1RO4A

Rdc-derived models of the zinc ribbon domain of human general transcription factor tfiib (zinc free structures)
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
58
structure length
58
Chain Sequence
b'ASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription initiation factor IIB
publication title Probing Zn2+-binding effects on the zinc-ribbon domain of human general transcription factor TFIIB.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 2
structure length 58
sequence length 58
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08271 TF_Zn_Ribbon TFIIB zinc-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1ro4A00
4A3KI 1TFIA 4A3II 3S1NI 4A3FI 3GCFA 1I6HI 2J6AA 2NVTI 3M3YI 3M4OI 2KPIA 4NOZA 4NBFA 3S17I 1I50I 2NVYI 1PFTA 4NBCA 3VMIA 3GKQA 4NB8A 4A3EI 3GTPI 5C3EI 3S2HI 4Y7NI 4X6AI 2JS4A 3K7AI 2AKLA 2DE7A 2JA5I 3PO3S 1USPA 3I07A 2E2JI 3ESWA 4NBDA 1WCMI 2BJOA 3D6WA 3HOYI 4A3CI 3HOWI 4BBSI 3HOXI 1X3ZA 1Y1VI 1ZB8A 4XX2A 3I4MI 2VUMI 3S16I 3VMHA 1RLYA 3GTLI 4Y52I 3RZDI 4BY7I 3FKII 1RO4A 2DE5A 3GTJI 3S14I 5C44I 4A3JI 1N2FA 2P3YA 2JNYA 1Y1WI 1SFOI 3GTKI 3GTMS 3HOVI 2NVXI 4NBHA 4A3GI 3Q87A 3S2DI 2PK7A 2R92I 2F4MA 1ZB9A 5IP9I 3I4NI 3S1MI 3CQZI 4NBEA 4NBAA 1TWHI 2DE6A 5FLMI 3HOZI 2R93I 1YUAA 3PO2I 1QYPA 2JA8I 3GTOI 4MH4A 3U50C 2K5RA 1X3WA 3GTGI 5IP7I 3H0GI 3PO3I 1TWAI 3S1RI 1Y1VS 1TWCI 4QTUA 4A93I 3VB9A 2B63I 4NBGA 5C4XI 1NUIA 2JR6A 1DL6A 4BBRI 1WW9A 1TWGI 1R9TI 4A3BI 3EERA 1K83I 4A3MI 2HF1A 4BY1I 3S15I 3HOUI 2E2HI 3S1QI 3VMGA 4BXXI 2E2II 3GTMI 3RZOI 4NBBA 2R7ZI 1LQLA 2NVQI 5CM2M 1L1OC 2JA6I 1USPB 4NB9A 2YU9I 3H3VJ 3GTQI 2RBLA 1ML8A 1I3QI 2JA7I 2F4OA 1TWFI 4A3DI 4A3LI 5C4JI 4QTTA 1VLAA 3LUSA
chains in the Genus database with same CATH superfamily
4MD7A 1TFIA 4A3KI 1M901 3GCFA 2J6AA 3CCEZ 1KD12 3J80f 3M3YI 1YUKA 1VQPZ 1Q821 1I50I 3GTPI 4Y7NI 3J81f 2IZ4A 2QR1B 2VPZA 2LFUA 3I07A 3J7A4 5LL6f 2OOYB 3KIHA 1WCMI 4NBDA 3CXCY 1VQ6Z 5T64A 4A3CI 1FDIA 2HU9A 3HOXI 2R6MA 1Q861 2M48A 3GTLI 1VQ41 2Q4ZA 1VQ91 2E7ZA 2YADA 2QKDA 4BY7I 3S14I 3GTMS 1N2FA 3HOYI 2JNYA 1KQSZ 2NVXI 4NBHA 2RIQA 3S2DI 2R92I 2F4MA 3EEDA 5IP9I 3CQZI 4NBAA 3HOZI 1JJ2Y 1YUAA 3TDHB 2JIMA 2JA8I 3I55Z 5FLXb 1VQO1 1NP6A 5IP7I 2QRDB 3FQMA 3CCL1 3TE5B 1VQ81 2KI7B 2RT9A 1YJNZ 4QTUA 1Q812 2B63I 1W2BZ 2PM9A 3F3FC 3KIFA 4BBRI 2HF1A 2IV2X 1S721 2M6NA 1RNIA 3S1QI 4MRIA 4BXXI 3GTMI 2V8JA 1QF8A 1QVGY 2G2KA 3NDIA 2OTJZ 1USPB 4NB9A 1Q811 2W03A 2RBLA 3T4NB 3I56Z 4E2ZA 3J80b 2F4OA 3CCR1 3G711 1Q16A 4E2YA 4A3II 1YJW1 1QVFY 3CME1 4E33A 1P9NA 4MD8A 1KC82 4NBFA 2RHBA 4E32A 4RS4A 3JAMb 2Q51A 3HKZA 3CMAZ 2NVYI 4NB8A 1AA6A 1RO0A 3K7AI 3CCU1 4E31A 1VQN1 1USPA 3CC41 4MONA 1YHQ1 3NFZA 2AYDA 3CXCZ 1NJI1 3NDJA 4BBSI 4EWCA 1VQ7Z 4AYBA 1Y1VI 1ZB8A 4XX2A 2QA4Z 5D1PA 3I4MI 3VMHA 4Y52I 3CC21 5T67A 3GTJI 3IFUA 4A3JI 1Y1WI 2VPXA 1K732 3CCS1 2VPYA 1VQ51 2PK7A 1SIWA 1ZB9A 4TNUA 3JAMf 1N8R1 1JJ2Z 2R93I 3FQQA 3CD61 3G6EZ 1QYPA 1KD11 3CPWY 1X3WA 2QEXZ 3G4S1 3CC7Z 1KRLA 5IT9b 2WB1A 1YI2Z 3H0GI 1VQM1 2OTLZ 3CCQ1 4A93I 3VB9A 2NAPA 5C4XI 1YIT1 4NFRA 1R9TI 2GTIA 1VQNZ 3CCM1 3OW2Z 3BG1B 1WIIA 2IZ3A 1YJ91 5A2Qf 2E2HI 2E2II 1YHQZ 4NBBA 2R7ZI 3MZLB 2GTHA 5CM2M 2JA6I 1JWHC 1M1K2 3GTQI 2OZKA 4S1TA 1ML8A 1I3QI 2JA7I 1TWFI 1VQK1 2QLVB 3CCJ1 2QRCB 4QTTA 1VQL1 5IT9f 3S1NI 2LEXA 1K8A2 2NVTI 1RQFA 2KPIA 4NOZA 3D9XA 1K9M2 1Z01A 4NBCA 3GKQA 4A3EI 3CCV1 3S2HI 1KQSY 1FDOA 4X6AI 1X0TA 2DE7A 2JA5I 1VQ4Z 3QWUA 3IF8A 3PO3S 1VQ9Z 3CCE1 1WJ2A 2VUGA 1VQP1 2E2JI 3ESWA 1K8A1 3D6WA 1RO2A 1Q7Y2 3HOWI 1X3ZA 2JMOA 1K9M1 4MXUA 3VTNA 3RZDI 3FKII 2V45A 2VPWA 3HOVI 4A3GI 4RVDA 1VQOZ 3CCLZ 1ZH1A 1VQ8Z 1VQ61 4NBEA 1TWHI 5FLMI 2DE6A 3NH8A 4DQYB 1M902 4HH4A 3GTOI 3U50C 2ZAEB 1KC81 3CPWZ 3GTGI 1S72Z 3PO3I 1TWAI 3S1RI 1Z02A 4NBGA 5A2Qb 4RVHA 3I551 1DL6A 4RV9A 2JIRA 1WW9A 1TWGI 2JIOA 3BG0B 3EERA 4A3MI 3CCRZ 4NH1C 3G71Z 2V8KA 1YJN1 3RZOI 1QXFA 1YJWZ 1Q862 3CMEZ 5D1OB 3H3VJ 1K731 4MD9A 4A3DI 4A3LI 5C4JI 1VLAA 3CCUZ 4A3FI 1I6HI 2P28A 2OTJ1 3CC4Z 3M4OI 4E2WA 2O4HA 3I561 1QVGZ 3S17I 1PFTA 3VMIA 2WAQA 1S7MA 5C3EI 2JS4A 2AKLA 4E30A 3CC2Z 5D1OA 2PMZA 3MONA 4RVFA 3CCSZ 3IR7A 1VQ5Z 2H85A 3F3PC 2QREB 1YIJ1 2BJOA 3CMA1 1QVFZ 4HGYA 3S16I 2VUMI 1RLYA 3IX0A 3CD6Z 1RO4A 1M1K1 2DE5A 3MZKB 5C44I 2P3YA 2V3VA 3GTKI 1SFOI 3G4SZ 3Q87A 2RPRA 1VQMZ 3I4NI 3S1MI 3CCQZ 2OOXB 1VQ71 5AN9F 3OW2Y 4DGLA 2QA41 3PO2I 4CL1A 1YITZ 4MH4A 2K5RA 2LIYA 3CCMZ 5T6BA 3NH4A 1YJ9Z 1Y8CA 2K3RA 1Y1VS 1TWCI 2GU2A 2I3CA 4E2XA 2W04A 1Z03A 2JIQA 1W2BY 1NUIA 2JR6A 3G6E1 2V8IA 5FLXf 3D2LA 2QEX1 3CC71 4A3BI 2EGTA 4DK1A 4RVGA 1YI21 1K83I 4BY1I 3J81b 1VQKZ 3S15I 3CCJZ 3HOUI 1VQLZ 1Q7Y1 1NJI2 3VMGA 2OTL1 1WZNA 2JIPA 1YIJZ 2O53A 4HGZA 1LQLA 3NH5A 3P5JB 1Q822 2NVQI 1L1OC 2VF1A 2YU9I 2JUBA 2Y0SA 2E9HA 3CCVZ 1N8R2 3LUSA
chains in the Genus database with same CATH topology
4MD7A 1TFIA 4A3KI 1M901 3GCFA 2J6AA 3CCEZ 1KD12 3J80f 3M3YI 1YUKA 1VQPZ 1Q821 1I50I 3GTPI 4Y7NI 3J81f 2IZ4A 2QR1B 2LFUA 3I07A 3J7A4 5LL6f 2OOYB 3KIHA 1WCMI 4NBDA 3CXCY 1VQ6Z 5T64A 4A3CI 2HU9A 3HOXI 2R6MA 1Q861 2M48A 3GTLI 1VQ41 2Q4ZA 1VQ91 2YADA 2QKDA 4BY7I 3S14I 3GTMS 1N2FA 3HOYI 2JNYA 1KQSZ 2NVXI 4NBHA 2RIQA 3S2DI 2R92I 2F4MA 3EEDA 5IP9I 3CQZI 4NBAA 3HOZI 1JJ2Y 1YUAA 3TDHB 2JA8I 3I55Z 5FLXb 1VQO1 1NP6A 5IP7I 2QRDB 3FQMA 3CCL1 3TE5B 1VQ81 2KI7B 2RT9A 1YJNZ 4QTUA 1Q812 2B63I 1W2BZ 2PM9A 3F3FC 3KIFA 4BBRI 2HF1A 1S721 2M6NA 1RNIA 3S1QI 4MRIA 4BXXI 3GTMI 2V8JA 1QF8A 1QVGY 2G2KA 3NDIA 2OTJZ 1USPB 4NB9A 1Q811 2W03A 2RBLA 3T4NB 3I56Z 4E2ZA 3J80b 2F4OA 3CCR1 3G711 4E2YA 4A3II 1YJW1 1QVFY 3CME1 4E33A 1P9NA 4MD8A 1KC82 4NBFA 2RHBA 4E32A 4RS4A 3JAMb 2Q51A 3HKZA 3CMAZ 2NVYI 4NB8A 1RO0A 3K7AI 3CCU1 4E31A 1VQN1 1USPA 3CC41 4MONA 1YHQ1 3NFZA 3CXCZ 1NJI1 3NDJA 4BBSI 4EWCA 1VQ7Z 4AYBA 1Y1VI 1ZB8A 4XX2A 2QA4Z 5D1PA 3I4MI 3VMHA 4Y52I 3CC21 5T67A 3GTJI 3IFUA 4A3JI 1Y1WI 1K732 3CCS1 1VQ51 2PK7A 1ZB9A 4TNUA 3JAMf 1N8R1 1JJ2Z 2R93I 3FQQA 3CD61 3G6EZ 1QYPA 1KD11 3CPWY 1X3WA 2QEXZ 3G4S1 3CC7Z 1KRLA 5IT9b 2WB1A 1YI2Z 3H0GI 1VQM1 2OTLZ 3CCQ1 4A93I 3VB9A 5C4XI 1YIT1 4NFRA 1R9TI 2GTIA 1VQNZ 3CCM1 3OW2Z 3BG1B 1WIIA 2IZ3A 1YJ91 5A2Qf 2E2HI 2E2II 1YHQZ 4NBBA 2R7ZI 3MZLB 2GTHA 5CM2M 2JA6I 1JWHC 1M1K2 3GTQI 2OZKA 4S1TA 1ML8A 1I3QI 2JA7I 1TWFI 1VQK1 2QLVB 3CCJ1 2QRCB 4QTTA 1VQL1 5IT9f 3S1NI 1K8A2 2NVTI 1RQFA 2KPIA 4NOZA 3D9XA 1K9M2 1Z01A 4NBCA 3GKQA 4A3EI 3CCV1 3S2HI 1KQSY 4X6AI 1X0TA 2DE7A 2JA5I 1VQ4Z 3QWUA 3IF8A 3PO3S 1VQ9Z 3CCE1 2VUGA 1VQP1 2E2JI 3ESWA 1K8A1 3D6WA 1RO2A 1Q7Y2 3HOWI 1X3ZA 2JMOA 1K9M1 4MXUA 3VTNA 3RZDI 3FKII 3HOVI 4A3GI 4RVDA 1VQOZ 3CCLZ 1ZH1A 1VQ8Z 1VQ61 4NBEA 1TWHI 5FLMI 2DE6A 3NH8A 4DQYB 1M902 4HH4A 3GTOI 3U50C 2ZAEB 1KC81 3CPWZ 3GTGI 1S72Z 3PO3I 1TWAI 3S1RI 1Z02A 4NBGA 5A2Qb 4RVHA 3I551 1DL6A 4RV9A 1WW9A 1TWGI 3BG0B 3EERA 4A3MI 3CCRZ 4NH1C 3G71Z 2V8KA 1YJN1 3RZOI 1YJWZ 1Q862 3CMEZ 5D1OB 3H3VJ 1K731 4MD9A 4A3DI 4A3LI 5C4JI 1VLAA 3CCUZ 4A3FI 1I6HI 2P28A 2OTJ1 3CC4Z 3M4OI 4E2WA 2O4HA 3I561 1QVGZ 3S17I 1PFTA 3VMIA 2WAQA 1S7MA 5C3EI 2JS4A 2AKLA 4E30A 3CC2Z 5D1OA 2PMZA 3MONA 4RVFA 3CCSZ 1VQ5Z 2H85A 3F3PC 2QREB 1YIJ1 2BJOA 3CMA1 1QVFZ 4HGYA 3S16I 2VUMI 1RLYA 3IX0A 3CD6Z 1RO4A 1M1K1 2DE5A 3MZKB 5C44I 2P3YA 3GTKI 1SFOI 3G4SZ 3Q87A 2RPRA 1VQMZ 3I4NI 3S1MI 3CCQZ 2OOXB 1VQ71 5AN9F 3OW2Y 4DGLA 2QA41 3PO2I 4CL1A 1YITZ 4MH4A 2K5RA 2LIYA 3CCMZ 5T6BA 3NH4A 1YJ9Z 2K3RA 1Y1VS 1TWCI 2GU2A 2I3CA 4E2XA 2W04A 1Z03A 1W2BY 1NUIA 2JR6A 3G6E1 2V8IA 5FLXf 2QEX1 3CC71 4A3BI 2EGTA 4DK1A 4RVGA 1YI21 1K83I 4BY1I 3J81b 1VQKZ 3S15I 3CCJZ 3HOUI 1VQLZ 1Q7Y1 1NJI2 3VMGA 2OTL1 1YIJZ 2O53A 4HGZA 1LQLA 3NH5A 3P5JB 1Q822 2NVQI 1L1OC 2VF1A 2YU9I 2JUBA 2Y0SA 2E9HA 3CCVZ 1N8R2 3LUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3K I;  1TFI A;  4A3I I;  3S1N I;  4A3F I;  3GCF A;  1I6H I;  2J6A A;  2NVT I;  3M3Y I;  3M4O I;  2KPI A;  4NOZ A;  4NBF A;  3S17 I;  1I50 I;  2NVY I;  1PFT A;  4NBC A;  3VMI A;  3GKQ A;  4NB8 A;  4A3E I;  3GTP I;  5C3E I;  3S2H I;  4Y7N I;  4X6A I;  2JS4 A;  3K7A I;  2AKL A;  2DE7 A;  2JA5 I;  3PO3 S;  1USP A;  3I07 A;  2E2J I;  3ESW A;  4NBD A;  1WCM I;  2BJO A;  3D6W A;  3HOY I;  4A3C I;  3HOW I;  4BBS I;  3HOX I;  1X3Z A;  1Y1V I;  1ZB8 A;  4XX2 A;  3I4M I;  2VUM I;  3S16 I;  3VMH A;  1RLY A;  3GTL I;  4Y52 I;  3RZD I;  4BY7 I;  3FKI I;  1RO4 A;  2DE5 A;  3GTJ I;  3S14 I;  5C44 I;  4A3J I;  1N2F A;  2P3Y A;  2JNY A;  1Y1W I;  1SFO I;  3GTK I;  3GTM S;  3HOV I;  2NVX I;  4NBH A;  4A3G I;  3Q87 A;  3S2D I;  2PK7 A;  2R92 I;  2F4M A;  1ZB9 A;  5IP9 I;  3I4N I;  3S1M I;  3CQZ I;  4NBE A;  4NBA A;  1TWH I;  2DE6 A;  5FLM I;  3HOZ I;  2R93 I;  1YUA A;  3PO2 I;  1QYP A;  2JA8 I;  3GTO I;  4MH4 A;  3U50 C;  2K5R A;  1X3W A;  3GTG I;  5IP7 I;  3H0G I;  3PO3 I;  1TWA I;  3S1R I;  1Y1V S;  1TWC I;  4QTU A;  4A93 I;  3VB9 A;  2B63 I;  4NBG A;  5C4X I;  1NUI A;  2JR6 A;  1DL6 A;  4BBR I;  1WW9 A;  1TWG I;  1R9T I;  4A3B I;  3EER A;  1K83 I;  4A3M I;  2HF1 A;  4BY1 I;  3S15 I;  3HOU I;  2E2H I;  3S1Q I;  3VMG A;  4BXX I;  2E2I I;  3GTM I;  3RZO I;  4NBB A;  2R7Z I;  1LQL A;  2NVQ I;  5CM2 M;  1L1O C;  2JA6 I;  1USP B;  4NB9 A;  2YU9 I;  3H3V J;  3GTQ I;  2RBL A;  1ML8 A;  1I3Q I;  2JA7 I;  2F4O A;  1TWF I;  4A3D I;  4A3L I;  5C4J I;  4QTT A;  1VLA A;  3LUS A; 
#chains in the Genus database with same CATH topology
 4MD7 A;  1TFI A;  4A3K I;  1M90 1;  3GCF A;  2J6A A;  3CCE Z;  1KD1 2;  3J80 f;  3M3Y I;  1YUK A;  1VQP Z;  1Q82 1;  1I50 I;  3GTP I;  4Y7N I;  3J81 f;  2IZ4 A;  2QR1 B;  2VPZ A;  2LFU A;  3I07 A;  3J7A 4;  5LL6 f;  2OOY B;  3KIH A;  1WCM I;  4NBD A;  3CXC Y;  1VQ6 Z;  5T64 A;  4A3C I;  1FDI A;  2HU9 A;  3HOX I;  2R6M A;  1Q86 1;  2M48 A;  3GTL I;  1VQ4 1;  2Q4Z A;  1VQ9 1;  2E7Z A;  2YAD A;  2QKD A;  4BY7 I;  3S14 I;  3GTM S;  1N2F A;  3HOY I;  2JNY A;  1KQS Z;  2NVX I;  4NBH A;  2RIQ A;  3S2D I;  2R92 I;  2F4M A;  3EED A;  5IP9 I;  3CQZ I;  4NBA A;  3HOZ I;  1JJ2 Y;  1YUA A;  3TDH B;  2JIM A;  2JA8 I;  3I55 Z;  5FLX b;  1VQO 1;  1NP6 A;  5IP7 I;  2QRD B;  3FQM A;  3CCL 1;  3TE5 B;  1VQ8 1;  2KI7 B;  2RT9 A;  1YJN Z;  4QTU A;  1Q81 2;  2B63 I;  1W2B Z;  2PM9 A;  3F3F C;  3KIF A;  4BBR I;  2HF1 A;  2IV2 X;  1S72 1;  2M6N A;  1RNI A;  3S1Q I;  4MRI A;  4BXX I;  3GTM I;  2V8J A;  1QF8 A;  1QVG Y;  2G2K A;  3NDI A;  2OTJ Z;  1USP B;  4NB9 A;  1Q81 1;  2W03 A;  2RBL A;  3T4N B;  3I56 Z;  4E2Z A;  3J80 b;  2F4O A;  3CCR 1;  3G71 1;  1Q16 A;  4E2Y A;  4A3I I;  1YJW 1;  1QVF Y;  3CME 1;  4E33 A;  1P9N A;  4MD8 A;  1KC8 2;  4NBF A;  2RHB A;  4E32 A;  4RS4 A;  3JAM b;  2Q51 A;  3HKZ A;  3CMA Z;  2NVY I;  4NB8 A;  1AA6 A;  1RO0 A;  3K7A I;  3CCU 1;  4E31 A;  1VQN 1;  1USP A;  3CC4 1;  4MON A;  1YHQ 1;  3NFZ A;  2AYD A;  3CXC Z;  1NJI 1;  3NDJ A;  4BBS I;  4EWC A;  1VQ7 Z;  4AYB A;  1Y1V I;  1ZB8 A;  4XX2 A;  2QA4 Z;  5D1P A;  3I4M I;  3VMH A;  4Y52 I;  3CC2 1;  5T67 A;  3GTJ I;  3IFU A;  4A3J I;  1Y1W I;  2VPX A;  1K73 2;  3CCS 1;  2VPY A;  1VQ5 1;  2PK7 A;  1SIW A;  1ZB9 A;  4TNU A;  3JAM f;  1N8R 1;  1JJ2 Z;  2R93 I;  3FQQ A;  3CD6 1;  3G6E Z;  1QYP A;  1KD1 1;  3CPW Y;  1X3W A;  2QEX Z;  3G4S 1;  3CC7 Z;  1KRL A;  5IT9 b;  2WB1 A;  1YI2 Z;  3H0G I;  1VQM 1;  2OTL Z;  3CCQ 1;  4A93 I;  3VB9 A;  2NAP A;  5C4X I;  1YIT 1;  4NFR A;  1R9T I;  2GTI A;  1VQN Z;  3CCM 1;  3OW2 Z;  3BG1 B;  1WII A;  2IZ3 A;  1YJ9 1;  5A2Q f;  2E2H I;  2E2I I;  1YHQ Z;  4NBB A;  2R7Z I;  3MZL B;  2GTH A;  5CM2 M;  2JA6 I;  1JWH C;  1M1K 2;  3GTQ I;  2OZK A;  4S1T A;  1ML8 A;  1I3Q I;  2JA7 I;  1TWF I;  1VQK 1;  2QLV B;  3CCJ 1;  2QRC B;  4QTT A;  1VQL 1;  5IT9 f;  3S1N I;  2LEX A;  1K8A 2;  2NVT I;  1RQF A;  2KPI A;  4NOZ A;  3D9X A;  1K9M 2;  1Z01 A;  4NBC A;  3GKQ A;  4A3E I;  3CCV 1;  3S2H I;  1KQS Y;  1FDO A;  4X6A I;  1X0T A;  2DE7 A;  2JA5 I;  1VQ4 Z;  3QWU A;  3IF8 A;  3PO3 S;  1VQ9 Z;  3CCE 1;  1WJ2 A;  2VUG A;  1VQP 1;  2E2J I;  3ESW A;  1K8A 1;  3D6W A;  1RO2 A;  1Q7Y 2;  3HOW I;  1X3Z A;  2JMO A;  1K9M 1;  4MXU A;  3VTN A;  3RZD I;  3FKI I;  2V45 A;  2VPW A;  3HOV I;  4A3G I;  4RVD A;  1VQO Z;  3CCL Z;  1ZH1 A;  1VQ8 Z;  1VQ6 1;  4NBE A;  1TWH I;  5FLM I;  2DE6 A;  3NH8 A;  4DQY B;  1M90 2;  4HH4 A;  3GTO I;  3U50 C;  2ZAE B;  1KC8 1;  3CPW Z;  3GTG I;  1S72 Z;  3PO3 I;  1TWA I;  3S1R I;  1Z02 A;  4NBG A;  5A2Q b;  4RVH A;  3I55 1;  1DL6 A;  4RV9 A;  2JIR A;  1WW9 A;  1TWG I;  2JIO A;  3BG0 B;  3EER A;  4A3M I;  3CCR Z;  4NH1 C;  3G71 Z;  2V8K A;  1YJN 1;  3RZO I;  1QXF A;  1YJW Z;  1Q86 2;  3CME Z;  5D1O B;  3H3V J;  1K73 1;  4MD9 A;  4A3D I;  4A3L I;  5C4J I;  1VLA A;  3CCU Z;  4A3F I;  1I6H I;  2P28 A;  2OTJ 1;  3CC4 Z;  3M4O I;  4E2W A;  2O4H A;  3I56 1;  1QVG Z;  3S17 I;  1PFT A;  3VMI A;  2WAQ A;  1S7M A;  5C3E I;  2JS4 A;  2AKL A;  4E30 A;  3CC2 Z;  5D1O A;  2PMZ A;  3MON A;  4RVF A;  3CCS Z;  3IR7 A;  1VQ5 Z;  2H85 A;  3F3P C;  2QRE B;  1YIJ 1;  2BJO A;  3CMA 1;  1QVF Z;  4HGY A;  3S16 I;  2VUM I;  1RLY A;  3IX0 A;  3CD6 Z;  1RO4 A;  1M1K 1;  2DE5 A;  3MZK B;  5C44 I;  2P3Y A;  2V3V A;  3GTK I;  1SFO I;  3G4S Z;  3Q87 A;  2RPR A;  1VQM Z;  3I4N I;  3S1M I;  3CCQ Z;  2OOX B;  1VQ7 1;  5AN9 F;  3OW2 Y;  4DGL A;  2QA4 1;  3PO2 I;  4CL1 A;  1YIT Z;  4MH4 A;  2K5R A;  2LIY A;  3CCM Z;  5T6B A;  3NH4 A;  1YJ9 Z;  1Y8C A;  2K3R A;  1Y1V S;  1TWC I;  2GU2 A;  2I3C A;  4E2X A;  2W04 A;  1Z03 A;  2JIQ A;  1W2B Y;  1NUI A;  2JR6 A;  3G6E 1;  2V8I A;  5FLX f;  3D2L A;  2QEX 1;  3CC7 1;  4A3B I;  2EGT A;  4DK1 A;  4RVG A;  1YI2 1;  1K83 I;  4BY1 I;  3J81 b;  1VQK Z;  3S15 I;  3CCJ Z;  3HOU I;  1VQL Z;  1Q7Y 1;  1NJI 2;  3VMG A;  2OTL 1;  1WZN A;  2JIP A;  1YIJ Z;  2O53 A;  4HGZ A;  1LQL A;  3NH5 A;  3P5J B;  1Q82 2;  2NVQ I;  1L1O C;  2VF1 A;  2YU9 I;  2JUB A;  2Y0S A;  2E9H A;  3CCV Z;  1N8R 2;  3LUS A; 
#chains in the Genus database with same CATH homology
 4MD7 A;  1TFI A;  4A3K I;  1M90 1;  3GCF A;  2J6A A;  3CCE Z;  1KD1 2;  3J80 f;  3M3Y I;  1YUK A;  1VQP Z;  1Q82 1;  1I50 I;  3GTP I;  4Y7N I;  3J81 f;  2IZ4 A;  2QR1 B;  2LFU A;  3I07 A;  3J7A 4;  5LL6 f;  2OOY B;  3KIH A;  1WCM I;  4NBD A;  3CXC Y;  1VQ6 Z;  5T64 A;  4A3C I;  2HU9 A;  3HOX I;  2R6M A;  1Q86 1;  2M48 A;  3GTL I;  1VQ4 1;  2Q4Z A;  1VQ9 1;  2YAD A;  2QKD A;  4BY7 I;  3S14 I;  3GTM S;  1N2F A;  3HOY I;  2JNY A;  1KQS Z;  2NVX I;  4NBH A;  2RIQ A;  3S2D I;  2R92 I;  2F4M A;  3EED A;  5IP9 I;  3CQZ I;  4NBA A;  3HOZ I;  1JJ2 Y;  1YUA A;  3TDH B;  2JA8 I;  3I55 Z;  5FLX b;  1VQO 1;  1NP6 A;  5IP7 I;  2QRD B;  3FQM A;  3CCL 1;  3TE5 B;  1VQ8 1;  2KI7 B;  2RT9 A;  1YJN Z;  4QTU A;  1Q81 2;  2B63 I;  1W2B Z;  2PM9 A;  3F3F C;  3KIF A;  4BBR I;  2HF1 A;  1S72 1;  2M6N A;  1RNI A;  3S1Q I;  4MRI A;  4BXX I;  3GTM I;  2V8J A;  1QF8 A;  1QVG Y;  2G2K A;  3NDI A;  2OTJ Z;  1USP B;  4NB9 A;  1Q81 1;  2W03 A;  2RBL A;  3T4N B;  3I56 Z;  4E2Z A;  3J80 b;  2F4O A;  3CCR 1;  3G71 1;  4E2Y A;  4A3I I;  1YJW 1;  1QVF Y;  3CME 1;  4E33 A;  1P9N A;  4MD8 A;  1KC8 2;  4NBF A;  2RHB A;  4E32 A;  4RS4 A;  3JAM b;  2Q51 A;  3HKZ A;  3CMA Z;  2NVY I;  4NB8 A;  1RO0 A;  3K7A I;  3CCU 1;  4E31 A;  1VQN 1;  1USP A;  3CC4 1;  4MON A;  1YHQ 1;  3NFZ A;  3CXC Z;  1NJI 1;  3NDJ A;  4BBS I;  4EWC A;  1VQ7 Z;  4AYB A;  1Y1V I;  1ZB8 A;  4XX2 A;  2QA4 Z;  5D1P A;  3I4M I;  3VMH A;  4Y52 I;  3CC2 1;  5T67 A;  3GTJ I;  3IFU A;  4A3J I;  1Y1W I;  1K73 2;  3CCS 1;  1VQ5 1;  2PK7 A;  1ZB9 A;  4TNU A;  3JAM f;  1N8R 1;  1JJ2 Z;  2R93 I;  3FQQ A;  3CD6 1;  3G6E Z;  1QYP A;  1KD1 1;  3CPW Y;  1X3W A;  2QEX Z;  3G4S 1;  3CC7 Z;  1KRL A;  5IT9 b;  2WB1 A;  1YI2 Z;  3H0G I;  1VQM 1;  2OTL Z;  3CCQ 1;  4A93 I;  3VB9 A;  5C4X I;  1YIT 1;  4NFR A;  1R9T I;  2GTI A;  1VQN Z;  3CCM 1;  3OW2 Z;  3BG1 B;  1WII A;  2IZ3 A;  1YJ9 1;  5A2Q f;  2E2H I;  2E2I I;  1YHQ Z;  4NBB A;  2R7Z I;  3MZL B;  2GTH A;  5CM2 M;  2JA6 I;  1JWH C;  1M1K 2;  3GTQ I;  2OZK A;  4S1T A;  1ML8 A;  1I3Q I;  2JA7 I;  1TWF I;  1VQK 1;  2QLV B;  3CCJ 1;  2QRC B;  4QTT A;  1VQL 1;  5IT9 f;  3S1N I;  1K8A 2;  2NVT I;  1RQF A;  2KPI A;  4NOZ A;  3D9X A;  1K9M 2;  1Z01 A;  4NBC A;  3GKQ A;  4A3E I;  3CCV 1;  3S2H I;  1KQS Y;  4X6A I;  1X0T A;  2DE7 A;  2JA5 I;  1VQ4 Z;  3QWU A;  3IF8 A;  3PO3 S;  1VQ9 Z;  3CCE 1;  2VUG A;  1VQP 1;  2E2J I;  3ESW A;  1K8A 1;  3D6W A;  1RO2 A;  1Q7Y 2;  3HOW I;  1X3Z A;  2JMO A;  1K9M 1;  4MXU A;  3VTN A;  3RZD I;  3FKI I;  3HOV I;  4A3G I;  4RVD A;  1VQO Z;  3CCL Z;  1ZH1 A;  1VQ8 Z;  1VQ6 1;  4NBE A;  1TWH I;  5FLM I;  2DE6 A;  3NH8 A;  4DQY B;  1M90 2;  4HH4 A;  3GTO I;  3U50 C;  2ZAE B;  1KC8 1;  3CPW Z;  3GTG I;  1S72 Z;  3PO3 I;  1TWA I;  3S1R I;  1Z02 A;  4NBG A;  5A2Q b;  4RVH A;  3I55 1;  1DL6 A;  4RV9 A;  1WW9 A;  1TWG I;  3BG0 B;  3EER A;  4A3M I;  3CCR Z;  4NH1 C;  3G71 Z;  2V8K A;  1YJN 1;  3RZO I;  1YJW Z;  1Q86 2;  3CME Z;  5D1O B;  3H3V J;  1K73 1;  4MD9 A;  4A3D I;  4A3L I;  5C4J I;  1VLA A;  3CCU Z;  4A3F I;  1I6H I;  2P28 A;  2OTJ 1;  3CC4 Z;  3M4O I;  4E2W A;  2O4H A;  3I56 1;  1QVG Z;  3S17 I;  1PFT A;  3VMI A;  2WAQ A;  1S7M A;  5C3E I;  2JS4 A;  2AKL A;  4E30 A;  3CC2 Z;  5D1O A;  2PMZ A;  3MON A;  4RVF A;  3CCS Z;  1VQ5 Z;  2H85 A;  3F3P C;  2QRE B;  1YIJ 1;  2BJO A;  3CMA 1;  1QVF Z;  4HGY A;  3S16 I;  2VUM I;  1RLY A;  3IX0 A;  3CD6 Z;  1RO4 A;  1M1K 1;  2DE5 A;  3MZK B;  5C44 I;  2P3Y A;  3GTK I;  1SFO I;  3G4S Z;  3Q87 A;  2RPR A;  1VQM Z;  3I4N I;  3S1M I;  3CCQ Z;  2OOX B;  1VQ7 1;  5AN9 F;  3OW2 Y;  4DGL A;  2QA4 1;  3PO2 I;  4CL1 A;  1YIT Z;  4MH4 A;  2K5R A;  2LIY A;  3CCM Z;  5T6B A;  3NH4 A;  1YJ9 Z;  2K3R A;  1Y1V S;  1TWC I;  2GU2 A;  2I3C A;  4E2X A;  2W04 A;  1Z03 A;  1W2B Y;  1NUI A;  2JR6 A;  3G6E 1;  2V8I A;  5FLX f;  2QEX 1;  3CC7 1;  4A3B I;  2EGT A;  4DK1 A;  4RVG A;  1YI2 1;  1K83 I;  4BY1 I;  3J81 b;  1VQK Z;  3S15 I;  3CCJ Z;  3HOU I;  1VQL Z;  1Q7Y 1;  1NJI 2;  3VMG A;  2OTL 1;  1YIJ Z;  2O53 A;  4HGZ A;  1LQL A;  3NH5 A;  3P5J B;  1Q82 2;  2NVQ I;  1L1O C;  2VF1 A;  2YU9 I;  2JUB A;  2Y0S A;  2E9H A;  3CCV Z;  1N8R 2;  3LUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...