3GTMI

Co-complex of backtracked rna polymerase ii with tfiis
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 8
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtmI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtmI02
1WCMI 1ZB8A 4BBRI 2NVQI 3ESWA 3S16I 4X6AI 1Y1VS 2F4OA 1TWFI 3CQZI 3GTQI 3H3VJ 4A3MI 3HOVI 3PO3S 2NVTI 3GTMI 2E2HI 1RO4A 3GTLI 4A3CI 3S1MI 4QTUA 2K5RA 2J6AA 3GCFA 3LUSA 3K7AI 2R92I 2NVXI 2PK7A 3EERA 3GKQA 4NBEA 5IP7I 1NUIA 4NBAA 2AKLA 2RBLA 3S2DI 3M4OI 2JA8I 1TWCI 1TWGI 1TWAI 4NB9A 3S1NI 4BBSI 5FLMI 2DE7A 1N2FA 4QTTA 4A3KI 4A3FI 1PFTA 2NVYI 4Y52I 2VUMI 3VMIA 5IP9I 3GTJI 4BY1I 3HOXI 1R9TI 3U50C 1RLYA 3S1QI 3HOUI 4Y7NI 3S2HI 1QYPA 2JA5I 3S14I 4A3EI 3S1RI 2JA7I 3GTOI 3PO2I 2F4MA 4A3LI 4NB8A 4BY7I 3FKII 1Y1VI 4NBGA 2HF1A 4A3II 4A3JI 3VMHA 1SFOI 3PO3I 1I50I 1L1OC 4MH4A 3VB9A 3H0GI 1I6HI 4A3GI 2JA6I 3M3YI 4NBCA 2YU9I 5C3EI 2P3YA 2E2JI 3D6WA 5CM2M 1ZB9A 2BJOA 1YUAA 3VMGA 3S15I 1ML8A 4BXXI 3GTMS 5C44I 2JS4A 1K83I 1X3ZA 2JNYA 4A93I 1I3QI 1TWHI 4NBFA 3S17I 3I4MI 2DE5A 3GTGI 5C4XI 4NBDA 1Y1WI 3GTKI 3I4NI 1VLAA 2R7ZI 2KPIA 4A3DI 1LQLA 1DL6A 3RZOI 4NBBA 3Q87A 3GTPI 3RZDI 2JR6A 4NBHA 2B63I 3HOYI 1WW9A 1USPA 3HOZI 2DE6A 2R93I 4XX2A 4NOZA 1X3WA 4A3BI 1USPB 3HOWI 5C4JI 1TFIA 3I07A 2E2II
chains in the Genus database with same CATH superfamily
1WCMI 1ZB8A 2QA41 3S16I 5D1OA 2OOXB 5FLXf 4X6AI 4MRIA 3G4SZ 2F4OA 1VQKZ 1Z03A 3CC21 1VQL1 2KI7B 3G711 1VQ41 5D1OB 3TE5B 4QTUA 3GCFA 3LUSA 3D9XA 1WJ2A 3K7AI 1K732 2PM9A 5LL6f 2NVXI 3KIFA 3NDJA 2LFUA 1NUIA 2AKLA 2RBLA 3CCL1 3M4OI 2NAPA 1TWAI 4BBSI 2QRCB 3J81f 3CCUZ 1NJI1 1YJ9Z 3CD61 2VUMI 2V8KA 4HH4A 4MD9A 1VQN1 1VQ7Z 2VPXA 3CCR1 1VQ51 3S14I 1YJWZ 3P5JB 3PO2I 4A3LI 3FKII 1Q861 4RVDA 3CCMZ 4NBGA 4A3JI 3NDIA 3VMHA 2EGTA 4TNUA 3CCVZ 2VPWA 4MH4A 1KC82 1I6HI 4A3GI 4DK1A 3I551 2E2JI 2JIRA 1M1K1 2I3CA 2BJOA 3VMGA 1VQOZ 2IZ3A 3CXCZ 1ZH1A 3CMEZ 3D2LA 5C44I 1M901 2JS4A 1KQSY 2W04A 4E2XA 2V45A 2O53A 1TWHI 4NBFA 1YJN1 4NBDA 3NH4A 4MXUA 2P28A 1LQLA 2E9HA 4MONA 4RVFA 3RZDI 3CCJ1 3HOYI 3HOZI 2RHBA 3CMAZ 3CCQ1 2V8JA 2WAQA 3CD6Z 2JIOA 2R93I 4XX2A 2GTHA 2OZKA 2OTLZ 1X3WA 1K731 4A3BI 2GTIA 3HOWI 5C4JI 1Q862 2E7ZA 3FQQA 2E2II 2IZ4A 1VQPZ 1VQ61 1Y1VS 3F3PC 3GTQI 3CQZI 4A3MI 4HGZA 1AA6A 1RNIA 1RO4A 2K5RA 3G6E1 4NFRA 1W2BZ 1WIIA 2R92I 1S72Z 3CCSZ 2PK7A 3EERA 3GKQA 4NBEA 4NBAA 1M902 2QEX1 1YIT1 2VPYA 5IT9b 2DE7A 3FQMA 4AYBA 3KIHA 4A3KI 4A3FI 1KC81 4Y52I 3IFUA 3HOXI 3IF8A 3U50C 1FDIA 3OW2Y 3F3FC 2Q51A 3NFZA 4NB8A 2R6MA 1Y1VI 1RO0A 2OOYB 1QVFZ 3CCQZ 5T67A 2RT9A 1KRLA 3CC4Z 2HU9A 1YIJ1 3VB9A 3IX0A 4MD8A 2YU9I 2P3YA 1JJ2Y 2OTJ1 3D6WA 5FLXb 4E30A 3S15I 4S1TA 1X0TA 4RS4A 2Q4ZA 1VQ91 1K83I 3MONA 2JNYA 3MZKB 3I561 2DE5A 1VQM1 2Y0SA 3TDHB 1Y1WI 1VQ81 2KPIA 1YHQZ 3J81b 3CCE1 3GTPI 2JR6A 2QA4Z 2B63I 3VTNA 1WW9A 2JUBA 3CC71 1KD12 3CC2Z 1VQLZ 1YI21 3G71Z 2IV2X 3I07A 1VQ4Z 3CPWY 4BBRI 2NVQI 3ESWA 2V3VA 2QREB 4E2YA 3CCLZ 3HOVI 2NVTI 4MD7A 3GTLI 3S1MI 2J6AA 2ZAEB 3J80f 3G4S1 1VQK1 1VQNZ 3S2DI 3CCRZ 1TWGI 3S1NI 5FLMI 1WZNA 1RQFA 2RIQA 1VQ5Z 2WB1A 1N2FA 2VF1A 4QTTA 4EWCA 2O4HA 5IP9I 3GTJI 4BY1I 2JIPA 1Q821 3S1QI 1KQSZ 4Y7NI 4E33A 1P9NA 1NP6A 3S2HI 1QYPA 3CCU1 4DQYB 4A3EI 1YJ91 2F4MA 4BY7I 5D1PA 3I55Z 1QVGZ 5T64A 2K3RA 1VQ71 4E32A 3IR7A 3H0GI 5A2Qf 2YADA 1YJW1 1Q16A 1QVFY 2JA6I 3M3YI 4NBCA 5C3EI 3CCM1 5CM2M 1ZB9A 1YUAA 1ML8A 4BXXI 3CCV1 1YJNZ 4RVHA 3GTMS 1S7MA 5AN9F 1Q811 1KD11 3BG0B 1X3ZA 3CCJZ 4A93I 1I3QI 1Q7Y1 1VQO1 2JMOA 1K8A1 1VLAA 3CME1 3RZOI 3NH5A 1Q822 5A2Qb 2W03A 1USPA 2H85A 3HKZA 2JIQA 1VQ6Z 2QRDB 4NOZA 2GU2A 1Z02A 1USPB 4RVGA 3JAMf 3MZLB 1TFIA 3G6EZ 3CMA1 3CXCY 2LIYA 4NH1C 3OW2Z 1N8R1 2OTL1 1TWFI 2QEXZ 1YITZ 3H3VJ 3PO3S 3GTMI 1QXFA 2E2HI 4A3CI 1QF8A 1VQP1 1RO2A 4RV9A 5IP7I 2LEXA 1Q812 1Z01A 3NH8A 4HGYA 2JA8I 1TWCI 4NB9A 1JJ2Z 1Q7Y2 3QWUA 3JAMb 1PFTA 2NVYI 1S721 1YUKA 3CCS1 2AYDA 1K8A2 3VMIA 1R9TI 1FDOA 1RLYA 3BG1B 3HOUI 4DGLA 4E2WA 2JA5I 1YIJZ 3S1RI 2JA7I 3GTOI 2JIMA 4A3II 2HF1A 1SFOI 1K9M1 2OTJZ 3PO3I 1W2BY 3J7A4 1I50I 2M48A 1NJI2 3T4NB 1L1OC 1QVGY 1N8R2 1VQ9Z 2QKDA 2VPZA 2RPRA 2V8IA 2PMZA 3CPWZ 3I56Z 1VQMZ 3CC41 5IT9f 1VQ8Z 3EEDA 3CCEZ 4CL1A 1JWHC 1Y8CA 3J80b 3CC7Z 3S17I 3I4MI 3GTGI 5C4XI 2VUGA 2G2KA 3GTKI 1YI2Z 3I4NI 2M6NA 2R7ZI 4A3DI 1DL6A 4E31A 4NBBA 1M1K2 1SIWA 3Q87A 2QR1B 4NBHA 4E2ZA 2DE6A 2QLVB 1YHQ1 1K9M2 5T6BA
chains in the Genus database with same CATH topology
1WCMI 1ZB8A 2QA41 3S16I 5D1OA 2OOXB 5FLXf 4X6AI 4MRIA 3G4SZ 2F4OA 1VQKZ 1Z03A 3CC21 1VQL1 2KI7B 3G711 1VQ41 5D1OB 3TE5B 4QTUA 3GCFA 3LUSA 3D9XA 3K7AI 1K732 2PM9A 5LL6f 2NVXI 3KIFA 3NDJA 2LFUA 1NUIA 2AKLA 2RBLA 3CCL1 3M4OI 1TWAI 4BBSI 2QRCB 3J81f 3CCUZ 1NJI1 1YJ9Z 3CD61 2VUMI 2V8KA 4HH4A 4MD9A 1VQN1 1VQ7Z 3CCR1 1VQ51 3S14I 1YJWZ 3P5JB 3PO2I 4A3LI 3FKII 1Q861 4RVDA 3CCMZ 4NBGA 4A3JI 3NDIA 3VMHA 2EGTA 4TNUA 3CCVZ 4MH4A 1KC82 1I6HI 4A3GI 4DK1A 3I551 2E2JI 1M1K1 2I3CA 2BJOA 3VMGA 1VQOZ 2IZ3A 3CXCZ 1ZH1A 3CMEZ 5C44I 1M901 2JS4A 1KQSY 2W04A 4E2XA 2O53A 1TWHI 4NBFA 1YJN1 4NBDA 3NH4A 4MXUA 2P28A 1LQLA 2E9HA 4MONA 4RVFA 3RZDI 3CCJ1 3HOYI 3HOZI 2RHBA 3CMAZ 3CCQ1 2V8JA 2WAQA 3CD6Z 2R93I 4XX2A 2GTHA 2OZKA 2OTLZ 1X3WA 1K731 4A3BI 2GTIA 3HOWI 5C4JI 1Q862 3FQQA 2E2II 2IZ4A 1VQPZ 1VQ61 1Y1VS 3F3PC 3GTQI 3CQZI 4A3MI 4HGZA 1RNIA 1RO4A 2K5RA 3G6E1 4NFRA 1W2BZ 1WIIA 2R92I 1S72Z 3CCSZ 2PK7A 3EERA 3GKQA 4NBEA 4NBAA 1M902 2QEX1 1YIT1 5IT9b 2DE7A 3FQMA 4AYBA 3KIHA 4A3KI 4A3FI 1KC81 4Y52I 3IFUA 3HOXI 3IF8A 3U50C 3OW2Y 3F3FC 2Q51A 3NFZA 4NB8A 2R6MA 1Y1VI 1RO0A 2OOYB 1QVFZ 3CCQZ 5T67A 2RT9A 1KRLA 3CC4Z 2HU9A 1YIJ1 3VB9A 3IX0A 4MD8A 2YU9I 2P3YA 1JJ2Y 2OTJ1 3D6WA 5FLXb 4E30A 3S15I 4S1TA 1X0TA 4RS4A 2Q4ZA 1VQ91 1K83I 3MONA 2JNYA 3MZKB 3I561 2DE5A 1VQM1 2Y0SA 3TDHB 1Y1WI 1VQ81 2KPIA 1YHQZ 3J81b 3CCE1 3GTPI 2JR6A 2QA4Z 2B63I 3VTNA 1WW9A 2JUBA 3CC71 1KD12 3CC2Z 1VQLZ 1YI21 3G71Z 3I07A 1VQ4Z 3CPWY 4BBRI 2NVQI 3ESWA 2QREB 4E2YA 3CCLZ 3HOVI 2NVTI 4MD7A 3GTLI 3S1MI 2J6AA 2ZAEB 3J80f 3G4S1 1VQK1 1VQNZ 3S2DI 3CCRZ 1TWGI 3S1NI 5FLMI 2RIQA 1RQFA 1VQ5Z 2WB1A 1N2FA 2VF1A 4QTTA 4EWCA 2O4HA 5IP9I 3GTJI 4BY1I 1Q821 3S1QI 1KQSZ 4Y7NI 4E33A 1P9NA 1NP6A 3S2HI 1QYPA 3CCU1 4DQYB 4A3EI 1YJ91 2F4MA 4BY7I 5D1PA 3I55Z 1QVGZ 5T64A 2K3RA 1VQ71 4E32A 3H0GI 5A2Qf 2YADA 1YJW1 1QVFY 2JA6I 3M3YI 4NBCA 5C3EI 3CCM1 5CM2M 1ZB9A 1YUAA 1ML8A 4BXXI 3CCV1 1YJNZ 4RVHA 3GTMS 1S7MA 5AN9F 1Q811 1KD11 3BG0B 1X3ZA 3CCJZ 4A93I 1I3QI 1Q7Y1 1VQO1 2JMOA 1K8A1 1VLAA 3CME1 3RZOI 3NH5A 1Q822 5A2Qb 2W03A 1USPA 2H85A 3HKZA 1VQ6Z 2QRDB 4NOZA 2GU2A 1Z02A 1USPB 4RVGA 3JAMf 3MZLB 1TFIA 3G6EZ 3CMA1 3CXCY 2LIYA 4NH1C 3OW2Z 1N8R1 2OTL1 1TWFI 2QEXZ 1YITZ 3H3VJ 3PO3S 3GTMI 2E2HI 4A3CI 1QF8A 1VQP1 1RO2A 4RV9A 5IP7I 1Q812 1Z01A 3NH8A 4HGYA 2JA8I 1TWCI 4NB9A 1JJ2Z 1Q7Y2 3QWUA 3JAMb 1PFTA 2NVYI 1S721 1YUKA 3CCS1 1K8A2 3VMIA 1R9TI 1RLYA 3BG1B 3HOUI 4DGLA 4E2WA 2JA5I 1YIJZ 3S1RI 2JA7I 3GTOI 4A3II 2HF1A 1SFOI 1K9M1 2OTJZ 3PO3I 1W2BY 3J7A4 1I50I 2M48A 1NJI2 3T4NB 1L1OC 1QVGY 1N8R2 1VQ9Z 2QKDA 2RPRA 2V8IA 2PMZA 3CPWZ 3I56Z 1VQMZ 3CC41 5IT9f 1VQ8Z 3EEDA 3CCEZ 4CL1A 1JWHC 3J80b 3CC7Z 3S17I 3I4MI 3GTGI 5C4XI 2VUGA 2G2KA 3GTKI 1YI2Z 3I4NI 2M6NA 2R7ZI 4A3DI 1DL6A 4E31A 4NBBA 1M1K2 3Q87A 2QR1B 4NBHA 4E2ZA 2DE6A 2QLVB 1YHQ1 1K9M2 5T6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WCM I;  1ZB8 A;  4BBR I;  2NVQ I;  3ESW A;  3S16 I;  4X6A I;  1Y1V S;  2F4O A;  1TWF I;  3CQZ I;  3GTQ I;  3H3V J;  4A3M I;  3HOV I;  3PO3 S;  2NVT I;  3GTM I;  2E2H I;  1RO4 A;  3GTL I;  4A3C I;  3S1M I;  4QTU A;  2K5R A;  2J6A A;  3GCF A;  3LUS A;  3K7A I;  2R92 I;  2NVX I;  2PK7 A;  3EER A;  3GKQ A;  4NBE A;  5IP7 I;  1NUI A;  4NBA A;  2AKL A;  2RBL A;  3S2D I;  3M4O I;  2JA8 I;  1TWC I;  1TWG I;  1TWA I;  4NB9 A;  3S1N I;  4BBS I;  5FLM I;  2DE7 A;  1N2F A;  4QTT A;  4A3K I;  4A3F I;  1PFT A;  2NVY I;  4Y52 I;  2VUM I;  3VMI A;  5IP9 I;  3GTJ I;  4BY1 I;  3HOX I;  1R9T I;  3U50 C;  1RLY A;  3S1Q I;  3HOU I;  4Y7N I;  3S2H I;  1QYP A;  2JA5 I;  3S14 I;  4A3E I;  3S1R I;  2JA7 I;  3GTO I;  3PO2 I;  2F4M A;  4A3L I;  4NB8 A;  4BY7 I;  3FKI I;  1Y1V I;  4NBG A;  2HF1 A;  4A3I I;  4A3J I;  3VMH A;  1SFO I;  3PO3 I;  1I50 I;  1L1O C;  4MH4 A;  3VB9 A;  3H0G I;  1I6H I;  4A3G I;  2JA6 I;  3M3Y I;  4NBC A;  2YU9 I;  5C3E I;  2P3Y A;  2E2J I;  3D6W A;  5CM2 M;  1ZB9 A;  2BJO A;  1YUA A;  3VMG A;  3S15 I;  1ML8 A;  4BXX I;  3GTM S;  5C44 I;  2JS4 A;  1K83 I;  1X3Z A;  2JNY A;  4A93 I;  1I3Q I;  1TWH I;  4NBF A;  3S17 I;  3I4M I;  2DE5 A;  3GTG I;  5C4X I;  4NBD A;  1Y1W I;  3GTK I;  3I4N I;  1VLA A;  2R7Z I;  2KPI A;  4A3D I;  1LQL A;  1DL6 A;  3RZO I;  4NBB A;  3Q87 A;  3GTP I;  3RZD I;  2JR6 A;  4NBH A;  2B63 I;  3HOY I;  1WW9 A;  1USP A;  3HOZ I;  2DE6 A;  2R93 I;  4XX2 A;  4NOZ A;  1X3W A;  4A3B I;  1USP B;  3HOW I;  5C4J I;  1TFI A;  3I07 A;  2E2I I; 
#chains in the Genus database with same CATH topology
 1WCM I;  1ZB8 A;  2QA4 1;  3S16 I;  5D1O A;  2OOX B;  5FLX f;  4X6A I;  4MRI A;  3G4S Z;  2F4O A;  1VQK Z;  1Z03 A;  3CC2 1;  1VQL 1;  2KI7 B;  3G71 1;  1VQ4 1;  5D1O B;  3TE5 B;  4QTU A;  3GCF A;  3LUS A;  3D9X A;  1WJ2 A;  3K7A I;  1K73 2;  2PM9 A;  5LL6 f;  2NVX I;  3KIF A;  3NDJ A;  2LFU A;  1NUI A;  2AKL A;  2RBL A;  3CCL 1;  3M4O I;  2NAP A;  1TWA I;  4BBS I;  2QRC B;  3J81 f;  3CCU Z;  1NJI 1;  1YJ9 Z;  3CD6 1;  2VUM I;  2V8K A;  4HH4 A;  4MD9 A;  1VQN 1;  1VQ7 Z;  2VPX A;  3CCR 1;  1VQ5 1;  3S14 I;  1YJW Z;  3P5J B;  3PO2 I;  4A3L I;  3FKI I;  1Q86 1;  4RVD A;  3CCM Z;  4NBG A;  4A3J I;  3NDI A;  3VMH A;  2EGT A;  4TNU A;  3CCV Z;  2VPW A;  4MH4 A;  1KC8 2;  1I6H I;  4A3G I;  4DK1 A;  3I55 1;  2E2J I;  2JIR A;  1M1K 1;  2I3C A;  2BJO A;  3VMG A;  1VQO Z;  2IZ3 A;  3CXC Z;  1ZH1 A;  3CME Z;  3D2L A;  5C44 I;  1M90 1;  2JS4 A;  1KQS Y;  2W04 A;  4E2X A;  2V45 A;  2O53 A;  1TWH I;  4NBF A;  1YJN 1;  4NBD A;  3NH4 A;  4MXU A;  2P28 A;  1LQL A;  2E9H A;  4MON A;  4RVF A;  3RZD I;  3CCJ 1;  3HOY I;  3HOZ I;  2RHB A;  3CMA Z;  3CCQ 1;  2V8J A;  2WAQ A;  3CD6 Z;  2JIO A;  2R93 I;  4XX2 A;  2GTH A;  2OZK A;  2OTL Z;  1X3W A;  1K73 1;  4A3B I;  2GTI A;  3HOW I;  5C4J I;  1Q86 2;  2E7Z A;  3FQQ A;  2E2I I;  2IZ4 A;  1VQP Z;  1VQ6 1;  1Y1V S;  3F3P C;  3GTQ I;  3CQZ I;  4A3M I;  4HGZ A;  1AA6 A;  1RNI A;  1RO4 A;  2K5R A;  3G6E 1;  4NFR A;  1W2B Z;  1WII A;  2R92 I;  1S72 Z;  3CCS Z;  2PK7 A;  3EER A;  3GKQ A;  4NBE A;  4NBA A;  1M90 2;  2QEX 1;  1YIT 1;  2VPY A;  5IT9 b;  2DE7 A;  3FQM A;  4AYB A;  3KIH A;  4A3K I;  4A3F I;  1KC8 1;  4Y52 I;  3IFU A;  3HOX I;  3IF8 A;  3U50 C;  1FDI A;  3OW2 Y;  3F3F C;  2Q51 A;  3NFZ A;  4NB8 A;  2R6M A;  1Y1V I;  1RO0 A;  2OOY B;  1QVF Z;  3CCQ Z;  5T67 A;  2RT9 A;  1KRL A;  3CC4 Z;  2HU9 A;  1YIJ 1;  3VB9 A;  3IX0 A;  4MD8 A;  2YU9 I;  2P3Y A;  1JJ2 Y;  2OTJ 1;  3D6W A;  5FLX b;  4E30 A;  3S15 I;  4S1T A;  1X0T A;  4RS4 A;  2Q4Z A;  1VQ9 1;  1K83 I;  3MON A;  2JNY A;  3MZK B;  3I56 1;  2DE5 A;  1VQM 1;  2Y0S A;  3TDH B;  1Y1W I;  1VQ8 1;  2KPI A;  1YHQ Z;  3J81 b;  3CCE 1;  3GTP I;  2JR6 A;  2QA4 Z;  2B63 I;  3VTN A;  1WW9 A;  2JUB A;  3CC7 1;  1KD1 2;  3CC2 Z;  1VQL Z;  1YI2 1;  3G71 Z;  2IV2 X;  3I07 A;  1VQ4 Z;  3CPW Y;  4BBR I;  2NVQ I;  3ESW A;  2V3V A;  2QRE B;  4E2Y A;  3CCL Z;  3HOV I;  2NVT I;  4MD7 A;  3GTL I;  3S1M I;  2J6A A;  2ZAE B;  3J80 f;  3G4S 1;  1VQK 1;  1VQN Z;  3S2D I;  3CCR Z;  1TWG I;  3S1N I;  5FLM I;  1WZN A;  1RQF A;  2RIQ A;  1VQ5 Z;  2WB1 A;  1N2F A;  2VF1 A;  4QTT A;  4EWC A;  2O4H A;  5IP9 I;  3GTJ I;  4BY1 I;  2JIP A;  1Q82 1;  3S1Q I;  1KQS Z;  4Y7N I;  4E33 A;  1P9N A;  1NP6 A;  3S2H I;  1QYP A;  3CCU 1;  4DQY B;  4A3E I;  1YJ9 1;  2F4M A;  4BY7 I;  5D1P A;  3I55 Z;  1QVG Z;  5T64 A;  2K3R A;  1VQ7 1;  4E32 A;  3IR7 A;  3H0G I;  5A2Q f;  2YAD A;  1YJW 1;  1Q16 A;  1QVF Y;  2JA6 I;  3M3Y I;  4NBC A;  5C3E I;  3CCM 1;  5CM2 M;  1ZB9 A;  1YUA A;  1ML8 A;  4BXX I;  3CCV 1;  1YJN Z;  4RVH A;  3GTM S;  1S7M A;  5AN9 F;  1Q81 1;  1KD1 1;  3BG0 B;  1X3Z A;  3CCJ Z;  4A93 I;  1I3Q I;  1Q7Y 1;  1VQO 1;  2JMO A;  1K8A 1;  1VLA A;  3CME 1;  3RZO I;  3NH5 A;  1Q82 2;  5A2Q b;  2W03 A;  1USP A;  2H85 A;  3HKZ A;  2JIQ A;  1VQ6 Z;  2QRD B;  4NOZ A;  2GU2 A;  1Z02 A;  1USP B;  4RVG A;  3JAM f;  3MZL B;  1TFI A;  3G6E Z;  3CMA 1;  3CXC Y;  2LIY A;  4NH1 C;  3OW2 Z;  1N8R 1;  2OTL 1;  1TWF I;  2QEX Z;  1YIT Z;  3H3V J;  3PO3 S;  3GTM I;  1QXF A;  2E2H I;  4A3C I;  1QF8 A;  1VQP 1;  1RO2 A;  4RV9 A;  5IP7 I;  2LEX A;  1Q81 2;  1Z01 A;  3NH8 A;  4HGY A;  2JA8 I;  1TWC I;  4NB9 A;  1JJ2 Z;  1Q7Y 2;  3QWU A;  3JAM b;  1PFT A;  2NVY I;  1S72 1;  1YUK A;  3CCS 1;  2AYD A;  1K8A 2;  3VMI A;  1R9T I;  1FDO A;  1RLY A;  3BG1 B;  3HOU I;  4DGL A;  4E2W A;  2JA5 I;  1YIJ Z;  3S1R I;  2JA7 I;  3GTO I;  2JIM A;  4A3I I;  2HF1 A;  1SFO I;  1K9M 1;  2OTJ Z;  3PO3 I;  1W2B Y;  3J7A 4;  1I50 I;  2M48 A;  1NJI 2;  3T4N B;  1L1O C;  1QVG Y;  1N8R 2;  1VQ9 Z;  2QKD A;  2VPZ A;  2RPR A;  2V8I A;  2PMZ A;  3CPW Z;  3I56 Z;  1VQM Z;  3CC4 1;  5IT9 f;  1VQ8 Z;  3EED A;  3CCE Z;  4CL1 A;  1JWH C;  1Y8C A;  3J80 b;  3CC7 Z;  3S17 I;  3I4M I;  3GTG I;  5C4X I;  2VUG A;  2G2K A;  3GTK I;  1YI2 Z;  3I4N I;  2M6N A;  2R7Z I;  4A3D I;  1DL6 A;  4E31 A;  4NBB A;  1M1K 2;  1SIW A;  3Q87 A;  2QR1 B;  4NBH A;  4E2Z A;  2DE6 A;  2QLV B;  1YHQ 1;  1K9M 2;  5T6B A; 
#chains in the Genus database with same CATH homology
 1WCM I;  1ZB8 A;  2QA4 1;  3S16 I;  5D1O A;  2OOX B;  5FLX f;  4X6A I;  4MRI A;  3G4S Z;  2F4O A;  1VQK Z;  1Z03 A;  3CC2 1;  1VQL 1;  2KI7 B;  3G71 1;  1VQ4 1;  5D1O B;  3TE5 B;  4QTU A;  3GCF A;  3LUS A;  3D9X A;  3K7A I;  1K73 2;  2PM9 A;  5LL6 f;  2NVX I;  3KIF A;  3NDJ A;  2LFU A;  1NUI A;  2AKL A;  2RBL A;  3CCL 1;  3M4O I;  1TWA I;  4BBS I;  2QRC B;  3J81 f;  3CCU Z;  1NJI 1;  1YJ9 Z;  3CD6 1;  2VUM I;  2V8K A;  4HH4 A;  4MD9 A;  1VQN 1;  1VQ7 Z;  3CCR 1;  1VQ5 1;  3S14 I;  1YJW Z;  3P5J B;  3PO2 I;  4A3L I;  3FKI I;  1Q86 1;  4RVD A;  3CCM Z;  4NBG A;  4A3J I;  3NDI A;  3VMH A;  2EGT A;  4TNU A;  3CCV Z;  4MH4 A;  1KC8 2;  1I6H I;  4A3G I;  4DK1 A;  3I55 1;  2E2J I;  1M1K 1;  2I3C A;  2BJO A;  3VMG A;  1VQO Z;  2IZ3 A;  3CXC Z;  1ZH1 A;  3CME Z;  5C44 I;  1M90 1;  2JS4 A;  1KQS Y;  2W04 A;  4E2X A;  2O53 A;  1TWH I;  4NBF A;  1YJN 1;  4NBD A;  3NH4 A;  4MXU A;  2P28 A;  1LQL A;  2E9H A;  4MON A;  4RVF A;  3RZD I;  3CCJ 1;  3HOY I;  3HOZ I;  2RHB A;  3CMA Z;  3CCQ 1;  2V8J A;  2WAQ A;  3CD6 Z;  2R93 I;  4XX2 A;  2GTH A;  2OZK A;  2OTL Z;  1X3W A;  1K73 1;  4A3B I;  2GTI A;  3HOW I;  5C4J I;  1Q86 2;  3FQQ A;  2E2I I;  2IZ4 A;  1VQP Z;  1VQ6 1;  1Y1V S;  3F3P C;  3GTQ I;  3CQZ I;  4A3M I;  4HGZ A;  1RNI A;  1RO4 A;  2K5R A;  3G6E 1;  4NFR A;  1W2B Z;  1WII A;  2R92 I;  1S72 Z;  3CCS Z;  2PK7 A;  3EER A;  3GKQ A;  4NBE A;  4NBA A;  1M90 2;  2QEX 1;  1YIT 1;  5IT9 b;  2DE7 A;  3FQM A;  4AYB A;  3KIH A;  4A3K I;  4A3F I;  1KC8 1;  4Y52 I;  3IFU A;  3HOX I;  3IF8 A;  3U50 C;  3OW2 Y;  3F3F C;  2Q51 A;  3NFZ A;  4NB8 A;  2R6M A;  1Y1V I;  1RO0 A;  2OOY B;  1QVF Z;  3CCQ Z;  5T67 A;  2RT9 A;  1KRL A;  3CC4 Z;  2HU9 A;  1YIJ 1;  3VB9 A;  3IX0 A;  4MD8 A;  2YU9 I;  2P3Y A;  1JJ2 Y;  2OTJ 1;  3D6W A;  5FLX b;  4E30 A;  3S15 I;  4S1T A;  1X0T A;  4RS4 A;  2Q4Z A;  1VQ9 1;  1K83 I;  3MON A;  2JNY A;  3MZK B;  3I56 1;  2DE5 A;  1VQM 1;  2Y0S A;  3TDH B;  1Y1W I;  1VQ8 1;  2KPI A;  1YHQ Z;  3J81 b;  3CCE 1;  3GTP I;  2JR6 A;  2QA4 Z;  2B63 I;  3VTN A;  1WW9 A;  2JUB A;  3CC7 1;  1KD1 2;  3CC2 Z;  1VQL Z;  1YI2 1;  3G71 Z;  3I07 A;  1VQ4 Z;  3CPW Y;  4BBR I;  2NVQ I;  3ESW A;  2QRE B;  4E2Y A;  3CCL Z;  3HOV I;  2NVT I;  4MD7 A;  3GTL I;  3S1M I;  2J6A A;  2ZAE B;  3J80 f;  3G4S 1;  1VQK 1;  1VQN Z;  3S2D I;  3CCR Z;  1TWG I;  3S1N I;  5FLM I;  2RIQ A;  1RQF A;  1VQ5 Z;  2WB1 A;  1N2F A;  2VF1 A;  4QTT A;  4EWC A;  2O4H A;  5IP9 I;  3GTJ I;  4BY1 I;  1Q82 1;  3S1Q I;  1KQS Z;  4Y7N I;  4E33 A;  1P9N A;  1NP6 A;  3S2H I;  1QYP A;  3CCU 1;  4DQY B;  4A3E I;  1YJ9 1;  2F4M A;  4BY7 I;  5D1P A;  3I55 Z;  1QVG Z;  5T64 A;  2K3R A;  1VQ7 1;  4E32 A;  3H0G I;  5A2Q f;  2YAD A;  1YJW 1;  1QVF Y;  2JA6 I;  3M3Y I;  4NBC A;  5C3E I;  3CCM 1;  5CM2 M;  1ZB9 A;  1YUA A;  1ML8 A;  4BXX I;  3CCV 1;  1YJN Z;  4RVH A;  3GTM S;  1S7M A;  5AN9 F;  1Q81 1;  1KD1 1;  3BG0 B;  1X3Z A;  3CCJ Z;  4A93 I;  1I3Q I;  1Q7Y 1;  1VQO 1;  2JMO A;  1K8A 1;  1VLA A;  3CME 1;  3RZO I;  3NH5 A;  1Q82 2;  5A2Q b;  2W03 A;  1USP A;  2H85 A;  3HKZ A;  1VQ6 Z;  2QRD B;  4NOZ A;  2GU2 A;  1Z02 A;  1USP B;  4RVG A;  3JAM f;  3MZL B;  1TFI A;  3G6E Z;  3CMA 1;  3CXC Y;  2LIY A;  4NH1 C;  3OW2 Z;  1N8R 1;  2OTL 1;  1TWF I;  2QEX Z;  1YIT Z;  3H3V J;  3PO3 S;  3GTM I;  2E2H I;  4A3C I;  1QF8 A;  1VQP 1;  1RO2 A;  4RV9 A;  5IP7 I;  1Q81 2;  1Z01 A;  3NH8 A;  4HGY A;  2JA8 I;  1TWC I;  4NB9 A;  1JJ2 Z;  1Q7Y 2;  3QWU A;  3JAM b;  1PFT A;  2NVY I;  1S72 1;  1YUK A;  3CCS 1;  1K8A 2;  3VMI A;  1R9T I;  1RLY A;  3BG1 B;  3HOU I;  4DGL A;  4E2W A;  2JA5 I;  1YIJ Z;  3S1R I;  2JA7 I;  3GTO I;  4A3I I;  2HF1 A;  1SFO I;  1K9M 1;  2OTJ Z;  3PO3 I;  1W2B Y;  3J7A 4;  1I50 I;  2M48 A;  1NJI 2;  3T4N B;  1L1O C;  1QVG Y;  1N8R 2;  1VQ9 Z;  2QKD A;  2RPR A;  2V8I A;  2PMZ A;  3CPW Z;  3I56 Z;  1VQM Z;  3CC4 1;  5IT9 f;  1VQ8 Z;  3EED A;  3CCE Z;  4CL1 A;  1JWH C;  3J80 b;  3CC7 Z;  3S17 I;  3I4M I;  3GTG I;  5C4X I;  2VUG A;  2G2K A;  3GTK I;  1YI2 Z;  3I4N I;  2M6N A;  2R7Z I;  4A3D I;  1DL6 A;  4E31 A;  4NBB A;  1M1K 2;  3Q87 A;  2QR1 B;  4NBH A;  4E2Z A;  2DE6 A;  2QLV B;  1YHQ 1;  1K9M 2;  5T6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...