FLX b;  2Q51 A;  5IP7 I;  1USP A;  2RBL A;  4E30 A;  2V3V A;  3CCS 1;  2E2I I;  2JIR A;  1KC8 2;  2H85 A;  2BJO A;  2IZ3 A;  4A3I I;  1YHQ Z;  4XX2 A;  4QTU A;  3CPW Z;  3I4N I;  1M90 1;  3D2L A;  3J81 f;  2LFU A;  3F3F C;  1I50 I;  1X3W A;  1Y1V I;  1K9M 2;  1Q81 2;  2W04 A;  1Z03 A;  5C44 I;  1YIJ 1;  3IF8 A;  4E32 A;  4X6A I;  2F4O A;  1SFO I;  2O53 A;  1KRL A;  1ZB8 A;  1Q86 2;  2PMZ A;  2OZK A;  1VLA A;  2NAP A;  4E33 A;  1TWC I;  2VUG A;  3FQQ A;  3PO3 S;  3MZK B;  2QRE B;  2JIO A;  1Y8C A;  3VMG A;  2AYD A;  2P28 A;  4BY1 I;  4E2W A;  1M90 2;  3MZL B;  4A3M I;  5AN9 F;  2E2H I;  3I07 A;  1K83 I;  3S16 I;  1WW9 A;  1VQ5 Z;  3KIF A;  3Q87 A;  1QXF A;  3CCJ Z;  3CCJ 1;  2RT9 A;  1W2B Z;  3CCE Z;  1VQN 1;  3G4S Z;  3G4S 1;  1YJ9 1;  1YJ9 Z;  3PO2 I;  2OTL Z;  3G71 Z;  3G71 1;  3I55 Z;  3I55 1;  4NBA A;  1FDO A;  2JR6 A;  4RS4 A;  4BBS I;  1VQK Z;  2V45 A;  3K7A I;  3I56 1;  4HGY A;  1S72 Z;  2VPY A;  5T6B A;  1VQ4 1;  3FKI I;  1YIT 1;  1YJN Z;  1YJN 1;  2JIM A;  1VQ6 Z;  1VQ6 1;  4RVH A;  1NP6 A;  4S1T A;  3M4O I;  2VUM I;  2RHB A;  3GKQ A;  3GTM I;  3J80 b;  2QR1 B;  1DL6 A;  2J6A A;  2E2J I;  4E2Z A;  2Q4Z A;  3VMI A;  3CCU 1;  3GCF A;  2DE7 A;  1QVG Y;  2QRC B;  3FQM A;  1PFT A;  2OOX B;  3S14 I;  2R7Z I;  2OTJ Z;  4E2Y A;  2OTJ 1;  3D9X A;  5C4X I;  4MXU A;  1QYP A;  4DGL A;  1KQS Z;  2QRD B;  1N2F A;  1TWA I;  5IT9 f;  3NH5 A;  3S15 I;  5D1P A;  2RIQ A;  3CCL Z;  4DQY B;  2R93 I;  2HU9 A;  2I3C A;  2OOY B;  1YHQ 1;  1RO0 A;  3CQZ I;  4MRI A;  5D1O B;  4E31 A;  1JJ2 Z;  2GTI A;  5C4J I;  1AA6 A;  2JIQ A;  4A3L I;  1TFI A;  2WB1 A;  3TDH B;  3NDI A;  4RVF A;  2KI7 B;  3GTL I;  5A2Q b;  5FLX f;  2K3R A;  3CCV Z;  2JA5 I;  3HOU I;  1NUI A;  3GTK I;  3CCR Z;  4NBG A;  3EER A;  5T67 A;  1N8R 1;  1P9N A;  3IR7 A;  3H0G I;  4BXX I;  2YU9 I;  1R9T I;  3CPW Y;  1SIW A;  1YUA A;  1WCM I;  2JMO A;  2V8J A;  3RZD I;  2M6N A;  2P3Y A;  2NVQ I;  3S2H I;  3CMA Z;  3CMA 1;  5A2Q f;  3BG0 B;  1VQ5 1;  3OW2 Y;  3CCE 1;  3HOV I;  5T64 A;  4A3G I;  1I6H I;  3I4M I;  1ZH1 A;  3CC7 Z;  2OTL 1;  4A3D I;  1VQO Z;  2IZ4 A;  1VQO 1;  1M1K 1;  2JA7 I;  3F3P C;  5FLM I;  1N8R 2;  4NFR A;  2NVX I;  3CC4 Z;  3CC4 1;  3S17 I;  4A3B I;  3IFU A;  1VQK 1;  4EWC A;  1S72 1;  3U50 C;  2K5R A;  4MH4 A;  5LL6 f;  2VPZ A;  3NFZ A;  2G2K A;  2F4M A;  2GTH A;  2V8I A;  2RPR A;  1W2B Y;  2JS4 A;  4A3E I;  3GTP I;  1Y1V S;  5D1O A;  3CCM Z;  1VQ8 Z;  1M1K 2;  1VQ8 1;  3S1N I;  3J7A 4;  3T4N B;  3CXC Z;  2E7Z A;  1QVF Z;  1ML8 A;  1KD1 1;  1JWH C;  1YUK A;  2VPW A;  3CC2 Z;  3VB9 A;  1LQL A;  2QLV B;  1K73 1;  2E9H A;  3S2D I;  4MD9 A;  4NBF A;  1TWG I;  1Q82 1;  4AYB A;  1WII A;  1Q7Y 1;  3EED A;  3J80 f;  3CCL 1;  2R6M A;  4A3F I;  3BG1 B;  1KD1 2;  1RO2 A;  2WAQ A;  3TE5 B;  4NBE A;  1VQM 1;  4MD8 A;  1K73 2;  3D6W A;  2QA4 Z;  2QA4 1;  2PM9 A;  2YAD A;  2V8K A;  2GU2 A;  2IV2 X;  1Y1W I;  2JA6 I;  3CCS Z;  1Q82 2;  2PK7 A;  4NBB A;  4NBD A;  1Q7Y 2;  4E2X A;  1RQF A;  3CCV 1; 
#chains in the Genus database with same CATH homology
 1RLY A;  1KQS Y;  3G6E Z;  3VMH A;  3G6E 1;  1X0T A;  3M3Y I;  3VTN A;  1X3Z A;  3CCR 1;  2R92 I;  3NH4 A;  1L1O C;  2HF1 A;  5C3E I;  3OW2 Z;  1YIJ Z;  4Y7N I;  4MON A;  2EGT A;  3GTM S;  4DK1 A;  3KIH A;  2O4H A;  1JJ2 Y;  3GTJ I;  4RVD A;  2Y0S A;  4NOZ A;  4NH1 C;  2LIY A;  1YJW Z;  1YJW 1;  4TNU A;  4A93 I;  4NB9 A;  2QEX Z;  2QEX 1;  1USP B;  4NBC A;  3QWU A;  3H3V J;  3CC7 1;  3NDJ A;  4A3C I;  3LUS A;  2B63 I;  5CM2 M;  1I3Q I;  4HGZ A;  2JA8 I;  3MON A;  1VQP 1;  1VQP Z;  1QF8 A;  3HOW I;  3GTO I;  3HOX I;  1Z02 A;  4CL1 A;  3HOZ I;  1VQN Z;  2DE5 A;  1NJI 1;  3IX0 A;  4A3J I;  3JAM b;  1YI2 Z;  1YI2 1;  4NBH A;  3GTG I;  1TWF I;  4RV9 A;  2DE6 A;  2M48 A;  2ZAE B;  1QVG Z;  4BBR I;  1S7M A;  4MD7 A;  3ESW A;  1K8A 1;  3CCM 1;  1VQ7 Z;  1VQ7 1;  3P5J B;  3I56 Z;  5IP9 I;  3PO3 I;  3HOY I;  1VQ4 Z;  2W03 A;  4BY7 I;  3CC2 1;  4HH4 A;  1YIT Z;  3RZO I;  1VQL Z;  1VQL 1;  4Y52 I;  3JAM f;  1NJI 2;  2NVY I;  3NH8 A;  1RNI A;  3S1R I;  5IT9 b;  1ZB9 A;  3CD6 Z;  3CD6 1;  1TWH I;  1KC8 1;  1VQ9 Z;  1VQ9 1;  3CCU Z;  3GTQ I;  3HKZ A;  3CME Z;  3CCQ Z;  3CME 1;  3CCQ 1;  2VF1 A;  1K8A 2;  1Z01 A;  2JNY A;  2QKD A;  3J81 b;  4NB8 A;  3S1Q I;  2JUB A;  4RVG A;  1K9M 1;  3S1M I;  1Q81 1;  3CXC Y;  1RO4 A;  4QTT A;  1QVF Y;  2AKL A;  2NVT I;  4A3K I;  2KPI A;  1Q86 1;  5FLX b;  2Q51 A;  5IP7 I;  1USP A;  2RBL A;  4E30 A;  3CCS 1;  2E2I I;  1KC8 2;  2H85 A;  2BJO A;  2IZ3 A;  4A3I I;  1YHQ Z;  4XX2 A;  4QTU A;  3CPW Z;  3I4N I;  1M90 1;  3J81 f;  2LFU A;  3F3F C;  1I50 I;  1X3W A;  1Y1V I;  1K9M 2;  1Q81 2;  2W04 A;  1Z03 A;  5C44 I;  1YIJ 1;  3IF8 A;  4E32 A;  4X6A I;  2F4O A;  1SFO I;  2O53 A;  1KRL A;  1ZB8 A;  1Q86 2;  2PMZ A;  2OZK A;  1VLA A;  4E33 A;  1TWC I;  2VUG A;  3FQQ A;  3PO3 S;  3MZK B;  2QRE B;  3VMG A;  2P28 A;  4BY1 I;  4E2W A;  1M90 2;  3MZL B;  4A3M I;  5AN9 F;  2E2H I;  3I07 A;  1K83 I;  3S16 I;  1WW9 A;  1VQ5 Z;  3KIF A;  3Q87 A;  3CCJ Z;  3CCJ 1;  2RT9 A;  1W2B Z;  3CCE Z;  1VQN 1;  3G4S Z;  3G4S 1;  1YJ9 1;  1YJ9 Z;  3PO2 I;  2OTL Z;  3G71 Z;  3G71 1;  3I55 Z;  3I55 1;  4NBA A;  2JR6 A;  4RS4 A;  4BBS I;  1VQK Z;  3K7A I;  3I56 1;  4HGY A;  1S72 Z;  5T6B A;  1VQ4 1;  3FKI I;  1YIT 1;  1YJN Z;  1YJN 1;  1VQ6 Z;  1VQ6 1;  4RVH A;  1NP6 A;  4S1T A;  3M4O I;  2VUM I;  2RHB A;  3GKQ A;  3GTM I;  3J80 b;  2QR1 B;  1DL6 A;  2J6A A;  2E2J I;  4E2Z A;  2Q4Z A;  3VMI A;  3CCU 1;  3GCF A;  2DE7 A;  1QVG Y;  2QRC B;  3FQM A;  1PFT A;  2OOX B;  3S14 I;  2R7Z I;  2OTJ Z;  4E2Y A;  2OTJ 1;  3D9X A;  5C4X I;  4MXU A;  1QYP A;  4DGL A;  1KQS Z;  2QRD B;  1N2F A;  1TWA I;  5IT9 f;  3NH5 A;  3S15 I;  5D1P A;  2RIQ A;  3CCL Z;  4DQY B;  2R93 I;  2HU9 A;  2I3C A;  2OOY B;  1YHQ 1;  1RO0 A;  3CQZ I;  4MRI A;  5D1O B;  4E31 A;  1JJ2 Z;  2GTI A;  5C4J I;  4A3L I;  1TFI A;  2WB1 A;  3TDH B;  3NDI A;  4RVF A;  2KI7 B;  3GTL I;  5A2Q b;  5FLX f;  2K3R A;  3CCV Z;  2JA5 I;  3HOU I;  1NUI A;  3GTK I;  3CCR Z;  4NBG A;  3EER A;  5T67 A;  4E2X A;  1N8R 1;  1P9N A;  3H0G I;  4BXX I;  2YU9 I;  1R9T I;  3CPW Y;  1YUA A;  1WCM I;  2JMO A;  2V8J A;  3RZD I;  2M6N A;  2P3Y A;  2NVQ I;  3S2H I;  3CMA Z;  3CMA 1;  5A2Q f;  3BG0 B;  1VQ5 1;  3OW2 Y;  3CCE 1;  3HOV I;  5T64 A;  4A3G I;  1I6H I;  3I4M I;  1ZH1 A;  3CC7 Z;  2OTL 1;  4A3D I;  1VQO Z;  2IZ4 A;  1VQO 1;  1M1K 1;  2JA7 I;  3F3P C;  5FLM I;  1N8R 2;  4NFR A;  2NVX I;  3CC4 Z;  3CC4 1;  3S17 I;  4A3B I;  3IFU A;  1VQK 1;  4EWC A;  1S72 1;  3U50 C;  2K5R A;  4MH4 A;  5LL6 f;  3NFZ A;  2G2K A;  2F4M A;  2GTH A;  2V8I A;  2RPR A;  1W2B Y;  2JS4 A;  4A3E I;  3GTP I;  1Y1V S;  5D1O A;  3CCM Z;  1VQ8 Z;  1M1K 2;  1VQ8 1;  3S1N I;  3J7A 4;  3T4N B;  3CXC Z;  1QVF Z;  1ML8 A;  1KD1 1;  1JWH C;  1YUK A;  3VB9 A;  3CC2 Z;  1LQL A;  2QLV B;  1K73 1;  2E9H A;  3S2D I;  4MD9 A;  4NBF A;  1TWG I;  1Q82 1;  4AYB A;  1WII A;  1Q7Y 1;  3EED A;  3J80 f;  3CCL 1;  2R6M A;  4A3F I;  3BG1 B;  1KD1 2;  1RO2 A;  2WAQ A;  3TE5 B;  4NBE A;  1VQM 1;  4MD8 A;  1K73 2;  3D6W A;  2QA4 Z;  2QA4 1;  2PM9 A;  2YAD A;  2V8K A;  2GU2 A;  1Y1W I;  2JA6 I;  3CCS Z;  1Q82 2;  2PK7 A;  4NBB A;  4NBD A;  1Q7Y 2;  1VQM Z;  1RQF A;  3CCV 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...