3GTKI

Backtracked rna polymerase ii complex with 18mer rna
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
total genus 11
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtkI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtkI02
4A3LI 4A3JI 4NBEA 3HOYI 2NVYI 1RO4A 2E2HI 4NBGA 2K5RA 3U50C 3GTKI 1Y1VS 2VUMI 4NB9A 3FKII 3S16I 4A3DI 3S1MI 2DE5A 2R93I 5C44I 3ESWA 3GCFA 3S1NI 4BY7I 4A3BI 2NVTI 5FLMI 1X3ZA 3Q87A 4BY1I 4BBSI 1I50I 2DE7A 3VB9A 3GTJI 3S17I 3HOXI 3HOWI 3M3YI 3CQZI 4A3II 4NB8A 4A3KI 2JNYA 2KPIA 4MH4A 2JA6I 2RBLA 2NVQI 2JA5I 2JR6A 3S2DI 3RZDI 3GTOI 3VMHA 1QYPA 3PO3S 5IP9I 3GTMS 2J6AA 1Y1VI 4A3FI 3GKQA 1SFOI 3S1RI 4BBRI 1N2FA 1PFTA 3S2HI 3GTGI 3EERA 2BJOA 3I07A 1K83I 4NBHA 5IP7I 3D6WA 4A3CI 4NBDA 3HOZI 3I4NI 2F4MA 1L1OC 3PO2I 1TFIA 1X3WA 2E2II 3I4MI 5C4XI 1I6HI 3RZOI 4X6AI 4NBCA 5CM2M 1USPB 3LUSA 1NUIA 1Y1WI 3HOUI 4Y52I 1ZB8A 4A93I 2DE6A 3S1QI 4NOZA 1R9TI 3VMGA 2JA7I 3PO3I 5C4JI 1TWHI 1LQLA 3K7AI 4A3MI 2HF1A 3GTMI 4XX2A 4BXXI 2JA8I 4NBFA 2E2JI 4QTTA 1TWGI 4QTUA 1WW9A 3H0GI 1RLYA 2F4OA 1I3QI 1YUAA 2R92I 4NBBA 1TWFI 3GTPI 2YU9I 3HOVI 4Y7NI 4A3EI 2AKLA 1WCMI 3M4OI 1ZB9A 1VLAA 2B63I 1TWAI 3H3VJ 3GTQI 3S15I 2NVXI 3VMIA 2R7ZI 4A3GI 1DL6A 1USPA 2PK7A 1TWCI 5C3EI 3S14I 4NBAA 1ML8A 2JS4A 3GTLI 2P3YA
chains in the Genus database with same CATH superfamily
4RVGA 3HOYI 1FDIA 3GTKI 2PM9A 1VQL1 4RVHA 1NJI2 3FKII 1VQ91 2R93I 3GCFA 2JUBA 3T4NB 1VQP1 5FLMI 3CC71 3J80f 3HOXI 1N8R2 1K732 5FLXb 1Z01A 2LFUA 4MH4A 1YJNZ 2WAQA 3NH8A 2GTIA 1Q821 2JA5I 3CCQZ 3VMHA 4HGZA 2G2KA 2IZ4A 2OTJ1 3GTMS 3CCLZ 1Y1VI 3GKQA 3CCJ1 3S1RI 5IT9b 4S1TA 3EERA 2QRDB 1QVFZ 3I4NI 3F3PC 2W03A 3HKZA 2F4MA 3TDHB 1VQ7Z 1NJI1 1USPB 3HOUI 1VQ5Z 2P28A 2JA7I 3K7AI 1W2BY 2V8IA 3MZLB 4HGYA 1X0TA 4NBFA 1N8R1 2E2JI 4EWCA 1K731 1YJN1 3F3FC 4MRIA 3P5JB 1Y8CA 2Q51A 1JJ2Y 2QRCB 3CXCY 2R92I 4NBBA 1TWFI 3G6EZ 4RVFA 4NH1C 4E2YA 2VPWA 1YIJZ 2B63I 1TWAI 3IFUA 1WZNA 2NAPA 4DGLA 1NP6A 1DL6A 4NFRA 2EGTA 1USPA 3D9XA 1TWCI 2OZKA 3S14I 2JMOA 2JS4A 1VQ71 3CPWY 2K3RA 1KC82 3CCU1 1VQ51 1RO4A 3J80b 4NBGA 3G4S1 2K5RA 3U50C 2QEXZ 3CMEZ 1Y1VS 2VUMI 2DE5A 2E9HA 4MD9A 3G71Z 4E30A 3I55Z 2DE7A 1WJ2A 3S17I 2R6MA 1S72Z 3G6E1 2RHBA 2JA6I 1YIJ1 4E2XA 1Q16A 2NVQI 2VPYA 3RZDI 2V45A 5IP9I 2O4HA 1M1K1 4MD7A 3CCMZ 2J6AA 4BBRI 4E2WA 4MD8A 4E32A 1PFTA 3S2HI 2RIQA 2BJOA 3I07A 1K83I 5IP7I 2WB1A 2VUGA 1K9M2 2QR1B 1Q812 4DQYB 3MZKB 2OTLZ 3HOZI 2QEX1 3CME1 1X3WA 2E2II 2RT9A 1QVGY 3I4MI 3RZOI 3G711 4X6AI 2LIYA 1Q862 2Q4ZA 3J81f 5CM2M 3LUSA 2JIQA 1ZB8A 1KD11 4NOZA 1R9TI 3VMGA 3PO3I 4A3MI 1TWHI 1LQLA 3BG1B 4AYBA 1S721 3FQQA 2ZAEB 4QTTA 1VQNZ 2H85A 1WW9A 3VTNA 3KIFA 2E7ZA 3NH5A 2QLVB 1JJ2Z 3HOVI 4Y7NI 1KRLA 1K8A2 1YI2Z 1WCMI 1ZH1A 3M4OI 1VLAA 2NVXI 5T67A 2M6NA 2OTL1 2VPXA 4A3GI 1Q811 2PK7A 2RPRA 3CC4Z 2JIOA 3OW2Z 2P3YA 2KI7B 1P9NA 3I56Z 2NVYI 3CCQ1 1Q861 5LL6f 2E2HI 2IZ3A 3CCL1 3CCEZ 3CCRZ 4A3DI 3S1MI 2V8JA 3ESWA 4BY7I 1VQN1 1YITZ 1X3ZA 4DK1A 1VQKZ 1KQSZ 4BY1I 4BBSI 3GTJI 3HOWI 5AN9F 2GTHA 3MONA 4A3KI 2JNYA 3CMAZ 1Z02A 2KPIA 1YI21 5D1OB 1K8A1 1FDOA 3PO3S 1YUKA 4RV9A 4A3FI 1VQLZ 1RQFA 3CC41 3KIHA 1SIWA 4NBHA 4E2ZA 3IR7A 3J81b 2W04A 2O53A 1L1OC 3CCR1 3EEDA 3PO2I 1TFIA 5C4XI 1QVGZ 1YIT1 4Y52I 1VQK1 5T6BA 4A93I 3S1QI 1JWHC 1VQOZ 5C4JI 2HF1A 4E31A 4XX2A 4BXXI 3CCSZ 3CMA1 2JA8I 5A2Qf 4QTUA 1KC81 2QA4Z 1QXFA 1VQMZ 1RLYA 4TNUA 1YUAA 2GU2A 2IV2X 2AKLA 3JAMf 1ZB9A 3I551 1VQ4Z 2JIPA 3IX0A 3VMIA 1RNIA 1VQ8Z 1W2BZ 5C3EI 1YHQZ 3CCVZ 1M902 4A3LI 3CC2Z 4A3JI 4NBEA 3BG0B 2VF1A 2VPZA 4MONA 3CCM1 1VQO1 1YJWZ 3CXCZ 4NB9A 3S16I 3CCS1 5C44I 3S1NI 4A3BI 2NVTI 2PMZA 3Q87A 2QA41 4RS4A 1VQM1 1I50I 3J7A4 1K9M1 3VB9A 2OOXB 3M3YI 3CQZI 4A3II 5T64A 1RO0A 4NB8A 5D1PA 1S7MA 2RBLA 3CPWZ 1VQ41 2OOYB 3CCUZ 2M48A 2JR6A 3S2DI 2LEXA 3GTOI 1QYPA 1Q7Y2 3G4SZ 5FLXf 1VQ6Z 1SFOI 1VQ81 1YHQ1 1N2FA 2QREB 4RVDA 3CCV1 3CC21 3GTGI 1QVFY 1M901 3D6WA 3CD6Z 4A3CI 4NBDA 1YJ9Z 3NH4A 1YJW1 3TE5B 5IT9f 1I6HI 3NFZA 1QF8A 4NBCA 5A2Qb 1Y1WI 1NUIA 2QKDA 2DE6A 2JIRA 2V8KA 2V3VA 1WIIA 1M1K2 3GTMI 1Z03A 2JIMA 1VQ9Z 2YADA 3OW2Y 1RO2A 3I561 1TWGI 4MXUA 4CL1A 1VQPZ 3JAMb 3CC7Z 3FQMA 3IF8A 3H0GI 2I3CA 4HH4A 2F4OA 2Y0SA 1I3QI 3CCE1 3GTPI 1Q7Y1 2YU9I 1VQ61 4A3EI 3QWUA 1Q822 3GTQI 1KQSY 3H3VJ 3S15I 2AYDA 1KD12 3NDIA 3CD61 2R7ZI 5D1OA 4E33A 3NDJA 1YJ91 2OTJZ 3CCJZ 3D2LA 1AA6A 2HU9A 4NBAA 1ML8A 3GTLI
chains in the Genus database with same CATH topology
4RVGA 3HOYI 3GTKI 2PM9A 1VQL1 4RVHA 1NJI2 3FKII 1VQ91 2R93I 3GCFA 2JUBA 3T4NB 1VQP1 5FLMI 3CC71 3J80f 3HOXI 1N8R2 1K732 5FLXb 1Z01A 2LFUA 4MH4A 1YJNZ 2WAQA 3NH8A 2GTIA 1Q821 2JA5I 3CCQZ 3VMHA 4HGZA 2G2KA 2IZ4A 2OTJ1 3GTMS 3CCLZ 1Y1VI 3GKQA 3CCJ1 3S1RI 5IT9b 4S1TA 3EERA 2QRDB 1QVFZ 3I4NI 3F3PC 2W03A 3HKZA 2F4MA 3TDHB 1VQ7Z 1NJI1 1USPB 3HOUI 1VQ5Z 2P28A 2JA7I 3K7AI 1W2BY 2V8IA 3MZLB 4HGYA 1X0TA 4NBFA 1N8R1 2E2JI 4EWCA 1K731 1YJN1 3F3FC 4MRIA 3P5JB 2Q51A 1JJ2Y 2QRCB 3CXCY 2R92I 4NBBA 1TWFI 3G6EZ 4RVFA 4NH1C 4E2YA 1YIJZ 2B63I 1TWAI 3IFUA 4DGLA 1NP6A 1DL6A 4NFRA 2EGTA 1USPA 3D9XA 1TWCI 2OZKA 3S14I 2JMOA 2JS4A 1VQ71 3CPWY 2K3RA 1KC82 3CCU1 1VQ51 1RO4A 3J80b 4NBGA 3G4S1 2K5RA 3U50C 2QEXZ 3CMEZ 1Y1VS 2VUMI 2DE5A 2E9HA 4MD9A 3G71Z 4E30A 3I55Z 2DE7A 3S17I 2R6MA 1S72Z 3G6E1 2RHBA 2JA6I 1YIJ1 4E2XA 2NVQI 3RZDI 5IP9I 2O4HA 1M1K1 4MD7A 3CCMZ 2J6AA 4BBRI 4E2WA 4MD8A 4E32A 1PFTA 3S2HI 2RIQA 2BJOA 3I07A 1K83I 5IP7I 2WB1A 2VUGA 1K9M2 2QR1B 1Q812 4DQYB 3MZKB 2OTLZ 3HOZI 2QEX1 3CME1 1X3WA 2E2II 2RT9A 1QVGY 3I4MI 3RZOI 3G711 4X6AI 2LIYA 1Q862 2Q4ZA 3J81f 5CM2M 3LUSA 1ZB8A 1KD11 4NOZA 1R9TI 3VMGA 3PO3I 4A3MI 1TWHI 1LQLA 3BG1B 4AYBA 1S721 3FQQA 2ZAEB 4QTTA 1VQNZ 2H85A 1WW9A 3VTNA 3KIFA 3NH5A 2QLVB 1JJ2Z 3HOVI 4Y7NI 1KRLA 1K8A2 1YI2Z 1WCMI 1ZH1A 3M4OI 1VLAA 2NVXI 5T67A 2M6NA 2OTL1 4A3GI 1Q811 2PK7A 2RPRA 3CC4Z 3OW2Z 2P3YA 2KI7B 1P9NA 3I56Z 2NVYI 3CCQ1 1Q861 5LL6f 2E2HI 2IZ3A 3CCL1 3CCEZ 3CCRZ 4A3DI 3S1MI 2V8JA 3ESWA 4BY7I 1VQN1 1YITZ 1X3ZA 4DK1A 1VQKZ 1KQSZ 4BY1I 4BBSI 3GTJI 3HOWI 5AN9F 2GTHA 3MONA 4A3KI 2JNYA 3CMAZ 1Z02A 2KPIA 1YI21 5D1OB 1K8A1 3PO3S 1YUKA 4RV9A 4A3FI 1VQLZ 1RQFA 3CC41 3KIHA 4NBHA 4E2ZA 3J81b 2W04A 2O53A 1L1OC 3CCR1 3EEDA 3PO2I 1TFIA 5C4XI 1QVGZ 1YIT1 4Y52I 1VQK1 5T6BA 4A93I 3S1QI 1JWHC 1VQOZ 5C4JI 2HF1A 4E31A 4XX2A 4BXXI 3CCSZ 3CMA1 2JA8I 5A2Qf 4QTUA 1KC81 2QA4Z 1VQMZ 1RLYA 4TNUA 1YUAA 2GU2A 2AKLA 3JAMf 1ZB9A 3I551 1VQ4Z 3IX0A 3VMIA 1RNIA 1VQ8Z 1W2BZ 5C3EI 1YHQZ 3CCVZ 1M902 4A3LI 3CC2Z 4A3JI 4NBEA 3BG0B 2VF1A 4MONA 3CCM1 1VQO1 1YJWZ 3CXCZ 4NB9A 3S16I 3CCS1 5C44I 3S1NI 4A3BI 2NVTI 2PMZA 3Q87A 2QA41 4RS4A 1VQM1 1I50I 3J7A4 1K9M1 3VB9A 2OOXB 3M3YI 3CQZI 4A3II 5T64A 1RO0A 4NB8A 5D1PA 1S7MA 2RBLA 3CPWZ 1VQ41 2OOYB 3CCUZ 2M48A 2JR6A 3S2DI 3GTOI 1QYPA 1Q7Y2 3G4SZ 5FLXf 1VQ6Z 1SFOI 1VQ81 1YHQ1 1N2FA 2QREB 4RVDA 3CCV1 3CC21 3GTGI 1QVFY 1M901 3D6WA 3CD6Z 4A3CI 4NBDA 1YJ9Z 3NH4A 1YJW1 3TE5B 5IT9f 1I6HI 3NFZA 1QF8A 4NBCA 5A2Qb 1Y1WI 1NUIA 2QKDA 2DE6A 2V8KA 1WIIA 1M1K2 3GTMI 1Z03A 1VQ9Z 2YADA 3OW2Y 1RO2A 3I561 1TWGI 4MXUA 4CL1A 1VQPZ 3JAMb 3CC7Z 3FQMA 3IF8A 3H0GI 2I3CA 4HH4A 2F4OA 2Y0SA 1I3QI 3CCE1 3GTPI 1Q7Y1 2YU9I 1VQ61 4A3EI 3QWUA 1Q822 3GTQI 1KQSY 3H3VJ 3S15I 1KD12 3NDIA 3CD61 2R7ZI 5D1OA 4E33A 3NDJA 1YJ91 2OTJZ 3CCJZ 2HU9A 4NBAA 1ML8A 3GTLI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3L I;  4A3J I;  4NBE A;  3HOY I;  2NVY I;  1RO4 A;  2E2H I;  4NBG A;  2K5R A;  3U50 C;  3GTK I;  1Y1V S;  2VUM I;  4NB9 A;  3FKI I;  3S16 I;  4A3D I;  3S1M I;  2DE5 A;  2R93 I;  5C44 I;  3ESW A;  3GCF A;  3S1N I;  4BY7 I;  4A3B I;  2NVT I;  5FLM I;  1X3Z A;  3Q87 A;  4BY1 I;  4BBS I;  1I50 I;  2DE7 A;  3VB9 A;  3GTJ I;  3S17 I;  3HOX I;  3HOW I;  3M3Y I;  3CQZ I;  4A3I I;  4NB8 A;  4A3K I;  2JNY A;  2KPI A;  4MH4 A;  2JA6 I;  2RBL A;  2NVQ I;  2JA5 I;  2JR6 A;  3S2D I;  3RZD I;  3GTO I;  3VMH A;  1QYP A;  3PO3 S;  5IP9 I;  3GTM S;  2J6A A;  1Y1V I;  4A3F I;  3GKQ A;  1SFO I;  3S1R I;  4BBR I;  1N2F A;  1PFT A;  3S2H I;  3GTG I;  3EER A;  2BJO A;  3I07 A;  1K83 I;  4NBH A;  5IP7 I;  3D6W A;  4A3C I;  4NBD A;  3HOZ I;  3I4N I;  2F4M A;  1L1O C;  3PO2 I;  1TFI A;  1X3W A;  2E2I I;  3I4M I;  5C4X I;  1I6H I;  3RZO I;  4X6A I;  4NBC A;  5CM2 M;  1USP B;  3LUS A;  1NUI A;  1Y1W I;  3HOU I;  4Y52 I;  1ZB8 A;  4A93 I;  2DE6 A;  3S1Q I;  4NOZ A;  1R9T I;  3VMG A;  2JA7 I;  3PO3 I;  5C4J I;  1TWH I;  1LQL A;  3K7A I;  4A3M I;  2HF1 A;  3GTM I;  4XX2 A;  4BXX I;  2JA8 I;  4NBF A;  2E2J I;  4QTT A;  1TWG I;  4QTU A;  1WW9 A;  3H0G I;  1RLY A;  2F4O A;  1I3Q I;  1YUA A;  2R92 I;  4NBB A;  1TWF I;  3GTP I;  2YU9 I;  3HOV I;  4Y7N I;  4A3E I;  2AKL A;  1WCM I;  3M4O I;  1ZB9 A;  1VLA A;  2B63 I;  1TWA I;  3H3V J;  3GTQ I;  3S15 I;  2NVX I;  3VMI A;  2R7Z I;  4A3G I;  1DL6 A;  1USP A;  2PK7 A;  1TWC I;  5C3E I;  3S14 I;  4NBA A;  1ML8 A;  2JS4 A;  3GTL I;  2P3Y A; 
#chains in the Genus database with same CATH topology
 4RVG A;  3HOY I;  1FDI A;  3GTK I;  2PM9 A;  1VQL 1;  4RVH A;  1NJI 2;  3FKI I;  1VQ9 1;  2R93 I;  3GCF A;  2JUB A;  3T4N B;  1VQP 1;  5FLM I;  3CC7 1;  3J80 f;  3HOX I;  1N8R 2;  1K73 2;  5FLX b;  1Z01 A;  2LFU A;  4MH4 A;  1YJN Z;  2WAQ A;  3NH8 A;  2GTI A;  1Q82 1;  2JA5 I;  3CCQ Z;  3VMH A;  4HGZ A;  2G2K A;  2IZ4 A;  2OTJ 1;  3GTM S;  3CCL Z;  1Y1V I;  3GKQ A;  3CCJ 1;  3S1R I;  5IT9 b;  4S1T A;  3EER A;  2QRD B;  1QVF Z;  3I4N I;  3F3P C;  2W03 A;  3HKZ A;  2F4M A;  3TDH B;  1VQ7 Z;  1NJI 1;  1USP B;  3HOU I;  1VQ5 Z;  2P28 A;  2JA7 I;  3K7A I;  1W2B Y;  2V8I A;  3MZL B;  4HGY A;  1X0T A;  4NBF A;  1N8R 1;  2E2J I;  4EWC A;  1K73 1;  1YJN 1;  3F3F C;  4MRI A;  3P5J B;  1Y8C A;  2Q51 A;  1JJ2 Y;  2QRC B;  3CXC Y;  2R92 I;  4NBB A;  1TWF I;  3G6E Z;  4RVF A;  4NH1 C;  4E2Y A;  2VPW A;  1YIJ Z;  2B63 I;  1TWA I;  3IFU A;  1WZN A;  2NAP A;  4DGL A;  1NP6 A;  1DL6 A;  4NFR A;  2EGT A;  1USP A;  3D9X A;  1TWC I;  2OZK A;  3S14 I;  2JMO A;  2JS4 A;  1VQ7 1;  3CPW Y;  2K3R A;  1KC8 2;  3CCU 1;  1VQ5 1;  1RO4 A;  3J80 b;  4NBG A;  3G4S 1;  2K5R A;  3U50 C;  2QEX Z;  3CME Z;  1Y1V S;  2VUM I;  2DE5 A;  2E9H A;  4MD9 A;  3G71 Z;  4E30 A;  3I55 Z;  2DE7 A;  1WJ2 A;  3S17 I;  2R6M A;  1S72 Z;  3G6E 1;  2RHB A;  2JA6 I;  1YIJ 1;  4E2X A;  1Q16 A;  2NVQ I;  2VPY A;  3RZD I;  2V45 A;  5IP9 I;  2O4H A;  1M1K 1;  4MD7 A;  3CCM Z;  2J6A A;  4BBR I;  4E2W A;  4MD8 A;  4E32 A;  1PFT A;  3S2H I;  2RIQ A;  2BJO A;  3I07 A;  1K83 I;  5IP7 I;  2WB1 A;  2VUG A;  1K9M 2;  2QR1 B;  1Q81 2;  4DQY B;  3MZK B;  2OTL Z;  3HOZ I;  2QEX 1;  3CME 1;  1X3W A;  2E2I I;  2RT9 A;  1QVG Y;  3I4M I;  3RZO I;  3G71 1;  4X6A I;  2LIY A;  1Q86 2;  2Q4Z A;  3J81 f;  5CM2 M;  3LUS A;  2JIQ A;  1ZB8 A;  1KD1 1;  4NOZ A;  1R9T I;  3VMG A;  3PO3 I;  4A3M I;  1TWH I;  1LQL A;  3BG1 B;  4AYB A;  1S72 1;  3FQQ A;  2ZAE B;  4QTT A;  1VQN Z;  2H85 A;  1WW9 A;  3VTN A;  3KIF A;  2E7Z A;  3NH5 A;  2QLV B;  1JJ2 Z;  3HOV I;  4Y7N I;  1KRL A;  1K8A 2;  1YI2 Z;  1WCM I;  1ZH1 A;  3M4O I;  1VLA A;  2NVX I;  5T67 A;  2M6N A;  2OTL 1;  2VPX A;  4A3G I;  1Q81 1;  2PK7 A;  2RPR A;  3CC4 Z;  2JIO A;  3OW2 Z;  2P3Y A;  2KI7 B;  1P9N A;  3I56 Z;  2NVY I;  3CCQ 1;  1Q86 1;  5LL6 f;  2E2H I;  2IZ3 A;  3CCL 1;  3CCE Z;  3CCR Z;  4A3D I;  3S1M I;  2V8J A;  3ESW A;  4BY7 I;  1VQN 1;  1YIT Z;  1X3Z A;  4DK1 A;  1VQK Z;  1KQS Z;  4BY1 I;  4BBS I;  3GTJ I;  3HOW I;  5AN9 F;  2GTH A;  3MON A;  4A3K I;  2JNY A;  3CMA Z;  1Z02 A;  2KPI A;  1YI2 1;  5D1O B;  1K8A 1;  1FDO A;  3PO3 S;  1YUK A;  4RV9 A;  4A3F I;  1VQL Z;  1RQF A;  3CC4 1;  3KIH A;  1SIW A;  4NBH A;  4E2Z A;  3IR7 A;  3J81 b;  2W04 A;  2O53 A;  1L1O C;  3CCR 1;  3EED A;  3PO2 I;  1TFI A;  5C4X I;  1QVG Z;  1YIT 1;  4Y52 I;  1VQK 1;  5T6B A;  4A93 I;  3S1Q I;  1JWH C;  1VQO Z;  5C4J I;  2HF1 A;  4E31 A;  4XX2 A;  4BXX I;  3CCS Z;  3CMA 1;  2JA8 I;  5A2Q f;  4QTU A;  1KC8 1;  2QA4 Z;  1QXF A;  1VQM Z;  1RLY A;  4TNU A;  1YUA A;  2GU2 A;  2IV2 X;  2AKL A;  3JAM f;  1ZB9 A;  3I55 1;  1VQ4 Z;  2JIP A;  3IX0 A;  3VMI A;  1RNI A;  1VQ8 Z;  1W2B Z;  5C3E I;  1YHQ Z;  3CCV Z;  1M90 2;  4A3L I;  3CC2 Z;  4A3J I;  4NBE A;  3BG0 B;  2VF1 A;  2VPZ A;  4MON A;  3CCM 1;  1VQO 1;  1YJW Z;  3CXC Z;  4NB9 A;  3S16 I;  3CCS 1;  5C44 I;  3S1N I;  4A3B I;  2NVT I;  2PMZ A;  3Q87 A;  2QA4 1;  4RS4 A;  1VQM 1;  1I50 I;  3J7A 4;  1K9M 1;  3VB9 A;  2OOX B;  3M3Y I;  3CQZ I;  4A3I I;  5T64 A;  1RO0 A;  4NB8 A;  5D1P A;  1S7M A;  2RBL A;  3CPW Z;  1VQ4 1;  2OOY B;  3CCU Z;  2M48 A;  2JR6 A;  3S2D I;  2LEX A;  3GTO I;  1QYP A;  1Q7Y 2;  3G4S Z;  5FLX f;  1VQ6 Z;  1SFO I;  1VQ8 1;  1YHQ 1;  1N2F A;  2QRE B;  4RVD A;  3CCV 1;  3CC2 1;  3GTG I;  1QVF Y;  1M90 1;  3D6W A;  3CD6 Z;  4A3C I;  4NBD A;  1YJ9 Z;  3NH4 A;  1YJW 1;  3TE5 B;  5IT9 f;  1I6H I;  3NFZ A;  1QF8 A;  4NBC A;  5A2Q b;  1Y1W I;  1NUI A;  2QKD A;  2DE6 A;  2JIR A;  2V8K A;  2V3V A;  1WII A;  1M1K 2;  3GTM I;  1Z03 A;  2JIM A;  1VQ9 Z;  2YAD A;  3OW2 Y;  1RO2 A;  3I56 1;  1TWG I;  4MXU A;  4CL1 A;  1VQP Z;  3JAM b;  3CC7 Z;  3FQM A;  3IF8 A;  3H0G I;  2I3C A;  4HH4 A;  2F4O A;  2Y0S A;  1I3Q I;  3CCE 1;  3GTP I;  1Q7Y 1;  2YU9 I;  1VQ6 1;  4A3E I;  3QWU A;  1Q82 2;  3GTQ I;  1KQS Y;  3H3V J;  3S15 I;  2AYD A;  1KD1 2;  3NDI A;  3CD6 1;  2R7Z I;  5D1O A;  4E33 A;  3NDJ A;  1YJ9 1;  2OTJ Z;  3CCJ Z;  3D2L A;  1AA6 A;  2HU9 A;  4NBA A;  1ML8 A;  3GTL I; 
#chains in the Genus database with same CATH homology
 4RVG A;  3HOY I;  3GTK I;  2PM9 A;  1VQL 1;  4RVH A;  1NJI 2;  3FKI I;  1VQ9 1;  2R93 I;  3GCF A;  2JUB A;  3T4N B;  1VQP 1;  5FLM I;  3CC7 1;  3J80 f;  3HOX I;  1N8R 2;  1K73 2;  5FLX b;  1Z01 A;  2LFU A;  4MH4 A;  1YJN Z;  2WAQ A;  3NH8 A;  2GTI A;  1Q82 1;  2JA5 I;  3CCQ Z;  3VMH A;  4HGZ A;  2G2K A;  2IZ4 A;  2OTJ 1;  3GTM S;  3CCL Z;  1Y1V I;  3GKQ A;  3CCJ 1;  3S1R I;  5IT9 b;  4S1T A;  3EER A;  2QRD B;  1QVF Z;  3I4N I;  3F3P C;  2W03 A;  3HKZ A;  2F4M A;  3TDH B;  1VQ7 Z;  1NJI 1;  1USP B;  3HOU I;  1VQ5 Z;  2P28 A;  2JA7 I;  3K7A I;  1W2B Y;  2V8I A;  3MZL B;  4HGY A;  1X0T A;  4NBF A;  1N8R 1;  2E2J I;  4EWC A;  1K73 1;  1YJN 1;  3F3F C;  4MRI A;  3P5J B;  2Q51 A;  1JJ2 Y;  2QRC B;  3CXC Y;  2R92 I;  4NBB A;  1TWF I;  3G6E Z;  4RVF A;  4NH1 C;  4E2Y A;  1YIJ Z;  2B63 I;  1TWA I;  3IFU A;  4DGL A;  1NP6 A;  1DL6 A;  4NFR A;  2EGT A;  1USP A;  3D9X A;  1TWC I;  2OZK A;  3S14 I;  2JMO A;  2JS4 A;  1VQ7 1;  3CPW Y;  2K3R A;  1KC8 2;  3CCU 1;  1VQ5 1;  1RO4 A;  3J80 b;  4NBG A;  3G4S 1;  2K5R A;  3U50 C;  2QEX Z;  3CME Z;  1Y1V S;  2VUM I;  2DE5 A;  2E9H A;  4MD9 A;  3G71 Z;  4E30 A;  3I55 Z;  2DE7 A;  3S17 I;  2R6M A;  1S72 Z;  3G6E 1;  2RHB A;  2JA6 I;  1YIJ 1;  4E2X A;  2NVQ I;  3RZD I;  5IP9 I;  2O4H A;  1M1K 1;  4MD7 A;  3CCM Z;  2J6A A;  4BBR I;  4E2W A;  4MD8 A;  4E32 A;  1PFT A;  3S2H I;  2RIQ A;  2BJO A;  3I07 A;  1K83 I;  5IP7 I;  2WB1 A;  2VUG A;  1K9M 2;  2QR1 B;  1Q81 2;  4DQY B;  3MZK B;  2OTL Z;  3HOZ I;  2QEX 1;  3CME 1;  1X3W A;  2E2I I;  2RT9 A;  1QVG Y;  3I4M I;  3RZO I;  3G71 1;  4X6A I;  2LIY A;  1Q86 2;  2Q4Z A;  3J81 f;  5CM2 M;  3LUS A;  1ZB8 A;  1KD1 1;  4NOZ A;  1R9T I;  3VMG A;  3PO3 I;  4A3M I;  1TWH I;  1LQL A;  3BG1 B;  4AYB A;  1S72 1;  3FQQ A;  2ZAE B;  4QTT A;  1VQN Z;  2H85 A;  1WW9 A;  3VTN A;  3KIF A;  3NH5 A;  2QLV B;  1JJ2 Z;  3HOV I;  4Y7N I;  1KRL A;  1K8A 2;  1YI2 Z;  1WCM I;  1ZH1 A;  3M4O I;  1VLA A;  2NVX I;  5T67 A;  2M6N A;  2OTL 1;  4A3G I;  1Q81 1;  2PK7 A;  2RPR A;  3CC4 Z;  3OW2 Z;  2P3Y A;  2KI7 B;  1P9N A;  3I56 Z;  2NVY I;  3CCQ 1;  1Q86 1;  5LL6 f;  2E2H I;  2IZ3 A;  3CCL 1;  3CCE Z;  3CCR Z;  4A3D I;  3S1M I;  2V8J A;  3ESW A;  4BY7 I;  1VQN 1;  1YIT Z;  1X3Z A;  4DK1 A;  1VQK Z;  1KQS Z;  4BY1 I;  4BBS I;  3GTJ I;  3HOW I;  5AN9 F;  2GTH A;  3MON A;  4A3K I;  2JNY A;  3CMA Z;  1Z02 A;  2KPI A;  1YI2 1;  5D1O B;  1K8A 1;  3PO3 S;  1YUK A;  4RV9 A;  4A3F I;  1VQL Z;  1RQF A;  3CC4 1;  3KIH A;  4NBH A;  4E2Z A;  3J81 b;  2W04 A;  2O53 A;  1L1O C;  3CCR 1;  3EED A;  3PO2 I;  1TFI A;  5C4X I;  1QVG Z;  1YIT 1;  4Y52 I;  1VQK 1;  5T6B A;  4A93 I;  3S1Q I;  1JWH C;  1VQO Z;  5C4J I;  2HF1 A;  4E31 A;  4XX2 A;  4BXX I;  3CCS Z;  3CMA 1;  2JA8 I;  5A2Q f;  4QTU A;  1KC8 1;  2QA4 Z;  1VQM Z;  1RLY A;  4TNU A;  1YUA A;  2GU2 A;  2AKL A;  3JAM f;  1ZB9 A;  3I55 1;  1VQ4 Z;  3IX0 A;  3VMI A;  1RNI A;  1VQ8 Z;  1W2B Z;  5C3E I;  1YHQ Z;  3CCV Z;  1M90 2;  4A3L I;  3CC2 Z;  4A3J I;  4NBE A;  3BG0 B;  2VF1 A;  4MON A;  3CCM 1;  1VQO 1;  1YJW Z;  3CXC Z;  4NB9 A;  3S16 I;  3CCS 1;  5C44 I;  3S1N I;  4A3B I;  2NVT I;  2PMZ A;  3Q87 A;  2QA4 1;  4RS4 A;  1VQM 1;  1I50 I;  3J7A 4;  1K9M 1;  3VB9 A;  2OOX B;  3M3Y I;  3CQZ I;  4A3I I;  5T64 A;  1RO0 A;  4NB8 A;  5D1P A;  1S7M A;  2RBL A;  3CPW Z;  1VQ4 1;  2OOY B;  3CCU Z;  2M48 A;  2JR6 A;  3S2D I;  3GTO I;  1QYP A;  1Q7Y 2;  3G4S Z;  5FLX f;  1VQ6 Z;  1SFO I;  1VQ8 1;  1YHQ 1;  1N2F A;  2QRE B;  4RVD A;  3CCV 1;  3CC2 1;  3GTG I;  1QVF Y;  1M90 1;  3D6W A;  3CD6 Z;  4A3C I;  4NBD A;  1YJ9 Z;  3NH4 A;  1YJW 1;  3TE5 B;  5IT9 f;  1I6H I;  3NFZ A;  1QF8 A;  4NBC A;  5A2Q b;  1Y1W I;  1NUI A;  2QKD A;  2DE6 A;  2V8K A;  1WII A;  1M1K 2;  3GTM I;  1Z03 A;  1VQ9 Z;  2YAD A;  3OW2 Y;  1RO2 A;  3I56 1;  1TWG I;  4MXU A;  4CL1 A;  1VQP Z;  3JAM b;  3CC7 Z;  3FQM A;  3IF8 A;  3H0G I;  2I3C A;  4HH4 A;  2F4O A;  2Y0S A;  1I3Q I;  3CCE 1;  3GTP I;  1Q7Y 1;  2YU9 I;  1VQ6 1;  4A3E I;  3QWU A;  1Q82 2;  3GTQ I;  1KQS Y;  3H3V J;  3S15 I;  1KD1 2;  3NDI A;  3CD6 1;  2R7Z I;  5D1O A;  4E33 A;  3NDJ A;  1YJ9 1;  2OTJ Z;  3CCJ Z;  2HU9 A;  4NBA A;  1ML8 A;  3GTL I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...