3GTKI

Backtracked rna polymerase ii complex with 18mer rna
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
total genus 11
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtkI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtkI02
3FKII 2YU9I 2E2II 2R92I 4Y7NI 2DE6A 3VMHA 2JR6A 2BJOA 5C44I 1Y1VI 4BBRI 1VLAA 2JA6I 1K83I 1X3ZA 4A3DI 3HOUI 1WW9A 4BY7I 3S16I 2B63I 3K7AI 3VMGA 3GTQI 3H0GI 4A3CI 3EERA 1SFOI 3PO2I 2KPIA 4MH4A 5C4JI 1YUAA 2JA5I 4A3II 3VMIA 1I6HI 3GTMI 3S17I 1R9TI 1X3WA 4QTUA 5CM2M 3HOXI 2NVTI 4A3BI 2JA7I 4NBHA 3S1MI 3I4MI 5FLMI 4Y52I 4A3FI 1TWCI 4NB8A 2R93I 3D6WA 3GTPI 2VUMI 1WCMI 5C4XI 3HOYI 3GTJI 3PO3I 1LQLA 4A3JI 2JS4A 4NBDA 4QTTA 4NOZA 3S15I 3S1RI 4A3GI 3GTLI 1USPB 3H3VJ 3RZOI 1I3QI 2PK7A 2R7ZI 2RBLA 1TWGI 4NBEA 4NBBA 3S2HI 5IP9I 1QYPA 3S2DI 2AKLA 1TWAI 1TWHI 4A3KI 1Y1VS 2F4MA 2DE7A 5IP7I 1USPA 3GCFA 2NVYI 3Q87A 4NB9A 1PFTA 3S1NI 1ZB8A 3CQZI 2E2JI 4A3MI 5C3EI 4NBGA 1NUIA 4X6AI 3GTOI 3S1QI 2F4OA 3I07A 1TFIA 1ZB9A 2K5RA 4NBFA 2E2HI 3GTMS 4A93I 3U50C 1TWFI 3LUSA 2NVXI 1Y1WI 4NBAA 3I4NI 2NVQI 4BBSI 1L1OC 4XX2A 1I50I 3M3YI 4BXXI 2J6AA 2JA8I 3HOWI 4NBCA 4A3LI 3GTGI 3HOVI 3ESWA 2JNYA 3GKQA 3VB9A 4BY1I 3S14I 1DL6A 4A3EI 1ML8A 3M4OI 1RO4A 2DE5A 3RZDI 3HOZI 2HF1A 3PO3S 1N2FA 2P3YA 1RLYA 3GTKI
chains in the Genus database with same CATH superfamily
2E2II 1RQFA 1VQ51 5LL6f 1RO2A 3VMHA 1VQK1 2LFUA 1VQ7Z 1K83I 2V8KA 1X3ZA 3CXCY 1Q821 2VF1A 5FLXb 1VQN1 4A3CI 2RPRA 2QLVB 3NFZA 2R6MA 1S721 1M1K2 2QRCB 1VQP1 1VQL1 1K9M2 3D2LA 1WIIA 4QTUA 4A3BI 2NVTI 3S1MI 3I4MI 1KC82 1YI2Z 3D6WA 1Q861 2VPXA 3HOYI 3PO3I 1LQLA 1SIWA 2IV2X 1VQPZ 2VPZA 4A3JI 4HGYA 2JS4A 1KD11 4NOZA 3VTNA 2WAQA 1X0TA 3H3VJ 3FQMA 1Q7Y2 2VUGA 2PK7A 2R7ZI 1FDOA 1YIT1 4NBBA 3CPWY 1NP6A 3J81f 2OTJ1 3J80b 3MZLB 4A3KI 1Y1VS 1N8R2 1YJN1 5IP7I 3GCFA 2QA4Z 5IT9b 3J81b 1ZB8A 3CQZI 1YITZ 1NUIA 2G2KA 2KI7B 1ZB9A 3NH5A 2E2HI 3U50C 2OZKA 4RS4A 2OOYB 4RV9A 2NVXI 1Y1WI 1KQSY 3KIHA 1VQ81 4A3LI 3TE5B 3ESWA 2JUBA 1VQ41 2ZAEB 3CCUZ 3HKZA 1M901 2RIQA 1Z03A 2Y0SA 4Y7NI 1Q16A 2DE6A 3CMA1 1M1K1 2BJOA 2JA6I 2PM9A 1K9M1 2OOXB 1KRLA 3CC71 1VQ4Z 4A3DI 3OW2Z 3HOUI 4BY7I 3NH4A 3GTQI 1WJ2A 3BG0B 3EERA 1YIJ1 4E30A 2W03A 3PO2I 2JIPA 3CMAZ 1YJ91 1VQ9Z 3VMIA 1I6HI 2K3RA 3CC7Z 1YJW1 3G71Z 1R9TI 4DGLA 1NJI2 1Z01A 3CC2Z 2JA7I 5FLMI 2HU9A 1TWCI 1Q7Y1 3CCL1 1JJ2Z 3GTPI 2OTL1 2QRDB 5C4XI 1K732 3EEDA 2O53A 4QTTA 1N8R1 3S15I 5T67A 2QR1B 1VQ5Z 3S1RI 3GTLI 1USPB 1VQKZ 2LEXA 4E2WA 3QWUA 3IFUA 3CC41 3CCV1 3G6E1 2RBLA 3S2HI 3BG1B 5IP9I 1VQNZ 2AKLA 1TWAI 5T6BA 2F4MA 1USPA 4HGZA 2VPYA 4TNUA 3CCQ1 1S72Z 3Q87A 1VQLZ 1QVFZ 3S1NI 2JIRA 3G6EZ 4A3MI 5C3EI 1JWHC 1Y8CA 1TFIA 1ZH1A 2K5RA 2JIOA 4MD8A 3NDJA 3CCQZ 2NVQI 4BBSI 1L1OC 4MD9A 2J6AA 3HOWI 1QF8A 4RVFA 3VB9A 5D1OA 4BY1I 1ML8A 3RZDI 3T4NB 1S7MA 3HOZI 1K8A1 3PO3S 5AN9F 4E2YA 1RLYA 3GTKI 2IZ3A 2OTJZ 5C44I 1YJNZ 4BBRI 1RO0A 1VLAA 3OW2Y 1QXFA 4E33A 5D1PA 1WW9A 3JAMf 1Q812 1NJI1 2QEX1 3IF8A 3J7A4 3VMGA 3H0GI 3G4S1 1SFOI 2KPIA 5C4JI 3CME1 1YUAA 4RVHA 2JA5I 3CD61 2E9HA 4MRIA 3I561 3GTMI 3CCM1 1Z02A 5CM2M 1JJ2Y 1Q862 1VQ8Z 4NB8A 4RVGA 2IZ4A 1W2BZ 2VUMI 1QVGZ 1WCMI 3CMEZ 3GTJI 3I56Z 3CCMZ 2WB1A 1KC81 2AYDA 4NBDA 5A2Qf 3NDIA 4A3GI 1VQO1 1P9NA 1YUKA 3RZOI 1I3QI 1VQ61 5T64A 2O4HA 1QYPA 5A2Qb 2JIQA 1YHQ1 1YIJZ 4RVDA 1VQ71 1YJ9Z 1QVFY 2NVYI 3FQQA 1PFTA 3CCJ1 1YJWZ 3IR7A 1VQ6Z 2E2JI 4NBGA 4X6AI 2P28A 3MONA 4DQYB 3CCLZ 5FLXf 1YHQZ 4E2ZA 2OTLZ 4MONA 4CL1A 2M48A 3LUSA 4E31A 1I50I 2V3VA 3CCJZ 2E7ZA 4NH1C 4NFRA 2M6NA 2JA8I 3TDHB 1RNIA 3HOVI 4MXUA 1YI21 1M902 3GKQA 2GTHA 2Q51A 1Q811 3M4OI 2DE5A 1AA6A 3CC4Z 1N2FA 3CCVZ 3FKII 2YU9I 2JIMA 2R92I 5D1OB 2JR6A 1VQM1 1Y1VI 4HH4A 3MZKB 3S16I 2LIYA 2B63I 3IX0A 3F3PC 3K7AI 3CXCZ 1FDIA 4MD7A 3NH8A 2V8JA 4MH4A 2V8IA 3J80f 2Q4ZA 3CCS1 1VQMZ 4A3II 3S17I 2QA41 2W04A 2GTIA 1X3WA 3HOXI 1W2BY 1QVGY 2YADA 4NBHA 5IT9f 1Q822 4Y52I 4E32A 4A3FI 2R93I 3CCR1 2V45A 3CCSZ 3CCE1 4AYBA 1K731 3D9XA 3P5JB 2VPWA 3JAMb 3CCU1 3CCRZ 2H85A 4DK1A 2QKDA 1TWGI 4NBEA 2QEXZ 4E2XA 3CCEZ 2JMOA 3S2DI 1TWHI 1KD12 3G4SZ 2RHBA 2DE7A 3CPWZ 3CD6Z 4NB9A 2I3CA 3F3FC 2EGTA 3GTOI 3S1QI 2F4OA 3I551 3I07A 2QREB 4NBFA 2NAPA 1VQ91 3GTMS 4A93I 1TWFI 4NBAA 3I4NI 3G711 4XX2A 2PMZA 3M3YI 2GU2A 4BXXI 3CC21 1K8A2 4NBCA 1KQSZ 3GTGI 2RT9A 2JNYA 4EWCA 3S14I 1DL6A 1WZNA 3KIFA 3I55Z 1VQOZ 4A3EI 1RO4A 2HF1A 4S1TA 2P3YA
chains in the Genus database with same CATH topology
2E2II 1RQFA 1VQ51 5LL6f 1RO2A 3VMHA 1VQK1 2LFUA 1VQ7Z 1K83I 2V8KA 1X3ZA 3CXCY 1Q821 2VF1A 5FLXb 1VQN1 4A3CI 2RPRA 2QLVB 3NFZA 2R6MA 1S721 1M1K2 2QRCB 1VQP1 1VQL1 1K9M2 1WIIA 4QTUA 4A3BI 2NVTI 3S1MI 3I4MI 1KC82 1YI2Z 3D6WA 1Q861 3HOYI 3PO3I 1LQLA 1VQPZ 4A3JI 4HGYA 2JS4A 1KD11 4NOZA 3VTNA 2WAQA 1X0TA 3H3VJ 3FQMA 1Q7Y2 2VUGA 2PK7A 2R7ZI 1YIT1 4NBBA 3CPWY 1NP6A 3J81f 2OTJ1 3J80b 3MZLB 4A3KI 1Y1VS 1N8R2 1YJN1 5IP7I 3GCFA 2QA4Z 5IT9b 3J81b 1ZB8A 3CQZI 1YITZ 1NUIA 2G2KA 2KI7B 1ZB9A 3NH5A 2E2HI 3U50C 2OZKA 4RS4A 2OOYB 4RV9A 2NVXI 1Y1WI 1KQSY 3KIHA 1VQ81 4A3LI 3TE5B 3ESWA 2JUBA 1VQ41 2ZAEB 3CCUZ 3HKZA 1M901 2RIQA 1Z03A 2Y0SA 4Y7NI 2DE6A 3CMA1 1M1K1 2BJOA 2JA6I 2PM9A 1K9M1 2OOXB 1KRLA 3CC71 1VQ4Z 4A3DI 3OW2Z 3HOUI 4BY7I 3NH4A 3GTQI 3BG0B 3EERA 1YIJ1 4E30A 2W03A 3PO2I 3CMAZ 1YJ91 1VQ9Z 3VMIA 1I6HI 2K3RA 3CC7Z 1YJW1 3G71Z 1R9TI 4DGLA 1NJI2 1Z01A 3CC2Z 2JA7I 5FLMI 2HU9A 1TWCI 1Q7Y1 3CCL1 1JJ2Z 3GTPI 2OTL1 2QRDB 5C4XI 1K732 3EEDA 2O53A 4QTTA 1N8R1 3S15I 5T67A 2QR1B 1VQ5Z 3S1RI 3GTLI 1USPB 1VQKZ 4E2WA 3QWUA 3IFUA 3CC41 3CCV1 3G6E1 2RBLA 3S2HI 3BG1B 5IP9I 1VQNZ 2AKLA 1TWAI 5T6BA 2F4MA 1USPA 4HGZA 4TNUA 3CCQ1 1S72Z 3Q87A 1VQLZ 1QVFZ 3S1NI 3G6EZ 4A3MI 5C3EI 1JWHC 1TFIA 1ZH1A 2K5RA 4MD8A 3NDJA 3CCQZ 2NVQI 4BBSI 1L1OC 4MD9A 2J6AA 3HOWI 1QF8A 4RVFA 3VB9A 5D1OA 4BY1I 1ML8A 3RZDI 3T4NB 1S7MA 3HOZI 1K8A1 3PO3S 5AN9F 4E2YA 1RLYA 3GTKI 2IZ3A 2OTJZ 5C44I 1YJNZ 4BBRI 1RO0A 1VLAA 3OW2Y 4E33A 5D1PA 1WW9A 3JAMf 1Q812 1NJI1 2QEX1 3IF8A 3J7A4 3VMGA 3H0GI 3G4S1 1SFOI 2KPIA 5C4JI 3CME1 1YUAA 4RVHA 2JA5I 3CD61 2E9HA 4MRIA 3I561 3GTMI 3CCM1 1Z02A 5CM2M 1JJ2Y 1Q862 1VQ8Z 4NB8A 4RVGA 2IZ4A 1W2BZ 2VUMI 1QVGZ 1WCMI 3CMEZ 3GTJI 3I56Z 3CCMZ 2WB1A 1KC81 4NBDA 5A2Qf 3NDIA 4A3GI 1VQO1 1P9NA 1YUKA 3RZOI 1I3QI 1VQ61 5T64A 2O4HA 1QYPA 5A2Qb 1YHQ1 1YIJZ 4RVDA 1VQ71 1YJ9Z 1QVFY 2NVYI 3FQQA 1PFTA 3CCJ1 1YJWZ 1VQ6Z 2E2JI 4NBGA 4X6AI 4DQYB 2P28A 3MONA 3CCLZ 5FLXf 1YHQZ 4E2ZA 2OTLZ 4MONA 4CL1A 2M48A 3LUSA 4E31A 1I50I 3CCJZ 4NH1C 2JA8I 4NFRA 2M6NA 3TDHB 1RNIA 3HOVI 4MXUA 1YI21 1M902 3GKQA 2GTHA 2Q51A 1Q811 3M4OI 2DE5A 3CC4Z 1N2FA 3CCVZ 3FKII 2YU9I 2R92I 5D1OB 2JR6A 1VQM1 1Y1VI 4HH4A 3MZKB 3S16I 2LIYA 2B63I 3IX0A 3F3PC 3K7AI 3CXCZ 4MD7A 3NH8A 2V8JA 4MH4A 2V8IA 3J80f 2Q4ZA 3CCS1 1VQMZ 4A3II 3S17I 2QA41 2W04A 2GTIA 1X3WA 3HOXI 1W2BY 1QVGY 2YADA 4NBHA 5IT9f 1Q822 4Y52I 4E32A 4A3FI 2R93I 3CCR1 3CCSZ 3CCE1 4AYBA 1K731 3D9XA 3P5JB 3JAMb 3CCU1 3CCRZ 2H85A 4DK1A 2QKDA 1TWGI 4NBEA 2QEXZ 4E2XA 3CCEZ 2JMOA 3S2DI 1TWHI 1KD12 3G4SZ 2RHBA 2DE7A 3CPWZ 3CD6Z 4NB9A 2I3CA 3F3FC 2EGTA 3GTOI 3S1QI 2F4OA 3I551 3I07A 2QREB 4NBFA 1VQ91 3GTMS 4A93I 1TWFI 4NBAA 3I4NI 3G711 4XX2A 2PMZA 3M3YI 2GU2A 4BXXI 3CC21 1K8A2 4NBCA 1KQSZ 3GTGI 2RT9A 2JNYA 4EWCA 3S14I 1DL6A 3KIFA 3I55Z 1VQOZ 4A3EI 1RO4A 2HF1A 4S1TA 2P3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FKI I;  2YU9 I;  2E2I I;  2R92 I;  4Y7N I;  2DE6 A;  3VMH A;  2JR6 A;  2BJO A;  5C44 I;  1Y1V I;  4BBR I;  1VLA A;  2JA6 I;  1K83 I;  1X3Z A;  4A3D I;  3HOU I;  1WW9 A;  4BY7 I;  3S16 I;  2B63 I;  3K7A I;  3VMG A;  3GTQ I;  3H0G I;  4A3C I;  3EER A;  1SFO I;  3PO2 I;  2KPI A;  4MH4 A;  5C4J I;  1YUA A;  2JA5 I;  4A3I I;  3VMI A;  1I6H I;  3GTM I;  3S17 I;  1R9T I;  1X3W A;  4QTU A;  5CM2 M;  3HOX I;  2NVT I;  4A3B I;  2JA7 I;  4NBH A;  3S1M I;  3I4M I;  5FLM I;  4Y52 I;  4A3F I;  1TWC I;  4NB8 A;  2R93 I;  3D6W A;  3GTP I;  2VUM I;  1WCM I;  5C4X I;  3HOY I;  3GTJ I;  3PO3 I;  1LQL A;  4A3J I;  2JS4 A;  4NBD A;  4QTT A;  4NOZ A;  3S15 I;  3S1R I;  4A3G I;  3GTL I;  1USP B;  3H3V J;  3RZO I;  1I3Q I;  2PK7 A;  2R7Z I;  2RBL A;  1TWG I;  4NBE A;  4NBB A;  3S2H I;  5IP9 I;  1QYP A;  3S2D I;  2AKL A;  1TWA I;  1TWH I;  4A3K I;  1Y1V S;  2F4M A;  2DE7 A;  5IP7 I;  1USP A;  3GCF A;  2NVY I;  3Q87 A;  4NB9 A;  1PFT A;  3S1N I;  1ZB8 A;  3CQZ I;  2E2J I;  4A3M I;  5C3E I;  4NBG A;  1NUI A;  4X6A I;  3GTO I;  3S1Q I;  2F4O A;  3I07 A;  1TFI A;  1ZB9 A;  2K5R A;  4NBF A;  2E2H I;  3GTM S;  4A93 I;  3U50 C;  1TWF I;  3LUS A;  2NVX I;  1Y1W I;  4NBA A;  3I4N I;  2NVQ I;  4BBS I;  1L1O C;  4XX2 A;  1I50 I;  3M3Y I;  4BXX I;  2J6A A;  2JA8 I;  3HOW I;  4NBC A;  4A3L I;  3GTG I;  3HOV I;  3ESW A;  2JNY A;  3GKQ A;  3VB9 A;  4BY1 I;  3S14 I;  1DL6 A;  4A3E I;  1ML8 A;  3M4O I;  1RO4 A;  2DE5 A;  3RZD I;  3HOZ I;  2HF1 A;  3PO3 S;  1N2F A;  2P3Y A;  1RLY A;  3GTK I; 
#chains in the Genus database with same CATH topology
 2E2I I;  1RQF A;  1VQ5 1;  5LL6 f;  1RO2 A;  3VMH A;  1VQK 1;  2LFU A;  1VQ7 Z;  1K83 I;  2V8K A;  1X3Z A;  3CXC Y;  1Q82 1;  2VF1 A;  5FLX b;  1VQN 1;  4A3C I;  2RPR A;  2QLV B;  3NFZ A;  2R6M A;  1S72 1;  1M1K 2;  2QRC B;  1VQP 1;  1VQL 1;  1K9M 2;  3D2L A;  1WII A;  4QTU A;  4A3B I;  2NVT I;  3S1M I;  3I4M I;  1KC8 2;  1YI2 Z;  3D6W A;  1Q86 1;  2VPX A;  3HOY I;  3PO3 I;  1LQL A;  1SIW A;  2IV2 X;  1VQP Z;  2VPZ A;  4A3J I;  4HGY A;  2JS4 A;  1KD1 1;  4NOZ A;  3VTN A;  2WAQ A;  1X0T A;  3H3V J;  3FQM A;  1Q7Y 2;  2VUG A;  2PK7 A;  2R7Z I;  1FDO A;  1YIT 1;  4NBB A;  3CPW Y;  1NP6 A;  3J81 f;  2OTJ 1;  3J80 b;  3MZL B;  4A3K I;  1Y1V S;  1N8R 2;  1YJN 1;  5IP7 I;  3GCF A;  2QA4 Z;  5IT9 b;  3J81 b;  1ZB8 A;  3CQZ I;  1YIT Z;  1NUI A;  2G2K A;  2KI7 B;  1ZB9 A;  3NH5 A;  2E2H I;  3U50 C;  2OZK A;  4RS4 A;  2OOY B;  4RV9 A;  2NVX I;  1Y1W I;  1KQS Y;  3KIH A;  1VQ8 1;  4A3L I;  3TE5 B;  3ESW A;  2JUB A;  1VQ4 1;  2ZAE B;  3CCU Z;  3HKZ A;  1M90 1;  2RIQ A;  1Z03 A;  2Y0S A;  4Y7N I;  1Q16 A;  2DE6 A;  3CMA 1;  1M1K 1;  2BJO A;  2JA6 I;  2PM9 A;  1K9M 1;  2OOX B;  1KRL A;  3CC7 1;  1VQ4 Z;  4A3D I;  3OW2 Z;  3HOU I;  4BY7 I;  3NH4 A;  3GTQ I;  1WJ2 A;  3BG0 B;  3EER A;  1YIJ 1;  4E30 A;  2W03 A;  3PO2 I;  2JIP A;  3CMA Z;  1YJ9 1;  1VQ9 Z;  3VMI A;  1I6H I;  2K3R A;  3CC7 Z;  1YJW 1;  3G71 Z;  1R9T I;  4DGL A;  1NJI 2;  1Z01 A;  3CC2 Z;  2JA7 I;  5FLM I;  2HU9 A;  1TWC I;  1Q7Y 1;  3CCL 1;  1JJ2 Z;  3GTP I;  2OTL 1;  2QRD B;  5C4X I;  1K73 2;  3EED A;  2O53 A;  4QTT A;  1N8R 1;  3S15 I;  5T67 A;  2QR1 B;  1VQ5 Z;  3S1R I;  3GTL I;  1USP B;  1VQK Z;  2LEX A;  4E2W A;  3QWU A;  3IFU A;  3CC4 1;  3CCV 1;  3G6E 1;  2RBL A;  3S2H I;  3BG1 B;  5IP9 I;  1VQN Z;  2AKL A;  1TWA I;  5T6B A;  2F4M A;  1USP A;  4HGZ A;  2VPY A;  4TNU A;  3CCQ 1;  1S72 Z;  3Q87 A;  1VQL Z;  1QVF Z;  3S1N I;  2JIR A;  3G6E Z;  4A3M I;  5C3E I;  1JWH C;  1Y8C A;  1TFI A;  1ZH1 A;  2K5R A;  2JIO A;  4MD8 A;  3NDJ A;  3CCQ Z;  2NVQ I;  4BBS I;  1L1O C;  4MD9 A;  2J6A A;  3HOW I;  1QF8 A;  4RVF A;  3VB9 A;  5D1O A;  4BY1 I;  1ML8 A;  3RZD I;  3T4N B;  1S7M A;  3HOZ I;  1K8A 1;  3PO3 S;  5AN9 F;  4E2Y A;  1RLY A;  3GTK I;  2IZ3 A;  2OTJ Z;  5C44 I;  1YJN Z;  4BBR I;  1RO0 A;  1VLA A;  3OW2 Y;  1QXF A;  4E33 A;  5D1P A;  1WW9 A;  3JAM f;  1Q81 2;  1NJI 1;  2QEX 1;  3IF8 A;  3J7A 4;  3VMG A;  3H0G I;  3G4S 1;  1SFO I;  2KPI A;  5C4J I;  3CME 1;  1YUA A;  4RVH A;  2JA5 I;  3CD6 1;  2E9H A;  4MRI A;  3I56 1;  3GTM I;  3CCM 1;  1Z02 A;  5CM2 M;  1JJ2 Y;  1Q86 2;  1VQ8 Z;  4NB8 A;  4RVG A;  2IZ4 A;  1W2B Z;  2VUM I;  1QVG Z;  1WCM I;  3CME Z;  3GTJ I;  3I56 Z;  3CCM Z;  2WB1 A;  1KC8 1;  2AYD A;  4NBD A;  5A2Q f;  3NDI A;  4A3G I;  1VQO 1;  1P9N A;  1YUK A;  3RZO I;  1I3Q I;  1VQ6 1;  5T64 A;  2O4H A;  1QYP A;  5A2Q b;  2JIQ A;  1YHQ 1;  1YIJ Z;  4RVD A;  1VQ7 1;  1YJ9 Z;  1QVF Y;  2NVY I;  3FQQ A;  1PFT A;  3CCJ 1;  1YJW Z;  3IR7 A;  1VQ6 Z;  2E2J I;  4NBG A;  4X6A I;  2P28 A;  3MON A;  4DQY B;  3CCL Z;  5FLX f;  1YHQ Z;  4E2Z A;  2OTL Z;  4MON A;  4CL1 A;  2M48 A;  3LUS A;  4E31 A;  1I50 I;  2V3V A;  3CCJ Z;  2E7Z A;  4NH1 C;  4NFR A;  2M6N A;  2JA8 I;  3TDH B;  1RNI A;  3HOV I;  4MXU A;  1YI2 1;  1M90 2;  3GKQ A;  2GTH A;  2Q51 A;  1Q81 1;  3M4O I;  2DE5 A;  1AA6 A;  3CC4 Z;  1N2F A;  3CCV Z;  3FKI I;  2YU9 I;  2JIM A;  2R92 I;  5D1O B;  2JR6 A;  1VQM 1;  1Y1V I;  4HH4 A;  3MZK B;  3S16 I;  2LIY A;  2B63 I;  3IX0 A;  3F3P C;  3K7A I;  3CXC Z;  1FDI A;  4MD7 A;  3NH8 A;  2V8J A;  4MH4 A;  2V8I A;  3J80 f;  2Q4Z A;  3CCS 1;  1VQM Z;  4A3I I;  3S17 I;  2QA4 1;  2W04 A;  2GTI A;  1X3W A;  3HOX I;  1W2B Y;  1QVG Y;  2YAD A;  4NBH A;  5IT9 f;  1Q82 2;  4Y52 I;  4E32 A;  4A3F I;  2R93 I;  3CCR 1;  2V45 A;  3CCS Z;  3CCE 1;  4AYB A;  1K73 1;  3D9X A;  3P5J B;  2VPW A;  3JAM b;  3CCU 1;  3CCR Z;  2H85 A;  4DK1 A;  2QKD A;  1TWG I;  4NBE A;  2QEX Z;  4E2X A;  3CCE Z;  2JMO A;  3S2D I;  1TWH I;  1KD1 2;  3G4S Z;  2RHB A;  2DE7 A;  3CPW Z;  3CD6 Z;  4NB9 A;  2I3C A;  3F3F C;  2EGT A;  3GTO I;  3S1Q I;  2F4O A;  3I55 1;  3I07 A;  2QRE B;  4NBF A;  2NAP A;  1VQ9 1;  3GTM S;  4A93 I;  1TWF I;  4NBA A;  3I4N I;  3G71 1;  4XX2 A;  2PMZ A;  3M3Y I;  2GU2 A;  4BXX I;  3CC2 1;  1K8A 2;  4NBC A;  1KQS Z;  3GTG I;  2RT9 A;  2JNY A;  4EWC A;  3S14 I;  1DL6 A;  1WZN A;  3KIF A;  3I55 Z;  1VQO Z;  4A3E I;  1RO4 A;  2HF1 A;  4S1T A;  2P3Y A; 
#chains in the Genus database with same CATH homology
 2E2I I;  1RQF A;  1VQ5 1;  5LL6 f;  1RO2 A;  3VMH A;  1VQK 1;  2LFU A;  1VQ7 Z;  1K83 I;  2V8K A;  1X3Z A;  3CXC Y;  1Q82 1;  2VF1 A;  5FLX b;  1VQN 1;  4A3C I;  2RPR A;  2QLV B;  3NFZ A;  2R6M A;  1S72 1;  1M1K 2;  2QRC B;  1VQP 1;  1VQL 1;  1K9M 2;  1WII A;  4QTU A;  4A3B I;  2NVT I;  3S1M I;  3I4M I;  1KC8 2;  1YI2 Z;  3D6W A;  1Q86 1;  3HOY I;  3PO3 I;  1LQL A;  1VQP Z;  4A3J I;  4HGY A;  2JS4 A;  1KD1 1;  4NOZ A;  3VTN A;  2WAQ A;  1X0T A;  3H3V J;  3FQM A;  1Q7Y 2;  2VUG A;  2PK7 A;  2R7Z I;  1YIT 1;  4NBB A;  3CPW Y;  1NP6 A;  3J81 f;  2OTJ 1;  3J80 b;  3MZL B;  4A3K I;  1Y1V S;  1N8R 2;  1YJN 1;  5IP7 I;  3GCF A;  2QA4 Z;  5IT9 b;  3J81 b;  1ZB8 A;  3CQZ I;  1YIT Z;  1NUI A;  2G2K A;  2KI7 B;  1ZB9 A;  3NH5 A;  2E2H I;  3U50 C;  2OZK A;  4RS4 A;  2OOY B;  4RV9 A;  2NVX I;  1Y1W I;  1KQS Y;  3KIH A;  1VQ8 1;  4A3L I;  3TE5 B;  3ESW A;  2JUB A;  1VQ4 1;  2ZAE B;  3CCU Z;  3HKZ A;  1M90 1;  2RIQ A;  1Z03 A;  2Y0S A;  4Y7N I;  2DE6 A;  3CMA 1;  1M1K 1;  2BJO A;  2JA6 I;  2PM9 A;  1K9M 1;  2OOX B;  1KRL A;  3CC7 1;  1VQ4 Z;  4A3D I;  3OW2 Z;  3HOU I;  4BY7 I;  3NH4 A;  3GTQ I;  3BG0 B;  3EER A;  1YIJ 1;  4E30 A;  2W03 A;  3PO2 I;  3CMA Z;  1YJ9 1;  1VQ9 Z;  3VMI A;  1I6H I;  2K3R A;  3CC7 Z;  1YJW 1;  3G71 Z;  1R9T I;  4DGL A;  1NJI 2;  1Z01 A;  3CC2 Z;  2JA7 I;  5FLM I;  2HU9 A;  1TWC I;  1Q7Y 1;  3CCL 1;  1JJ2 Z;  3GTP I;  2OTL 1;  2QRD B;  5C4X I;  1K73 2;  3EED A;  2O53 A;  4QTT A;  1N8R 1;  3S15 I;  5T67 A;  2QR1 B;  1VQ5 Z;  3S1R I;  3GTL I;  1USP B;  1VQK Z;  4E2W A;  3QWU A;  3IFU A;  3CC4 1;  3CCV 1;  3G6E 1;  2RBL A;  3S2H I;  3BG1 B;  5IP9 I;  1VQN Z;  2AKL A;  1TWA I;  5T6B A;  2F4M A;  1USP A;  4HGZ A;  4TNU A;  3CCQ 1;  1S72 Z;  3Q87 A;  1VQL Z;  1QVF Z;  3S1N I;  3G6E Z;  4A3M I;  5C3E I;  1JWH C;  1TFI A;  1ZH1 A;  2K5R A;  4MD8 A;  3NDJ A;  3CCQ Z;  2NVQ I;  4BBS I;  1L1O C;  4MD9 A;  2J6A A;  3HOW I;  1QF8 A;  4RVF A;  3VB9 A;  5D1O A;  4BY1 I;  1ML8 A;  3RZD I;  3T4N B;  1S7M A;  3HOZ I;  1K8A 1;  3PO3 S;  5AN9 F;  4E2Y A;  1RLY A;  3GTK I;  2IZ3 A;  2OTJ Z;  5C44 I;  1YJN Z;  4BBR I;  1RO0 A;  1VLA A;  3OW2 Y;  4E33 A;  5D1P A;  1WW9 A;  3JAM f;  1Q81 2;  1NJI 1;  2QEX 1;  3IF8 A;  3J7A 4;  3VMG A;  3H0G I;  3G4S 1;  1SFO I;  2KPI A;  5C4J I;  3CME 1;  1YUA A;  4RVH A;  2JA5 I;  3CD6 1;  2E9H A;  4MRI A;  3I56 1;  3GTM I;  3CCM 1;  1Z02 A;  5CM2 M;  1JJ2 Y;  1Q86 2;  1VQ8 Z;  4NB8 A;  4RVG A;  2IZ4 A;  1W2B Z;  2VUM I;  1QVG Z;  1WCM I;  3CME Z;  3GTJ I;  3I56 Z;  3CCM Z;  2WB1 A;  1KC8 1;  4NBD A;  5A2Q f;  3NDI A;  4A3G I;  1VQO 1;  1P9N A;  1YUK A;  3RZO I;  1I3Q I;  1VQ6 1;  5T64 A;  2O4H A;  1QYP A;  5A2Q b;  1YHQ 1;  1YIJ Z;  4RVD A;  1VQ7 1;  1YJ9 Z;  1QVF Y;  2NVY I;  3FQQ A;  1PFT A;  3CCJ 1;  1YJW Z;  1VQ6 Z;  2E2J I;  4NBG A;  4X6A I;  4DQY B;  2P28 A;  3MON A;  3CCL Z;  5FLX f;  1YHQ Z;  4E2Z A;  2OTL Z;  4MON A;  4CL1 A;  2M48 A;  3LUS A;  4E31 A;  1I50 I;  3CCJ Z;  4NH1 C;  2JA8 I;  4NFR A;  2M6N A;  3TDH B;  1RNI A;  3HOV I;  4MXU A;  1YI2 1;  1M90 2;  3GKQ A;  2GTH A;  2Q51 A;  1Q81 1;  3M4O I;  2DE5 A;  3CC4 Z;  1N2F A;  3CCV Z;  3FKI I;  2YU9 I;  2R92 I;  5D1O B;  2JR6 A;  1VQM 1;  1Y1V I;  4HH4 A;  3MZK B;  3S16 I;  2LIY A;  2B63 I;  3IX0 A;  3F3P C;  3K7A I;  3CXC Z;  4MD7 A;  3NH8 A;  2V8J A;  4MH4 A;  2V8I A;  3J80 f;  2Q4Z A;  3CCS 1;  1VQM Z;  4A3I I;  3S17 I;  2QA4 1;  2W04 A;  2GTI A;  1X3W A;  3HOX I;  1W2B Y;  1QVG Y;  2YAD A;  4NBH A;  5IT9 f;  1Q82 2;  4Y52 I;  4E32 A;  4A3F I;  2R93 I;  3CCR 1;  3CCS Z;  3CCE 1;  4AYB A;  1K73 1;  3D9X A;  3P5J B;  3JAM b;  3CCU 1;  3CCR Z;  2H85 A;  4DK1 A;  2QKD A;  1TWG I;  4NBE A;  2QEX Z;  4E2X A;  3CCE Z;  2JMO A;  3S2D I;  1TWH I;  1KD1 2;  3G4S Z;  2RHB A;  2DE7 A;  3CPW Z;  3CD6 Z;  4NB9 A;  2I3C A;  3F3F C;  2EGT A;  3GTO I;  3S1Q I;  2F4O A;  3I55 1;  3I07 A;  2QRE B;  4NBF A;  1VQ9 1;  3GTM S;  4A93 I;  1TWF I;  4NBA A;  3I4N I;  3G71 1;  4XX2 A;  2PMZ A;  3M3Y I;  2GU2 A;  4BXX I;  3CC2 1;  1K8A 2;  4NBC A;  1KQS Z;  3GTG I;  2RT9 A;  2JNY A;  4EWC A;  3S14 I;  1DL6 A;  3KIF A;  3I55 Z;  1VQO Z;  4A3E I;  1RO4 A;  2HF1 A;  4S1T A;  2P3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...