3GTMI

Co-complex of backtracked rna polymerase ii with tfiis
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 8
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtmI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtmI02
3H0GI 3GTMS 2RBLA 2JNYA 4MH4A 4X6AI 4A3FI 4A93I 4A3CI 2BJOA 1USPB 3HOYI 2HF1A 1TWAI 4NBDA 1Y1WI 2R92I 3LUSA 3M3YI 3RZOI 1R9TI 1Y1VI 5FLMI 1TWFI 1DL6A 3VMGA 3FKII 5C44I 1TWCI 4NBAA 4NB9A 1I50I 3I07A 5CM2M 5IP7I 4NBEA 2B63I 3Q87A 4NOZA 3S2HI 3S1QI 1X3ZA 2NVXI 3GTQI 3S14I 4QTTA 3GTJI 1L1OC 3VMIA 3HOWI 2F4OA 1QYPA 4NBBA 2JR6A 3M4OI 2E2JI 3S17I 3I4NI 1YUAA 4A3JI 4XX2A 3GKQA 2DE6A 1RLYA 1LQLA 4QTUA 3HOVI 1PFTA 4A3GI 1I6HI 2VUMI 4NB8A 2R7ZI 5C4XI 3K7AI 3H3VJ 3ESWA 1NUIA 3VMHA 5C3EI 1RO4A 2PK7A 3VB9A 3S1MI 4A3II 2JA6I 3S15I 2JS4A 2NVYI 2AKLA 1ML8A 4A3KI 3GTKI 2NVQI 3PO2I 2K5RA 3HOXI 2E2HI 2E2II 3PO3S 4Y52I 1X3WA 4BXXI 3S2DI 1TFIA 4NBFA 3GTPI 2P3YA 4Y7NI 4A3DI 3S1NI 4BY7I 2JA7I 3HOUI 1ZB9A 4A3MI 3U50C 2DE7A 2NVTI 5C4JI 1USPA 3S16I 4NBHA 4BBRI 4A3BI 4BBSI 3S1RI 4A3LI 1ZB8A 2J6AA 1WCMI 4BY1I 1TWGI 3GTGI 2F4MA 2DE5A 3GTMI 2R93I 1TWHI 1VLAA 4NBCA 1SFOI 4NBGA 3EERA 3GTOI 3GTLI 3D6WA 1I3QI 3GCFA 2YU9I 2JA8I 2JA5I 3RZDI 1WW9A 4A3EI 3CQZI 3HOZI 1K83I 2KPIA 5IP9I 1Y1VS 3I4MI 1N2FA 3PO3I
chains in the Genus database with same CATH superfamily
2JIQA 1Z03A 2OZKA 2IZ3A 1VQN1 2JNYA 4MH4A 1M1K2 1YIJ1 2VPZA 4A3CI 2OOYB 1USPB 2OTL1 1M902 1Y1WI 2R92I 3RZOI 2LFUA 3HKZA 1Y1VI 1S72Z 5C44I 4NB9A 5D1OA 3Q87A 2M48A 4NOZA 1Q812 3CCU1 2OTLZ 2NVXI 3S14I 3IX0A 1K8A2 3HOWI 1K8A1 3M4OI 5FLXb 2E2JI 1N8R2 3S17I 3I4NI 2QLVB 1YUAA 4A3JI 2O53A 1RLYA 4QTUA 3CXCY 4NB8A 4HGYA 1RO2A 4NH1C 4RS4A 2HU9A 2PK7A 4RVDA 2VPXA 2JUBA 2AKLA 1YI21 2QR1B 1W2BY 3JAMf 3J81f 2ZAEB 2WB1A 3CXCZ 1KD12 3S1NI 3CMAZ 3HOUI 1KQSZ 2GU2A 3CMEZ 2RIQA 4BBRI 1VQLZ 1VQOZ 1QVFZ 4A3LI 2V3VA 3CC4Z 3D9XA 3CMA1 3FQMA 3IR7A 5A2Qb 3BG0B 1VQL1 1JWHC 4DQYB 1Q811 4HGZA 3MZLB 1VQ91 3I561 4NFRA 2V45A 3GTOI 4S1TA 2JA8I 4MONA 3G711 3CQZI 3HOZI 1FDOA 4DGLA 2KPIA 5IP9I 1K9M2 1QVGZ 3I4MI 2KI7B 3H0GI 2RBLA 1YJW1 2QRDB 4A93I 2O4HA 1KQSY 3CCVZ 2R6MA 3CCR1 3KIFA 1TWCI 4NBAA 2QA41 1QVGY 3I07A 5IP7I 4NBEA 1QVFY 3I55Z 3NH5A 3IFUA 3S1QI 1NJI1 2LEXA 1X3ZA 3F3FC 4QTTA 3GTJI 1SIWA 2QA4Z 3CC21 1L1OC 1KD11 1AA6A 1QYPA 5T67A 3NFZA 1W2BZ 1NJI2 3P5JB 2LIYA 1VQ9Z 2H85A 4XX2A 3CC2Z 3GKQA 1S7MA 5A2Qf 2R7ZI 1VQ7Z 2QKDA 1VQPZ 1NUIA 3CD61 1RO4A 2IZ4A 1VQNZ 5IT9b 2GTHA 2JA6I 1ML8A 2OTJ1 3GTKI 3MONA 1NP6A 1YITZ 1VQ41 3HOXI 2E2HI 2E2II 1Q861 1JJ2Y 4E2ZA 4Y52I 1Q862 5AN9F 1YI2Z 4A3MI 2VUGA 5C4JI 2V8JA 3S16I 1VQMZ 1K9M1 1Z01A 4A3BI 1YIJZ 3S1RI 2P28A 1JJ2Z 1Q821 1WCMI 2JIPA 2F4MA 5T6BA 4AYBA 2VPWA 5IT9f 1YHQ1 1Q822 3J7A4 1YJN1 2VF1A 4HH4A 1SFOI 1YUKA 3CC7Z 1Y8CA 2W03A 2YU9I 1WW9A 3D2LA 2M6NA 2Q4ZA 1K83I 1K732 4MXUA 3CC71 2V8IA 2W04A 4A3FI 2NAPA 3CCJZ 4NBDA 3CC41 3NH4A 3CCMZ 1VQKZ 1TWFI 3VMGA 1VQO1 3KIHA 3G6E1 2G2KA 5CM2M 1YJWZ 3CCV1 3S2HI 2VPYA 3CCL1 3GTQI 2EGTA 2QEX1 3VMIA 2Y0SA 1KC81 3CME1 3CCQZ 3I56Z 4RVFA 4E33A 2YADA 4E30A 4TNUA 4A3GI 1I6HI 3NDJA 1RO0A 5C4XI 3H3VJ 3ESWA 5C3EI 4MD7A 3VB9A 1VQ61 4A3II 3S1MI 4E31A 2JS4A 2NVYI 4A3KI 2RHBA 2K5RA 3G4SZ 3PO3S 2E9HA 1X3WA 4BXXI 4MRIA 1YIT1 1TFIA 4NBFA 2JMOA 2P3YA 4BY7I 4E2WA 3OW2Z 2OOXB 2DE7A 2NVTI 1USPA 1VQ8Z 1K731 3CCE1 3CCQ1 1WZNA 1Q7Y1 2I3CA 3JAMb 3CCSZ 2J6AA 1VQ71 4BY1I 3CCEZ 1VQP1 2DE5A 1QF8A 1Q7Y2 2R93I 3J80f 2PMZA 3MZKB 3CD6Z 5D1OB 3EERA 1X0TA 2RPRA 3CCS1 4E2YA 1WIIA 1YJNZ 1VQ4Z 3RZDI 4EWCA 1KC82 3CPWY 3F3PC 3GTMS 2JIMA 4X6AI 1P9NA 1FDIA 2BJOA 3HOYI 2HF1A 1TWAI 1VQ81 3OW2Y 1VQM1 3LUSA 3M3YI 1R9TI 2AYDA 5FLMI 3CCUZ 2OTJZ 1DL6A 2E7ZA 3FKII 3J81b 1I50I 1YHQZ 5D1PA 2B63I 1ZH1A 1VQK1 2IV2X 4E2XA 1RQFA 2F4OA 2JIRA 4NBBA 2JR6A 1KRLA 3NDIA 3TDHB 3J80b 1YJ9Z 5FLXf 2DE6A 1LQLA 4RV9A 3HOVI 1PFTA 2GTIA 2JIOA 2VUMI 1M901 2RT9A 1Q16A 3K7AI 4MD8A 1QXFA 3VMHA 4RVGA 3CCJ1 4E32A 5LL6f 3S15I 1YJ91 3NH8A 2V8KA 2WAQA 3G6EZ 3FQQA 2NVQI 3PO2I 4MD9A 2K3RA 3IF8A 3VTNA 1VQ6Z 3S2DI 3QWUA 3GTPI 4Y7NI 4A3DI 1VQ5Z 2JA7I 1N8R1 1ZB9A 4CL1A 3U50C 3TE5B 2QEXZ 3T4NB 4NBHA 4DK1A 4BBSI 3CCRZ 3CPWZ 1ZB8A 3CCM1 1VQ51 3EEDA 1TWGI 3GTGI 2QREB 3GTMI 1TWHI 1VLAA 1RNIA 3I551 3CCLZ 1WJ2A 4NBCA 3G71Z 4NBGA 4RVHA 5T64A 1Z02A 3G4S1 3GTLI 3D6WA 1I3QI 2PM9A 2Q51A 2QRCB 3BG1B 3GCFA 2JA5I 4A3EI 1S721 1M1K1 1Y1VS 1N2FA 3PO3I
chains in the Genus database with same CATH topology
1Z03A 2OZKA 2IZ3A 1VQN1 2JNYA 4MH4A 1M1K2 1YIJ1 4A3CI 2OOYB 1USPB 2OTL1 1M902 1Y1WI 2R92I 3RZOI 2LFUA 3HKZA 1Y1VI 1S72Z 5C44I 4NB9A 5D1OA 3Q87A 2M48A 4NOZA 1Q812 3CCU1 2OTLZ 2NVXI 3S14I 3IX0A 1K8A2 3HOWI 1K8A1 3M4OI 5FLXb 2E2JI 1N8R2 3S17I 3I4NI 2QLVB 1YUAA 4A3JI 2O53A 1RLYA 4QTUA 3CXCY 4NB8A 4HGYA 1RO2A 4NH1C 4RS4A 2HU9A 2PK7A 4RVDA 2JUBA 2AKLA 1YI21 2QR1B 1W2BY 3JAMf 3J81f 2ZAEB 2WB1A 3CXCZ 1KD12 3S1NI 3CMAZ 3HOUI 1KQSZ 2GU2A 3CMEZ 2RIQA 4BBRI 1VQLZ 1VQOZ 1QVFZ 4A3LI 3CC4Z 3D9XA 3CMA1 3FQMA 5A2Qb 3BG0B 1VQL1 1JWHC 4DQYB 1Q811 4HGZA 3MZLB 1VQ91 3I561 4NFRA 3GTOI 4S1TA 2JA8I 4MONA 3G711 3CQZI 3HOZI 4DGLA 2KPIA 5IP9I 1K9M2 1QVGZ 3I4MI 2KI7B 3H0GI 2RBLA 1YJW1 2QRDB 4A93I 2O4HA 1KQSY 3CCVZ 2R6MA 3CCR1 3KIFA 1TWCI 4NBAA 2QA41 1QVGY 3I07A 5IP7I 4NBEA 1QVFY 3I55Z 3NH5A 3IFUA 3S1QI 1NJI1 1X3ZA 3F3FC 4QTTA 3GTJI 2QA4Z 3CC21 1L1OC 1KD11 1QYPA 5T67A 3NFZA 1W2BZ 1NJI2 3P5JB 2LIYA 1VQ9Z 2H85A 4XX2A 3CC2Z 3GKQA 1S7MA 5A2Qf 2R7ZI 1VQ7Z 2QKDA 1VQPZ 1NUIA 3CD61 1RO4A 2IZ4A 1VQNZ 5IT9b 2GTHA 2JA6I 1ML8A 2OTJ1 3GTKI 3MONA 1NP6A 1YITZ 1VQ41 3HOXI 2E2HI 2E2II 1Q861 1JJ2Y 4E2ZA 4Y52I 1Q862 5AN9F 1YI2Z 4A3MI 2VUGA 5C4JI 2V8JA 3S16I 1VQMZ 1K9M1 1Z01A 4A3BI 1YIJZ 3S1RI 2P28A 1JJ2Z 1Q821 1WCMI 4AYBA 2F4MA 5T6BA 5IT9f 1YHQ1 1Q822 3J7A4 1YJN1 2VF1A 4HH4A 1SFOI 1YUKA 3CC7Z 2W03A 2YU9I 1WW9A 2M6NA 2Q4ZA 1K83I 1K732 4MXUA 3CC71 2V8IA 2W04A 4A3FI 3CCJZ 4NBDA 3CC41 3NH4A 3CCMZ 1VQKZ 1TWFI 3VMGA 1VQO1 3KIHA 3G6E1 2G2KA 5CM2M 1YJWZ 3CCV1 3S2HI 3CCL1 3GTQI 2EGTA 2QEX1 3VMIA 2Y0SA 1KC81 3CME1 3CCQZ 3I56Z 4RVFA 4E33A 2YADA 4E30A 4TNUA 4A3GI 1I6HI 3NDJA 1RO0A 5C4XI 3H3VJ 3ESWA 5C3EI 4MD7A 3VB9A 1VQ61 4A3II 3S1MI 4E31A 2JS4A 2NVYI 4A3KI 2RHBA 2K5RA 3G4SZ 3PO3S 2E9HA 1X3WA 4BXXI 4MRIA 1YIT1 1TFIA 4NBFA 2JMOA 2P3YA 4BY7I 4E2WA 3OW2Z 2OOXB 2DE7A 2NVTI 1USPA 1VQ8Z 1K731 3CCE1 3CCQ1 1Q7Y1 2I3CA 3JAMb 3CCSZ 2J6AA 1VQ71 4BY1I 3CCEZ 1VQP1 2DE5A 1QF8A 1Q7Y2 2R93I 3J80f 2PMZA 3MZKB 3CD6Z 5D1OB 3EERA 1X0TA 2RPRA 3CCS1 4E2YA 1WIIA 1YJNZ 1VQ4Z 3RZDI 4EWCA 1KC82 3CPWY 3F3PC 3GTMS 4X6AI 1P9NA 2BJOA 3HOYI 2HF1A 1TWAI 1VQ81 3OW2Y 1VQM1 3LUSA 3M3YI 1R9TI 3CCUZ 5FLMI 2OTJZ 1DL6A 3FKII 3J81b 1I50I 1YHQZ 5D1PA 2B63I 1ZH1A 1VQK1 4E2XA 1RQFA 2F4OA 4NBBA 2JR6A 1KRLA 3NDIA 3TDHB 3J80b 1YJ9Z 5FLXf 2DE6A 1LQLA 4RV9A 3HOVI 1PFTA 2GTIA 2VUMI 1M901 2RT9A 3K7AI 4MD8A 3VMHA 4RVGA 3CCJ1 4E32A 5LL6f 3S15I 1YJ91 3NH8A 2V8KA 2WAQA 3G6EZ 3FQQA 2NVQI 3PO2I 4MD9A 2K3RA 3IF8A 3VTNA 1VQ6Z 3S2DI 3QWUA 3GTPI 4Y7NI 4A3DI 1VQ5Z 2JA7I 1N8R1 1ZB9A 4CL1A 3U50C 3TE5B 2QEXZ 3T4NB 4NBHA 4DK1A 4BBSI 3CCRZ 3CPWZ 1ZB8A 3CCM1 1VQ51 3EEDA 1TWGI 3GTGI 2QREB 3GTMI 1TWHI 1VLAA 1RNIA 3I551 3CCLZ 4NBCA 3G71Z 4NBGA 4RVHA 5T64A 1Z02A 3G4S1 3GTLI 3D6WA 1I3QI 2PM9A 2Q51A 2QRCB 3BG1B 3GCFA 2JA5I 4A3EI 1S721 1M1K1 1Y1VS 1N2FA 3PO3I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H0G I;  3GTM S;  2RBL A;  2JNY A;  4MH4 A;  4X6A I;  4A3F I;  4A93 I;  4A3C I;  2BJO A;  1USP B;  3HOY I;  2HF1 A;  1TWA I;  4NBD A;  1Y1W I;  2R92 I;  3LUS A;  3M3Y I;  3RZO I;  1R9T I;  1Y1V I;  5FLM I;  1TWF I;  1DL6 A;  3VMG A;  3FKI I;  5C44 I;  1TWC I;  4NBA A;  4NB9 A;  1I50 I;  3I07 A;  5CM2 M;  5IP7 I;  4NBE A;  2B63 I;  3Q87 A;  4NOZ A;  3S2H I;  3S1Q I;  1X3Z A;  2NVX I;  3GTQ I;  3S14 I;  4QTT A;  3GTJ I;  1L1O C;  3VMI A;  3HOW I;  2F4O A;  1QYP A;  4NBB A;  2JR6 A;  3M4O I;  2E2J I;  3S17 I;  3I4N I;  1YUA A;  4A3J I;  4XX2 A;  3GKQ A;  2DE6 A;  1RLY A;  1LQL A;  4QTU A;  3HOV I;  1PFT A;  4A3G I;  1I6H I;  2VUM I;  4NB8 A;  2R7Z I;  5C4X I;  3K7A I;  3H3V J;  3ESW A;  1NUI A;  3VMH A;  5C3E I;  1RO4 A;  2PK7 A;  3VB9 A;  3S1M I;  4A3I I;  2JA6 I;  3S15 I;  2JS4 A;  2NVY I;  2AKL A;  1ML8 A;  4A3K I;  3GTK I;  2NVQ I;  3PO2 I;  2K5R A;  3HOX I;  2E2H I;  2E2I I;  3PO3 S;  4Y52 I;  1X3W A;  4BXX I;  3S2D I;  1TFI A;  4NBF A;  3GTP I;  2P3Y A;  4Y7N I;  4A3D I;  3S1N I;  4BY7 I;  2JA7 I;  3HOU I;  1ZB9 A;  4A3M I;  3U50 C;  2DE7 A;  2NVT I;  5C4J I;  1USP A;  3S16 I;  4NBH A;  4BBR I;  4A3B I;  4BBS I;  3S1R I;  4A3L I;  1ZB8 A;  2J6A A;  1WCM I;  4BY1 I;  1TWG I;  3GTG I;  2F4M A;  2DE5 A;  3GTM I;  2R93 I;  1TWH I;  1VLA A;  4NBC A;  1SFO I;  4NBG A;  3EER A;  3GTO I;  3GTL I;  3D6W A;  1I3Q I;  3GCF A;  2YU9 I;  2JA8 I;  2JA5 I;  3RZD I;  1WW9 A;  4A3E I;  3CQZ I;  3HOZ I;  1K83 I;  2KPI A;  5IP9 I;  1Y1V S;  3I4M I;  1N2F A;  3PO3 I; 
#chains in the Genus database with same CATH topology
 2JIQ A;  1Z03 A;  2OZK A;  2IZ3 A;  1VQN 1;  2JNY A;  4MH4 A;  1M1K 2;  1YIJ 1;  2VPZ A;  4A3C I;  2OOY B;  1USP B;  2OTL 1;  1M90 2;  1Y1W I;  2R92 I;  3RZO I;  2LFU A;  3HKZ A;  1Y1V I;  1S72 Z;  5C44 I;  4NB9 A;  5D1O A;  3Q87 A;  2M48 A;  4NOZ A;  1Q81 2;  3CCU 1;  2OTL Z;  2NVX I;  3S14 I;  3IX0 A;  1K8A 2;  3HOW I;  1K8A 1;  3M4O I;  5FLX b;  2E2J I;  1N8R 2;  3S17 I;  3I4N I;  2QLV B;  1YUA A;  4A3J I;  2O53 A;  1RLY A;  4QTU A;  3CXC Y;  4NB8 A;  4HGY A;  1RO2 A;  4NH1 C;  4RS4 A;  2HU9 A;  2PK7 A;  4RVD A;  2VPX A;  2JUB A;  2AKL A;  1YI2 1;  2QR1 B;  1W2B Y;  3JAM f;  3J81 f;  2ZAE B;  2WB1 A;  3CXC Z;  1KD1 2;  3S1N I;  3CMA Z;  3HOU I;  1KQS Z;  2GU2 A;  3CME Z;  2RIQ A;  4BBR I;  1VQL Z;  1VQO Z;  1QVF Z;  4A3L I;  2V3V A;  3CC4 Z;  3D9X A;  3CMA 1;  3FQM A;  3IR7 A;  5A2Q b;  3BG0 B;  1VQL 1;  1JWH C;  4DQY B;  1Q81 1;  4HGZ A;  3MZL B;  1VQ9 1;  3I56 1;  4NFR A;  2V45 A;  3GTO I;  4S1T A;  2JA8 I;  4MON A;  3G71 1;  3CQZ I;  3HOZ I;  1FDO A;  4DGL A;  2KPI A;  5IP9 I;  1K9M 2;  1QVG Z;  3I4M I;  2KI7 B;  3H0G I;  2RBL A;  1YJW 1;  2QRD B;  4A93 I;  2O4H A;  1KQS Y;  3CCV Z;  2R6M A;  3CCR 1;  3KIF A;  1TWC I;  4NBA A;  2QA4 1;  1QVG Y;  3I07 A;  5IP7 I;  4NBE A;  1QVF Y;  3I55 Z;  3NH5 A;  3IFU A;  3S1Q I;  1NJI 1;  2LEX A;  1X3Z A;  3F3F C;  4QTT A;  3GTJ I;  1SIW A;  2QA4 Z;  3CC2 1;  1L1O C;  1KD1 1;  1AA6 A;  1QYP A;  5T67 A;  3NFZ A;  1W2B Z;  1NJI 2;  3P5J B;  2LIY A;  1VQ9 Z;  2H85 A;  4XX2 A;  3CC2 Z;  3GKQ A;  1S7M A;  5A2Q f;  2R7Z I;  1VQ7 Z;  2QKD A;  1VQP Z;  1NUI A;  3CD6 1;  1RO4 A;  2IZ4 A;  1VQN Z;  5IT9 b;  2GTH A;  2JA6 I;  1ML8 A;  2OTJ 1;  3GTK I;  3MON A;  1NP6 A;  1YIT Z;  1VQ4 1;  3HOX I;  2E2H I;  2E2I I;  1Q86 1;  1JJ2 Y;  4E2Z A;  4Y52 I;  1Q86 2;  5AN9 F;  1YI2 Z;  4A3M I;  2VUG A;  5C4J I;  2V8J A;  3S16 I;  1VQM Z;  1K9M 1;  1Z01 A;  4A3B I;  1YIJ Z;  3S1R I;  2P28 A;  1JJ2 Z;  1Q82 1;  1WCM I;  2JIP A;  2F4M A;  5T6B A;  4AYB A;  2VPW A;  5IT9 f;  1YHQ 1;  1Q82 2;  3J7A 4;  1YJN 1;  2VF1 A;  4HH4 A;  1SFO I;  1YUK A;  3CC7 Z;  1Y8C A;  2W03 A;  2YU9 I;  1WW9 A;  3D2L A;  2M6N A;  2Q4Z A;  1K83 I;  1K73 2;  4MXU A;  3CC7 1;  2V8I A;  2W04 A;  4A3F I;  2NAP A;  3CCJ Z;  4NBD A;  3CC4 1;  3NH4 A;  3CCM Z;  1VQK Z;  1TWF I;  3VMG A;  1VQO 1;  3KIH A;  3G6E 1;  2G2K A;  5CM2 M;  1YJW Z;  3CCV 1;  3S2H I;  2VPY A;  3CCL 1;  3GTQ I;  2EGT A;  2QEX 1;  3VMI A;  2Y0S A;  1KC8 1;  3CME 1;  3CCQ Z;  3I56 Z;  4RVF A;  4E33 A;  2YAD A;  4E30 A;  4TNU A;  4A3G I;  1I6H I;  3NDJ A;  1RO0 A;  5C4X I;  3H3V J;  3ESW A;  5C3E I;  4MD7 A;  3VB9 A;  1VQ6 1;  4A3I I;  3S1M I;  4E31 A;  2JS4 A;  2NVY I;  4A3K I;  2RHB A;  2K5R A;  3G4S Z;  3PO3 S;  2E9H A;  1X3W A;  4BXX I;  4MRI A;  1YIT 1;  1TFI A;  4NBF A;  2JMO A;  2P3Y A;  4BY7 I;  4E2W A;  3OW2 Z;  2OOX B;  2DE7 A;  2NVT I;  1USP A;  1VQ8 Z;  1K73 1;  3CCE 1;  3CCQ 1;  1WZN A;  1Q7Y 1;  2I3C A;  3JAM b;  3CCS Z;  2J6A A;  1VQ7 1;  4BY1 I;  3CCE Z;  1VQP 1;  2DE5 A;  1QF8 A;  1Q7Y 2;  2R93 I;  3J80 f;  2PMZ A;  3MZK B;  3CD6 Z;  5D1O B;  3EER A;  1X0T A;  2RPR A;  3CCS 1;  4E2Y A;  1WII A;  1YJN Z;  1VQ4 Z;  3RZD I;  4EWC A;  1KC8 2;  3CPW Y;  3F3P C;  3GTM S;  2JIM A;  4X6A I;  1P9N A;  1FDI A;  2BJO A;  3HOY I;  2HF1 A;  1TWA I;  1VQ8 1;  3OW2 Y;  1VQM 1;  3LUS A;  3M3Y I;  1R9T I;  2AYD A;  5FLM I;  3CCU Z;  2OTJ Z;  1DL6 A;  2E7Z A;  3FKI I;  3J81 b;  1I50 I;  1YHQ Z;  5D1P A;  2B63 I;  1ZH1 A;  1VQK 1;  2IV2 X;  4E2X A;  1RQF A;  2F4O A;  2JIR A;  4NBB A;  2JR6 A;  1KRL A;  3NDI A;  3TDH B;  3J80 b;  1YJ9 Z;  5FLX f;  2DE6 A;  1LQL A;  4RV9 A;  3HOV I;  1PFT A;  2GTI A;  2JIO A;  2VUM I;  1M90 1;  2RT9 A;  1Q16 A;  3K7A I;  4MD8 A;  1QXF A;  3VMH A;  4RVG A;  3CCJ 1;  4E32 A;  5LL6 f;  3S15 I;  1YJ9 1;  3NH8 A;  2V8K A;  2WAQ A;  3G6E Z;  3FQQ A;  2NVQ I;  3PO2 I;  4MD9 A;  2K3R A;  3IF8 A;  3VTN A;  1VQ6 Z;  3S2D I;  3QWU A;  3GTP I;  4Y7N I;  4A3D I;  1VQ5 Z;  2JA7 I;  1N8R 1;  1ZB9 A;  4CL1 A;  3U50 C;  3TE5 B;  2QEX Z;  3T4N B;  4NBH A;  4DK1 A;  4BBS I;  3CCR Z;  3CPW Z;  1ZB8 A;  3CCM 1;  1VQ5 1;  3EED A;  1TWG I;  3GTG I;  2QRE B;  3GTM I;  1TWH I;  1VLA A;  1RNI A;  3I55 1;  3CCL Z;  1WJ2 A;  4NBC A;  3G71 Z;  4NBG A;  4RVH A;  5T64 A;  1Z02 A;  3G4S 1;  3GTL I;  3D6W A;  1I3Q I;  2PM9 A;  2Q51 A;  2QRC B;  3BG1 B;  3GCF A;  2JA5 I;  4A3E I;  1S72 1;  1M1K 1;  1Y1V S;  1N2F A;  3PO3 I; 
#chains in the Genus database with same CATH homology
 1Z03 A;  2OZK A;  2IZ3 A;  1VQN 1;  2JNY A;  4MH4 A;  1M1K 2;  1YIJ 1;  4A3C I;  2OOY B;  1USP B;  2OTL 1;  1M90 2;  1Y1W I;  2R92 I;  3RZO I;  2LFU A;  3HKZ A;  1Y1V I;  1S72 Z;  5C44 I;  4NB9 A;  5D1O A;  3Q87 A;  2M48 A;  4NOZ A;  1Q81 2;  3CCU 1;  2OTL Z;  2NVX I;  3S14 I;  3IX0 A;  1K8A 2;  3HOW I;  1K8A 1;  3M4O I;  5FLX b;  2E2J I;  1N8R 2;  3S17 I;  3I4N I;  2QLV B;  1YUA A;  4A3J I;  2O53 A;  1RLY A;  4QTU A;  3CXC Y;  4NB8 A;  4HGY A;  1RO2 A;  4NH1 C;  4RS4 A;  2HU9 A;  2PK7 A;  4RVD A;  2JUB A;  2AKL A;  1YI2 1;  2QR1 B;  1W2B Y;  3JAM f;  3J81 f;  2ZAE B;  2WB1 A;  3CXC Z;  1KD1 2;  3S1N I;  3CMA Z;  3HOU I;  1KQS Z;  2GU2 A;  3CME Z;  2RIQ A;  4BBR I;  1VQL Z;  1VQO Z;  1QVF Z;  4A3L I;  3CC4 Z;  3D9X A;  3CMA 1;  3FQM A;  5A2Q b;  3BG0 B;  1VQL 1;  1JWH C;  4DQY B;  1Q81 1;  4HGZ A;  3MZL B;  1VQ9 1;  3I56 1;  4NFR A;  3GTO I;  4S1T A;  2JA8 I;  4MON A;  3G71 1;  3CQZ I;  3HOZ I;  4DGL A;  2KPI A;  5IP9 I;  1K9M 2;  1QVG Z;  3I4M I;  2KI7 B;  3H0G I;  2RBL A;  1YJW 1;  2QRD B;  4A93 I;  2O4H A;  1KQS Y;  3CCV Z;  2R6M A;  3CCR 1;  3KIF A;  1TWC I;  4NBA A;  2QA4 1;  1QVG Y;  3I07 A;  5IP7 I;  4NBE A;  1QVF Y;  3I55 Z;  3NH5 A;  3IFU A;  3S1Q I;  1NJI 1;  1X3Z A;  3F3F C;  4QTT A;  3GTJ I;  2QA4 Z;  3CC2 1;  1L1O C;  1KD1 1;  1QYP A;  5T67 A;  3NFZ A;  1W2B Z;  1NJI 2;  3P5J B;  2LIY A;  1VQ9 Z;  2H85 A;  4XX2 A;  3CC2 Z;  3GKQ A;  1S7M A;  5A2Q f;  2R7Z I;  1VQ7 Z;  2QKD A;  1VQP Z;  1NUI A;  3CD6 1;  1RO4 A;  2IZ4 A;  1VQN Z;  5IT9 b;  2GTH A;  2JA6 I;  1ML8 A;  2OTJ 1;  3GTK I;  3MON A;  1NP6 A;  1YIT Z;  1VQ4 1;  3HOX I;  2E2H I;  2E2I I;  1Q86 1;  1JJ2 Y;  4E2Z A;  4Y52 I;  1Q86 2;  5AN9 F;  1YI2 Z;  4A3M I;  2VUG A;  5C4J I;  2V8J A;  3S16 I;  1VQM Z;  1K9M 1;  1Z01 A;  4A3B I;  1YIJ Z;  3S1R I;  2P28 A;  1JJ2 Z;  1Q82 1;  1WCM I;  4AYB A;  2F4M A;  5T6B A;  5IT9 f;  1YHQ 1;  1Q82 2;  3J7A 4;  1YJN 1;  2VF1 A;  4HH4 A;  1SFO I;  1YUK A;  3CC7 Z;  2W03 A;  2YU9 I;  1WW9 A;  2M6N A;  2Q4Z A;  1K83 I;  1K73 2;  4MXU A;  3CC7 1;  2V8I A;  2W04 A;  4A3F I;  3CCJ Z;  4NBD A;  3CC4 1;  3NH4 A;  3CCM Z;  1VQK Z;  1TWF I;  3VMG A;  1VQO 1;  3KIH A;  3G6E 1;  2G2K A;  5CM2 M;  1YJW Z;  3CCV 1;  3S2H I;  3CCL 1;  3GTQ I;  2EGT A;  2QEX 1;  3VMI A;  2Y0S A;  1KC8 1;  3CME 1;  3CCQ Z;  3I56 Z;  4RVF A;  4E33 A;  2YAD A;  4E30 A;  4TNU A;  4A3G I;  1I6H I;  3NDJ A;  1RO0 A;  5C4X I;  3H3V J;  3ESW A;  5C3E I;  4MD7 A;  3VB9 A;  1VQ6 1;  4A3I I;  3S1M I;  4E31 A;  2JS4 A;  2NVY I;  4A3K I;  2RHB A;  2K5R A;  3G4S Z;  3PO3 S;  2E9H A;  1X3W A;  4BXX I;  4MRI A;  1YIT 1;  1TFI A;  4NBF A;  2JMO A;  2P3Y A;  4BY7 I;  4E2W A;  3OW2 Z;  2OOX B;  2DE7 A;  2NVT I;  1USP A;  1VQ8 Z;  1K73 1;  3CCE 1;  3CCQ 1;  1Q7Y 1;  2I3C A;  3JAM b;  3CCS Z;  2J6A A;  1VQ7 1;  4BY1 I;  3CCE Z;  1VQP 1;  2DE5 A;  1QF8 A;  1Q7Y 2;  2R93 I;  3J80 f;  2PMZ A;  3MZK B;  3CD6 Z;  5D1O B;  3EER A;  1X0T A;  2RPR A;  3CCS 1;  4E2Y A;  1WII A;  1YJN Z;  1VQ4 Z;  3RZD I;  4EWC A;  1KC8 2;  3CPW Y;  3F3P C;  3GTM S;  4X6A I;  1P9N A;  2BJO A;  3HOY I;  2HF1 A;  1TWA I;  1VQ8 1;  3OW2 Y;  1VQM 1;  3LUS A;  3M3Y I;  1R9T I;  3CCU Z;  5FLM I;  2OTJ Z;  1DL6 A;  3FKI I;  3J81 b;  1I50 I;  1YHQ Z;  5D1P A;  2B63 I;  1ZH1 A;  1VQK 1;  4E2X A;  1RQF A;  2F4O A;  4NBB A;  2JR6 A;  1KRL A;  3NDI A;  3TDH B;  3J80 b;  1YJ9 Z;  5FLX f;  2DE6 A;  1LQL A;  4RV9 A;  3HOV I;  1PFT A;  2GTI A;  2VUM I;  1M90 1;  2RT9 A;  3K7A I;  4MD8 A;  3VMH A;  4RVG A;  3CCJ 1;  4E32 A;  5LL6 f;  3S15 I;  1YJ9 1;  3NH8 A;  2V8K A;  2WAQ A;  3G6E Z;  3FQQ A;  2NVQ I;  3PO2 I;  4MD9 A;  2K3R A;  3IF8 A;  3VTN A;  1VQ6 Z;  3S2D I;  3QWU A;  3GTP I;  4Y7N I;  4A3D I;  1VQ5 Z;  2JA7 I;  1N8R 1;  1ZB9 A;  4CL1 A;  3U50 C;  3TE5 B;  2QEX Z;  3T4N B;  4NBH A;  4DK1 A;  4BBS I;  3CCR Z;  3CPW Z;  1ZB8 A;  3CCM 1;  1VQ5 1;  3EED A;  1TWG I;  3GTG I;  2QRE B;  3GTM I;  1TWH I;  1VLA A;  1RNI A;  3I55 1;  3CCL Z;  4NBC A;  3G71 Z;  4NBG A;  4RVH A;  5T64 A;  1Z02 A;  3G4S 1;  3GTL I;  3D6W A;  1I3Q I;  2PM9 A;  2Q51 A;  2QRC B;  3BG1 B;  3GCF A;  2JA5 I;  4A3E I;  1S72 1;  1M1K 1;  1Y1V S;  1N2F A;  3PO3 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...