1RO4A

Rdc-derived models of the zinc ribbon domain of human general transcription factor tfiib (zinc free structures)
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
58
structure length
58
Chain Sequence
ASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription initiation factor IIB
publication title Probing Zn2+-binding effects on the zinc-ribbon domain of human general transcription factor TFIIB.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 2
structure length 58
sequence length 58
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08271 TF_Zn_Ribbon TFIIB zinc-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1ro4A00
3S14I 4NB8A 3S2DI 4Y7NI 2J6AA 4XX2A 2JA6I 2DE5A 1X3ZA 3EERA 4NB9A 3GTMI 2E2II 2AKLA 5C3EI 2YU9I 4BY1I 4NBAA 1WCMI 2NVYI 1I6HI 4Y52I 2R93I 1X3WA 2B63I 3GTGI 3GCFA 1I3QI 3HOUI 2E2HI 3PO3I 3Q87A 3S16I 4BY7I 5C44I 1LQLA 4A3MI 1TWFI 2R92I 2NVTI 2JNYA 3S1NI 5IP7I 2DE7A 4A3FI 1ML8A 1USPA 1Y1VS 5IP9I 4NBEA 3GTJI 1VLAA 4A3GI 5CM2M 3HOXI 3S1MI 1TWCI 3VMIA 3VMHA 3ESWA 4BXXI 4MH4A 2VUMI 1I50I 3U50C 3GKQA 2JR6A 2RBLA 3S15I 4NBCA 2JS4A 4NBFA 4A3EI 1K83I 1QYPA 1DL6A 3H0GI 1Y1WI 1NUIA 3PO2I 2P3YA 3GTMS 3I4NI 4A93I 4BBRI 2DE6A 4NBBA 3M4OI 3HOVI 2BJOA 3K7AI 3LUSA 4QTTA 3S1RI 2JA8I 4A3DI 3M3YI 1YUAA 3H3VJ 3D6WA 3CQZI 5FLMI 3HOWI 2NVQI 3HOZI 2HF1A 1ZB9A 3GTQI 3PO3S 2NVXI 2R7ZI 1N2FA 1R9TI 3HOYI 3VMGA 1TFIA 1RLYA 1SFOI 3VB9A 2KPIA 4A3LI 3I07A 2K5RA 2E2JI 3S2HI 1TWAI 3I4MI 3S1QI 1USPB 4A3II 4A3CI 3S17I 4NBGA 3GTPI 4A3JI 3GTKI 4A3BI 1ZB8A 1PFTA 3GTOI 3FKII 4A3KI 5C4XI 1Y1VI 1WW9A 4QTUA 1L1OC 4X6AI 4NOZA 4BBSI 2F4MA 2PK7A 3RZOI 4NBDA 4NBHA 2JA7I 3RZDI 2F4OA 1TWHI 5C4JI 3GTLI 1TWGI 1RO4A 2JA5I
chains in the Genus database with same CATH superfamily
3J7A4 3S14I 3VTNA 3J80f 2JA6I 4NB9A 3JAMf 2QEXZ 2AKLA 2EGTA 1NP6A 4BY1I 4Y52I 1WIIA 1ZH1A 3CCLZ 1VQ91 2E7ZA 3HOUI 2E2HI 1W2BY 3PO3I 2V8KA 5C44I 1P9NA 1TWFI 1YHQZ 3S1NI 4TNUA 4A3FI 1VQO1 5IT9b 4E2ZA 1QXFA 1USPA 3HOXI 5FLXf 3CC2Z 3VMHA 4NH1C 2G2KA 2OTLZ 4E2YA 4MH4A 3TE5B 4E2WA 2VUMI 1QVGZ 3D2LA 1YJWZ 2RBLA 4NBCA 1YI21 4E2XA 1DL6A 2JMOA 2JIRA 1RQFA 1YIJ1 3J81b 3PO2I 3GTMS 4NFRA 3I4NI 2QRDB 2I3CA 4NBBA 4DGLA 3M4OI 3K7AI 1KD11 4A3DI 3D6WA 4MD7A 1KQSY 1VQ6Z 3HOZI 3CCJZ 1ZB9A 3CCS1 4MD9A 3HOYI 1YUKA 4HGZA 2PMZA 1VQMZ 3OW2Y 2E2JI 2IV2X 3S1QI 1RNIA 1KC81 3S17I 2OZKA 2VPXA 2GTHA 3CC41 1ZB8A 1VQPZ 1JJ2Y 2V8JA 3CCUZ 1Y1VI 3F3PC 1M901 1L1OC 4X6AI 5D1OA 4E32A 3CMAZ 3EEDA 4E33A 1M1K1 3I55Z 2OTJZ 4XX2A 5A2Qf 1X3ZA 3CME1 4E31A 1KD12 3G4SZ 1Q16A 3CXCZ 4NBAA 2AYDA 1WCMI 2NAPA 1I6HI 3IR7A 1VQN1 1S7MA 1X3WA 1VQ4Z 3GTGI 1Z03A 1I3QI 3S16I 1LQLA 2VPWA 2QKDA 3CCQZ 1KC82 3I56Z 1RO0A 1ML8A 3P5JB 2IZ4A 3FQMA 2HU9A 2VPYA 2QA4Z 4BXXI 1YJN1 1M902 2KI7B 1RO2A 3F3FC 4MRIA 3CPWY 3KIHA 2QEX1 2M6NA 2JS4A 4NBFA 1K83I 4CL1A 1Y1WI 3CCL1 1M1K2 4RVHA 2P3YA 2JIQA 1KQSZ 4A93I 5T64A 1VQ9Z 4BBRI 2DE6A 3MZKB 3BG1B 1YUAA 1YITZ 2W03A 2O53A 3HOWI 1K9M1 1VQOZ 3GTQI 2R7ZI 1VQ81 1N2FA 3CC21 2OOYB 3VMGA 1SFOI 2OTL1 3TDHB 2V3VA 2VPZA 1K731 2V45A 1JJ2Z 3I4MI 2LFUA 1USPB 3CCMZ 4A3II 4A3CI 2QLVB 1JWHC 3GTPI 1YJW1 4A3BI 1SIWA 3T4NB 4E30A 5IT9f 3GTOI 2LIYA 1YI2Z 1WW9A 3HKZA 1Q7Y1 4NBDA 2JA7I 1FDIA 1YJ9Z 4S1TA 2JUBA 1VQLZ 2F4OA 1TWHI 2W04A 5C4JI 1WZNA 2JA5I 1VQ61 3CCEZ 1N8R1 1Q861 3CD6Z 1VQ7Z 3S2DI 3FQQA 3IF8A 1Z01A 1Q821 3EERA 3G6E1 3J81f 3GTMI 2V8IA 1VQM1 2YU9I 3D9XA 1Q811 1K8A1 3QWUA 1VQ51 3Q87A 1K732 2NVTI 3G71Z 3CCVZ 1VQKZ 1QVGY 1S72Z 5IP9I 3GTJI 1VLAA 4A3GI 1TWCI 3VMIA 3CMA1 3CC7Z 1QVFY 1W2BZ 1Q7Y2 2JIMA 3NDJA 1QF8A 5LL6f 3U50C 3GKQA 3S15I 3IFUA 4MONA 4A3EI 1QYPA 3J80b 1N8R2 1Q862 3H0GI 1VQ41 3JAMb 2O4HA 1Q822 3NH5A 3CCRZ 3HOVI 2BJOA 3LUSA 4QTTA 3CCQ1 3NH8A 3S1RI 1Q812 3H3VJ 2QR1B 2HF1A 2GTIA 3PO3S 2NVXI 1R9TI 3MONA 2Q4ZA 1RLYA 4EWCA 1WJ2A 4A3LI 3I07A 2K5RA 1YJNZ 5AN9F 5FLXb 4A3JI 3GTKI 1KRLA 1PFTA 4HH4A 3FKII 1FDOA 2Y0SA 4AYBA 1NJI1 1YHQ1 2M48A 1Z02A 2RIQA 4NOZA 2F4MA 3RZOI 2YADA 3OW2Z 4NBHA 4MD8A 3CXCY 2WB1A 3GTLI 1YIT1 4Y7NI 1RO4A 2ZAEB 4NB8A 3NH4A 2J6AA 2DE5A 1VQ8Z 2E2II 5C3EI 3CCM1 2E9HA 2LEXA 2NVYI 2R93I 2JIPA 5D1PA 2B63I 1YIJZ 3GCFA 3NDIA 2QREB 4BY7I 4A3MI 2R92I 2JNYA 5IP7I 2DE7A 3CCJ1 2Q51A 1YJ91 1QVFZ 4RVFA 1Y1VS 1VQL1 4NBEA 2JIOA 3BG0B 3CCSZ 2VUGA 5CM2M 3S1MI 5T67A 1NJI2 3ESWA 3CCE1 3CD61 1VQ71 2H85A 2RHBA 1K9M2 1VQP1 1I50I 3CCU1 2PM9A 3G6EZ 3IX0A 2JR6A 3CC4Z 2GU2A 2RT9A 4RVDA 2IZ3A 5A2Qb 1NUIA 4DK1A 1X0TA 2P28A 3CPWZ 3G711 2JA8I 1VQ5Z 5D1OB 3CCV1 1VQK1 3M3YI 1S721 3I551 2OTJ1 3CQZI 5FLMI 2NVQI 3NFZA 4MXUA 5T6BA 4HGYA 3G4S1 1TFIA 3CC71 3VB9A 3CMEZ 3MZLB 2KPIA 2QRCB 3S2HI 1TWAI 2R6MA 4RS4A 2OOXB 1Y8CA 1VQNZ 2RPRA 4NBGA 2K3RA 4A3KI 5C4XI 2WAQA 4QTUA 3KIFA 3I561 4BBSI 2PK7A 1AA6A 1K8A2 3CCR1 3RZDI 2QA41 2VF1A 4DQYB 1TWGI 4RV9A 4RVGA
chains in the Genus database with same CATH topology
3J7A4 3S14I 3VTNA 3J80f 2JA6I 4NB9A 3JAMf 2QEXZ 2AKLA 2EGTA 1NP6A 4BY1I 4Y52I 1WIIA 1ZH1A 3CCLZ 1VQ91 3HOUI 2E2HI 1W2BY 3PO3I 2V8KA 5C44I 1P9NA 1TWFI 1YHQZ 3S1NI 4TNUA 4A3FI 1VQO1 5IT9b 4E2ZA 1USPA 3HOXI 5FLXf 3CC2Z 3VMHA 4NH1C 2G2KA 2OTLZ 4E2YA 4MH4A 3TE5B 4E2WA 2VUMI 1QVGZ 1YJWZ 2RBLA 4NBCA 1YI21 4E2XA 1DL6A 2JMOA 1RQFA 1YIJ1 3J81b 3PO2I 3GTMS 4NFRA 3I4NI 2QRDB 2I3CA 4NBBA 4DGLA 3M4OI 3K7AI 1KD11 4A3DI 3D6WA 4MD7A 1KQSY 1VQ6Z 3HOZI 3CCJZ 1ZB9A 3CCS1 4MD9A 3HOYI 1YUKA 4HGZA 2PMZA 1VQMZ 3OW2Y 2E2JI 3S1QI 1RNIA 1KC81 3S17I 2OZKA 2GTHA 3CC41 1ZB8A 1VQPZ 1JJ2Y 2V8JA 3CCUZ 1Y1VI 3F3PC 1M901 1L1OC 4X6AI 5D1OA 4E32A 3CMAZ 3EEDA 4E33A 1M1K1 3I55Z 2OTJZ 4XX2A 5A2Qf 1X3ZA 3CME1 4E31A 1KD12 3G4SZ 3CXCZ 4NBAA 1WCMI 1I6HI 1VQN1 1S7MA 1X3WA 1VQ4Z 3GTGI 1Z03A 1I3QI 3S16I 1LQLA 2QKDA 3CCQZ 1KC82 3I56Z 1RO0A 1ML8A 3P5JB 2IZ4A 3FQMA 2HU9A 2QA4Z 4BXXI 1YJN1 1M902 2KI7B 1RO2A 3F3FC 4MRIA 3CPWY 3KIHA 2QEX1 2M6NA 2JS4A 4NBFA 1K83I 4CL1A 1Y1WI 3CCL1 1M1K2 4RVHA 2P3YA 1KQSZ 4A93I 5T64A 1VQ9Z 4BBRI 2DE6A 3MZKB 3BG1B 1YUAA 1YITZ 2W03A 2O53A 3HOWI 1K9M1 1VQOZ 3GTQI 2R7ZI 1VQ81 1N2FA 3CC21 2OOYB 3VMGA 1SFOI 2OTL1 3TDHB 1K731 1JJ2Z 3I4MI 2LFUA 1USPB 3CCMZ 4A3II 4A3CI 2QLVB 1JWHC 3GTPI 1YJW1 4A3BI 3T4NB 4E30A 5IT9f 3GTOI 2LIYA 1YI2Z 1WW9A 3HKZA 1Q7Y1 4NBDA 2JA7I 1YJ9Z 4S1TA 2JUBA 1VQLZ 2F4OA 1TWHI 2W04A 5C4JI 2JA5I 1VQ61 3CCEZ 1N8R1 1Q861 3CD6Z 1VQ7Z 3S2DI 3FQQA 3IF8A 1Z01A 1Q821 3EERA 3G6E1 3J81f 3GTMI 2V8IA 1VQM1 2YU9I 3D9XA 1Q811 1K8A1 3QWUA 1VQ51 3Q87A 1K732 2NVTI 3G71Z 3CCVZ 1VQKZ 1QVGY 1S72Z 5IP9I 3GTJI 1VLAA 4A3GI 1TWCI 3VMIA 3CMA1 3CC7Z 1QVFY 1W2BZ 1Q7Y2 3NDJA 1QF8A 5LL6f 3U50C 3GKQA 3S15I 3IFUA 4MONA 4A3EI 1QYPA 3J80b 1N8R2 1Q862 3H0GI 1VQ41 3JAMb 2O4HA 1Q822 3NH5A 3CCRZ 3HOVI 2BJOA 3LUSA 4QTTA 3CCQ1 3NH8A 3S1RI 1Q812 3H3VJ 2QR1B 2HF1A 2GTIA 3PO3S 2NVXI 1R9TI 3MONA 2Q4ZA 1RLYA 4EWCA 4A3LI 3I07A 2K5RA 1YJNZ 5AN9F 5FLXb 4A3JI 3GTKI 1KRLA 1PFTA 4HH4A 3FKII 2Y0SA 4AYBA 1NJI1 1YHQ1 2M48A 1Z02A 2RIQA 4NOZA 2F4MA 3RZOI 2YADA 3OW2Z 4NBHA 4MD8A 3CXCY 2WB1A 3GTLI 1YIT1 4Y7NI 1RO4A 2ZAEB 4NB8A 3NH4A 2J6AA 2DE5A 1VQ8Z 2E2II 5C3EI 3CCM1 2E9HA 2NVYI 2R93I 5D1PA 2B63I 1YIJZ 3GCFA 3NDIA 2QREB 4BY7I 4A3MI 2R92I 2JNYA 5IP7I 2DE7A 3CCJ1 2Q51A 1YJ91 1QVFZ 4RVFA 1Y1VS 1VQL1 4NBEA 3BG0B 3CCSZ 2VUGA 5CM2M 3S1MI 5T67A 1NJI2 3ESWA 3CCE1 3CD61 1VQ71 2H85A 2RHBA 1K9M2 1VQP1 1I50I 3CCU1 2PM9A 3G6EZ 3IX0A 2JR6A 3CC4Z 2GU2A 2RT9A 4RVDA 2IZ3A 5A2Qb 1NUIA 4DK1A 1X0TA 2P28A 3CPWZ 3G711 2JA8I 1VQ5Z 5D1OB 3CCV1 1VQK1 3M3YI 1S721 3I551 2OTJ1 3CQZI 5FLMI 2NVQI 3NFZA 4MXUA 5T6BA 4HGYA 3G4S1 1TFIA 3CC71 3VB9A 3CMEZ 3MZLB 2KPIA 2QRCB 3S2HI 1TWAI 2R6MA 4RS4A 2OOXB 1VQNZ 2RPRA 4NBGA 2K3RA 4A3KI 5C4XI 2WAQA 4QTUA 3KIFA 3I561 4BBSI 2PK7A 1K8A2 3CCR1 3RZDI 2QA41 2VF1A 4DQYB 1TWGI 4RV9A 4RVGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S14 I;  4NB8 A;  3S2D I;  4Y7N I;  2J6A A;  4XX2 A;  2JA6 I;  2DE5 A;  1X3Z A;  3EER A;  4NB9 A;  3GTM I;  2E2I I;  2AKL A;  5C3E I;  2YU9 I;  4BY1 I;  4NBA A;  1WCM I;  2NVY I;  1I6H I;  4Y52 I;  2R93 I;  1X3W A;  2B63 I;  3GTG I;  3GCF A;  1I3Q I;  3HOU I;  2E2H I;  3PO3 I;  3Q87 A;  3S16 I;  4BY7 I;  5C44 I;  1LQL A;  4A3M I;  1TWF I;  2R92 I;  2NVT I;  2JNY A;  3S1N I;  5IP7 I;  2DE7 A;  4A3F I;  1ML8 A;  1USP A;  1Y1V S;  5IP9 I;  4NBE A;  3GTJ I;  1VLA A;  4A3G I;  5CM2 M;  3HOX I;  3S1M I;  1TWC I;  3VMI A;  3VMH A;  3ESW A;  4BXX I;  4MH4 A;  2VUM I;  1I50 I;  3U50 C;  3GKQ A;  2JR6 A;  2RBL A;  3S15 I;  4NBC A;  2JS4 A;  4NBF A;  4A3E I;  1K83 I;  1QYP A;  1DL6 A;  3H0G I;  1Y1W I;  1NUI A;  3PO2 I;  2P3Y A;  3GTM S;  3I4N I;  4A93 I;  4BBR I;  2DE6 A;  4NBB A;  3M4O I;  3HOV I;  2BJO A;  3K7A I;  3LUS A;  4QTT A;  3S1R I;  2JA8 I;  4A3D I;  3M3Y I;  1YUA A;  3H3V J;  3D6W A;  3CQZ I;  5FLM I;  3HOW I;  2NVQ I;  3HOZ I;  2HF1 A;  1ZB9 A;  3GTQ I;  3PO3 S;  2NVX I;  2R7Z I;  1N2F A;  1R9T I;  3HOY I;  3VMG A;  1TFI A;  1RLY A;  1SFO I;  3VB9 A;  2KPI A;  4A3L I;  3I07 A;  2K5R A;  2E2J I;  3S2H I;  1TWA I;  3I4M I;  3S1Q I;  1USP B;  4A3I I;  4A3C I;  3S17 I;  4NBG A;  3GTP I;  4A3J I;  3GTK I;  4A3B I;  1ZB8 A;  1PFT A;  3GTO I;  3FKI I;  4A3K I;  5C4X I;  1Y1V I;  1WW9 A;  4QTU A;  1L1O C;  4X6A I;  4NOZ A;  4BBS I;  2F4M A;  2PK7 A;  3RZO I;  4NBD A;  4NBH A;  2JA7 I;  3RZD I;  2F4O A;  1TWH I;  5C4J I;  3GTL I;  1TWG I;  1RO4 A;  2JA5 I; 
#chains in the Genus database with same CATH topology
 3J7A 4;  3S14 I;  3VTN A;  3J80 f;  2JA6 I;  4NB9 A;  3JAM f;  2QEX Z;  2AKL A;  2EGT A;  1NP6 A;  4BY1 I;  4Y52 I;  1WII A;  1ZH1 A;  3CCL Z;  1VQ9 1;  2E7Z A;  3HOU I;  2E2H I;  1W2B Y;  3PO3 I;  2V8K A;  5C44 I;  1P9N A;  1TWF I;  1YHQ Z;  3S1N I;  4TNU A;  4A3F I;  1VQO 1;  5IT9 b;  4E2Z A;  1QXF A;  1USP A;  3HOX I;  5FLX f;  3CC2 Z;  3VMH A;  4NH1 C;  2G2K A;  2OTL Z;  4E2Y A;  4MH4 A;  3TE5 B;  4E2W A;  2VUM I;  1QVG Z;  3D2L A;  1YJW Z;  2RBL A;  4NBC A;  1YI2 1;  4E2X A;  1DL6 A;  2JMO A;  2JIR A;  1RQF A;  1YIJ 1;  3J81 b;  3PO2 I;  3GTM S;  4NFR A;  3I4N I;  2QRD B;  2I3C A;  4NBB A;  4DGL A;  3M4O I;  3K7A I;  1KD1 1;  4A3D I;  3D6W A;  4MD7 A;  1KQS Y;  1VQ6 Z;  3HOZ I;  3CCJ Z;  1ZB9 A;  3CCS 1;  4MD9 A;  3HOY I;  1YUK A;  4HGZ A;  2PMZ A;  1VQM Z;  3OW2 Y;  2E2J I;  2IV2 X;  3S1Q I;  1RNI A;  1KC8 1;  3S17 I;  2OZK A;  2VPX A;  2GTH A;  3CC4 1;  1ZB8 A;  1VQP Z;  1JJ2 Y;  2V8J A;  3CCU Z;  1Y1V I;  3F3P C;  1M90 1;  1L1O C;  4X6A I;  5D1O A;  4E32 A;  3CMA Z;  3EED A;  4E33 A;  1M1K 1;  3I55 Z;  2OTJ Z;  4XX2 A;  5A2Q f;  1X3Z A;  3CME 1;  4E31 A;  1KD1 2;  3G4S Z;  1Q16 A;  3CXC Z;  4NBA A;  2AYD A;  1WCM I;  2NAP A;  1I6H I;  3IR7 A;  1VQN 1;  1S7M A;  1X3W A;  1VQ4 Z;  3GTG I;  1Z03 A;  1I3Q I;  3S16 I;  1LQL A;  2VPW A;  2QKD A;  3CCQ Z;  1KC8 2;  3I56 Z;  1RO0 A;  1ML8 A;  3P5J B;  2IZ4 A;  3FQM A;  2HU9 A;  2VPY A;  2QA4 Z;  4BXX I;  1YJN 1;  1M90 2;  2KI7 B;  1RO2 A;  3F3F C;  4MRI A;  3CPW Y;  3KIH A;  2QEX 1;  2M6N A;  2JS4 A;  4NBF A;  1K83 I;  4CL1 A;  1Y1W I;  3CCL 1;  1M1K 2;  4RVH A;  2P3Y A;  2JIQ A;  1KQS Z;  4A93 I;  5T64 A;  1VQ9 Z;  4BBR I;  2DE6 A;  3MZK B;  3BG1 B;  1YUA A;  1YIT Z;  2W03 A;  2O53 A;  3HOW I;  1K9M 1;  1VQO Z;  3GTQ I;  2R7Z I;  1VQ8 1;  1N2F A;  3CC2 1;  2OOY B;  3VMG A;  1SFO I;  2OTL 1;  3TDH B;  2V3V A;  2VPZ A;  1K73 1;  2V45 A;  1JJ2 Z;  3I4M I;  2LFU A;  1USP B;  3CCM Z;  4A3I I;  4A3C I;  2QLV B;  1JWH C;  3GTP I;  1YJW 1;  4A3B I;  1SIW A;  3T4N B;  4E30 A;  5IT9 f;  3GTO I;  2LIY A;  1YI2 Z;  1WW9 A;  3HKZ A;  1Q7Y 1;  4NBD A;  2JA7 I;  1FDI A;  1YJ9 Z;  4S1T A;  2JUB A;  1VQL Z;  2F4O A;  1TWH I;  2W04 A;  5C4J I;  1WZN A;  2JA5 I;  1VQ6 1;  3CCE Z;  1N8R 1;  1Q86 1;  3CD6 Z;  1VQ7 Z;  3S2D I;  3FQQ A;  3IF8 A;  1Z01 A;  1Q82 1;  3EER A;  3G6E 1;  3J81 f;  3GTM I;  2V8I A;  1VQM 1;  2YU9 I;  3D9X A;  1Q81 1;  1K8A 1;  3QWU A;  1VQ5 1;  3Q87 A;  1K73 2;  2NVT I;  3G71 Z;  3CCV Z;  1VQK Z;  1QVG Y;  1S72 Z;  5IP9 I;  3GTJ I;  1VLA A;  4A3G I;  1TWC I;  3VMI A;  3CMA 1;  3CC7 Z;  1QVF Y;  1W2B Z;  1Q7Y 2;  2JIM A;  3NDJ A;  1QF8 A;  5LL6 f;  3U50 C;  3GKQ A;  3S15 I;  3IFU A;  4MON A;  4A3E I;  1QYP A;  3J80 b;  1N8R 2;  1Q86 2;  3H0G I;  1VQ4 1;  3JAM b;  2O4H A;  1Q82 2;  3NH5 A;  3CCR Z;  3HOV I;  2BJO A;  3LUS A;  4QTT A;  3CCQ 1;  3NH8 A;  3S1R I;  1Q81 2;  3H3V J;  2QR1 B;  2HF1 A;  2GTI A;  3PO3 S;  2NVX I;  1R9T I;  3MON A;  2Q4Z A;  1RLY A;  4EWC A;  1WJ2 A;  4A3L I;  3I07 A;  2K5R A;  1YJN Z;  5AN9 F;  5FLX b;  4A3J I;  3GTK I;  1KRL A;  1PFT A;  4HH4 A;  3FKI I;  1FDO A;  2Y0S A;  4AYB A;  1NJI 1;  1YHQ 1;  2M48 A;  1Z02 A;  2RIQ A;  4NOZ A;  2F4M A;  3RZO I;  2YAD A;  3OW2 Z;  4NBH A;  4MD8 A;  3CXC Y;  2WB1 A;  3GTL I;  1YIT 1;  4Y7N I;  1RO4 A;  2ZAE B;  4NB8 A;  3NH4 A;  2J6A A;  2DE5 A;  1VQ8 Z;  2E2I I;  5C3E I;  3CCM 1;  2E9H A;  2LEX A;  2NVY I;  2R93 I;  2JIP A;  5D1P A;  2B63 I;  1YIJ Z;  3GCF A;  3NDI A;  2QRE B;  4BY7 I;  4A3M I;  2R92 I;  2JNY A;  5IP7 I;  2DE7 A;  3CCJ 1;  2Q51 A;  1YJ9 1;  1QVF Z;  4RVF A;  1Y1V S;  1VQL 1;  4NBE A;  2JIO A;  3BG0 B;  3CCS Z;  2VUG A;  5CM2 M;  3S1M I;  5T67 A;  1NJI 2;  3ESW A;  3CCE 1;  3CD6 1;  1VQ7 1;  2H85 A;  2RHB A;  1K9M 2;  1VQP 1;  1I50 I;  3CCU 1;  2PM9 A;  3G6E Z;  3IX0 A;  2JR6 A;  3CC4 Z;  2GU2 A;  2RT9 A;  4RVD A;  2IZ3 A;  5A2Q b;  1NUI A;  4DK1 A;  1X0T A;  2P28 A;  3CPW Z;  3G71 1;  2JA8 I;  1VQ5 Z;  5D1O B;  3CCV 1;  1VQK 1;  3M3Y I;  1S72 1;  3I55 1;  2OTJ 1;  3CQZ I;  5FLM I;  2NVQ I;  3NFZ A;  4MXU A;  5T6B A;  4HGY A;  3G4S 1;  1TFI A;  3CC7 1;  3VB9 A;  3CME Z;  3MZL B;  2KPI A;  2QRC B;  3S2H I;  1TWA I;  2R6M A;  4RS4 A;  2OOX B;  1Y8C A;  1VQN Z;  2RPR A;  4NBG A;  2K3R A;  4A3K I;  5C4X I;  2WAQ A;  4QTU A;  3KIF A;  3I56 1;  4BBS I;  2PK7 A;  1AA6 A;  1K8A 2;  3CCR 1;  3RZD I;  2QA4 1;  2VF1 A;  4DQY B;  1TWG I;  4RV9 A;  4RVG A; 
#chains in the Genus database with same CATH homology
 3J7A 4;  3S14 I;  3VTN A;  3J80 f;  2JA6 I;  4NB9 A;  3JAM f;  2QEX Z;  2AKL A;  2EGT A;  1NP6 A;  4BY1 I;  4Y52 I;  1WII A;  1ZH1 A;  3CCL Z;  1VQ9 1;  3HOU I;  2E2H I;  1W2B Y;  3PO3 I;  2V8K A;  5C44 I;  1P9N A;  1TWF I;  1YHQ Z;  3S1N I;  4TNU A;  4A3F I;  1VQO 1;  5IT9 b;  4E2Z A;  1USP A;  3HOX I;  5FLX f;  3CC2 Z;  3VMH A;  4NH1 C;  2G2K A;  2OTL Z;  4E2Y A;  4MH4 A;  3TE5 B;  4E2W A;  2VUM I;  1QVG Z;  1YJW Z;  2RBL A;  4NBC A;  1YI2 1;  4E2X A;  1DL6 A;  2JMO A;  1RQF A;  1YIJ 1;  3J81 b;  3PO2 I;  3GTM S;  4NFR A;  3I4N I;  2QRD B;  2I3C A;  4NBB A;  4DGL A;  3M4O I;  3K7A I;  1KD1 1;  4A3D I;  3D6W A;  4MD7 A;  1KQS Y;  1VQ6 Z;  3HOZ I;  3CCJ Z;  1ZB9 A;  3CCS 1;  4MD9 A;  3HOY I;  1YUK A;  4HGZ A;  2PMZ A;  1VQM Z;  3OW2 Y;  2E2J I;  3S1Q I;  1RNI A;  1KC8 1;  3S17 I;  2OZK A;  2GTH A;  3CC4 1;  1ZB8 A;  1VQP Z;  1JJ2 Y;  2V8J A;  3CCU Z;  1Y1V I;  3F3P C;  1M90 1;  1L1O C;  4X6A I;  5D1O A;  4E32 A;  3CMA Z;  3EED A;  4E33 A;  1M1K 1;  3I55 Z;  2OTJ Z;  4XX2 A;  5A2Q f;  1X3Z A;  3CME 1;  4E31 A;  1KD1 2;  3G4S Z;  3CXC Z;  4NBA A;  1WCM I;  1I6H I;  1VQN 1;  1S7M A;  1X3W A;  1VQ4 Z;  3GTG I;  1Z03 A;  1I3Q I;  3S16 I;  1LQL A;  2QKD A;  3CCQ Z;  1KC8 2;  3I56 Z;  1RO0 A;  1ML8 A;  3P5J B;  2IZ4 A;  3FQM A;  2HU9 A;  2QA4 Z;  4BXX I;  1YJN 1;  1M90 2;  2KI7 B;  1RO2 A;  3F3F C;  4MRI A;  3CPW Y;  3KIH A;  2QEX 1;  2M6N A;  2JS4 A;  4NBF A;  1K83 I;  4CL1 A;  1Y1W I;  3CCL 1;  1M1K 2;  4RVH A;  2P3Y A;  1KQS Z;  4A93 I;  5T64 A;  1VQ9 Z;  4BBR I;  2DE6 A;  3MZK B;  3BG1 B;  1YUA A;  1YIT Z;  2W03 A;  2O53 A;  3HOW I;  1K9M 1;  1VQO Z;  3GTQ I;  2R7Z I;  1VQ8 1;  1N2F A;  3CC2 1;  2OOY B;  3VMG A;  1SFO I;  2OTL 1;  3TDH B;  1K73 1;  1JJ2 Z;  3I4M I;  2LFU A;  1USP B;  3CCM Z;  4A3I I;  4A3C I;  2QLV B;  1JWH C;  3GTP I;  1YJW 1;  4A3B I;  3T4N B;  4E30 A;  5IT9 f;  3GTO I;  2LIY A;  1YI2 Z;  1WW9 A;  3HKZ A;  1Q7Y 1;  4NBD A;  2JA7 I;  1YJ9 Z;  4S1T A;  2JUB A;  1VQL Z;  2F4O A;  1TWH I;  2W04 A;  5C4J I;  2JA5 I;  1VQ6 1;  3CCE Z;  1N8R 1;  1Q86 1;  3CD6 Z;  1VQ7 Z;  3S2D I;  3FQQ A;  3IF8 A;  1Z01 A;  1Q82 1;  3EER A;  3G6E 1;  3J81 f;  3GTM I;  2V8I A;  1VQM 1;  2YU9 I;  3D9X A;  1Q81 1;  1K8A 1;  3QWU A;  1VQ5 1;  3Q87 A;  1K73 2;  2NVT I;  3G71 Z;  3CCV Z;  1VQK Z;  1QVG Y;  1S72 Z;  5IP9 I;  3GTJ I;  1VLA A;  4A3G I;  1TWC I;  3VMI A;  3CMA 1;  3CC7 Z;  1QVF Y;  1W2B Z;  1Q7Y 2;  3NDJ A;  1QF8 A;  5LL6 f;  3U50 C;  3GKQ A;  3S15 I;  3IFU A;  4MON A;  4A3E I;  1QYP A;  3J80 b;  1N8R 2;  1Q86 2;  3H0G I;  1VQ4 1;  3JAM b;  2O4H A;  1Q82 2;  3NH5 A;  3CCR Z;  3HOV I;  2BJO A;  3LUS A;  4QTT A;  3CCQ 1;  3NH8 A;  3S1R I;  1Q81 2;  3H3V J;  2QR1 B;  2HF1 A;  2GTI A;  3PO3 S;  2NVX I;  1R9T I;  3MON A;  2Q4Z A;  1RLY A;  4EWC A;  4A3L I;  3I07 A;  2K5R A;  1YJN Z;  5AN9 F;  5FLX b;  4A3J I;  3GTK I;  1KRL A;  1PFT A;  4HH4 A;  3FKI I;  2Y0S A;  4AYB A;  1NJI 1;  1YHQ 1;  2M48 A;  1Z02 A;  2RIQ A;  4NOZ A;  2F4M A;  3RZO I;  2YAD A;  3OW2 Z;  4NBH A;  4MD8 A;  3CXC Y;  2WB1 A;  3GTL I;  1YIT 1;  4Y7N I;  1RO4 A;  2ZAE B;  4NB8 A;  3NH4 A;  2J6A A;  2DE5 A;  1VQ8 Z;  2E2I I;  5C3E I;  3CCM 1;  2E9H A;  2NVY I;  2R93 I;  5D1P A;  2B63 I;  1YIJ Z;  3GCF A;  3NDI A;  2QRE B;  4BY7 I;  4A3M I;  2R92 I;  2JNY A;  5IP7 I;  2DE7 A;  3CCJ 1;  2Q51 A;  1YJ9 1;  1QVF Z;  4RVF A;  1Y1V S;  1VQL 1;  4NBE A;  3BG0 B;  3CCS Z;  2VUG A;  5CM2 M;  3S1M I;  5T67 A;  1NJI 2;  3ESW A;  3CCE 1;  3CD6 1;  1VQ7 1;  2H85 A;  2RHB A;  1K9M 2;  1VQP 1;  1I50 I;  3CCU 1;  2PM9 A;  3G6E Z;  3IX0 A;  2JR6 A;  3CC4 Z;  2GU2 A;  2RT9 A;  4RVD A;  2IZ3 A;  5A2Q b;  1NUI A;  4DK1 A;  1X0T A;  2P28 A;  3CPW Z;  3G71 1;  2JA8 I;  1VQ5 Z;  5D1O B;  3CCV 1;  1VQK 1;  3M3Y I;  1S72 1;  3I55 1;  2OTJ 1;  3CQZ I;  5FLM I;  2NVQ I;  3NFZ A;  4MXU A;  5T6B A;  4HGY A;  3G4S 1;  1TFI A;  3CC7 1;  3VB9 A;  3CME Z;  3MZL B;  2KPI A;  2QRC B;  3S2H I;  1TWA I;  2R6M A;  4RS4 A;  2OOX B;  1VQN Z;  2RPR A;  4NBG A;  2K3R A;  4A3K I;  5C4X I;  2WAQ A;  4QTU A;  3KIF A;  3I56 1;  4BBS I;  2PK7 A;  1K8A 2;  3CCR 1;  3RZD I;  2QA4 1;  2VF1 A;  4DQY B;  1TWG I;  4RV9 A;  4RVG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...