3F3FC

Crystal structure of the nucleoporin pair nup85-seh1, space group p21
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
498
structure length
475
Chain Sequence
ILVPMTVNDQPIEKNGDKMPLKFKLGPLSYQNMAFITAKDKYKLYPVRIPRLDTSKEFSAYVSGLFEIYRDLGDDRVFNVVNSNFAKEHNATVNLAMEAILNELEVFIGRVKDQDGRVNRFYELEESLTVLNCLRTMYFILDGQDVEENRSEFIESLLNWINRSDGEPDEEYIEQVFSVAGKKVFETQYFWKLLNQLVLRGLLSQAIGCIERSDLLPYLSDTCAVSFDAVSDSIELLKQYPKDSSSTFREWKNLVLKLSQAFGSSATDISGELRDYIEDFLLVIGGNQRKILQYSRTWYESFCGFLLYYIPSLELSAEYLQMSLEANVVDITNDWEQPCVDIISGKIHSILPVMESLDSCTAAFTAMICEAKGLIENIFEGLEDLFSYRNGMASYMLNSFAFELCSLGDKELWPVAIGLIALSATGTRSAKKMVIAELLPHYPFVTNDDIEWMLSICVEWRLPEIAKEIYTTLGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nucleoporin SEH1
publication title A fence-like coat for the nuclear pore membrane.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 155
structure length 475
sequence length 498
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 2008-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.500 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3f3fC01
3F3PC 3F3FC
chains in the Genus database with same CATH superfamily
4TNUA 2AKLA 3CD6Z 3S14I 3CCUZ 3CCR1 4NBDA 1Z02A 1PFTA 3CXCZ 1ML8A 3CCL1 5D1PA 3CC21 3PO3S 3GTLI 2PK7A 2IZ3A 1QF8A 3JAMf 1YJ91 1VQ9Z 5T67A 3I561 2QEX1 3OW2Z 4BXXI 2Q4ZA 3VMIA 3F3PC 3S16I 4DQYB 4BBSI 2YU9I 3CCVZ 1S721 1Q812 4NH1C 4A3JI 1VQNZ 5FLXf 4A3BI 1DL6A 2YADA 2RBLA 3I4NI 1VQLZ 1WJ2A 3CC71 1TWCI 4DGLA 4A3DI 1QXFA 1RO4A 3VMHA 2OOXB 4MD8A 3S1MI 3I55Z 4DK1A 1QVGY 1NUIA 2V8KA 1QVFY 3HOUI 2W03A 3JAMb 3CMA1 4E2XA 3CC41 5LL6f 4RVGA 2R93I 2V8JA 1WIIA 2P3YA 5C3EI 2AYDA 1Y8CA 3CCRZ 2RHBA 1TWFI 3IR7A 2V8IA 5FLXb 3H3VJ 2JIMA 3M3YI 3CCLZ 4A3FI 1I6HI 2E9HA 4E2WA 4X6AI 3CC2Z 1K732 2GU2A 1VQ71 3OW2Y 1YJN1 2LEXA 1K9M1 4NBEA 1YJ9Z 1NP6A 3J7A4 3I56Z 3TE5B 2P28A 1Z03A 2JMOA 4BBRI 2JIRA 1S72Z 1Q7Y2 1S7MA 1QYPA 1Y1VI 3S1RI 4RVFA 2JA5I 3MZKB 3G6E1 2VPXA 3J80f 2VUGA 1Z01A 3S2DI 3U50C 1Q862 1WZNA 2DE6A 2JR6A 3G711 2NVYI 4NBCA 3CC4Z 3CME1 1YUAA 1N2FA 3FQMA 2LFUA 2VF1A 3CCS1 2QRCB 1VQ51 3HOYI 2PMZA 4RVHA 1X0TA 1X3WA 3J80b 1QVGZ 1VQ7Z 1YJNZ 4Y7NI 1QVFZ 4E2YA 2BJOA 3D2LA 4EWCA 1TWHI 3NH4A 2QKDA 2KPIA 3KIFA 3HKZA 3CCE1 2IZ4A 3BG1B 3GCFA 3FQQA 1M1K1 4NB8A 2VPWA 1N8R2 3P5JB 3GTGI 3S1NI 3F3FC 4NBHA 4QTUA 2Y0SA 1TFIA 3G6EZ 2F4MA 1W2BY 1X3ZA 1NJI2 3QWUA 4E31A 4BY7I 1Q16A 3BG0B 2V3VA 3H0GI 2JNYA 1VQM1 3VTNA 5D1OA 1I3QI 3G71Z 4NOZA 4A3LI 2OTJ1 4QTTA 1VQ6Z 3CMEZ 4HGZA 3NH5A 1R9TI 3MONA 5AN9F 1YIT1 1K83I 3J81f 3HOVI 2DE7A 3GTMS 3NDJA 3CCSZ 1VQ5Z 2JA8I 1VQKZ 1YHQ1 1YI2Z 3EERA 3I4MI 5C44I 1RNIA 3RZDI 3CCEZ 2JUBA 4RS4A 3CCQ1 1K731 3PO2I 4A93I 2JS4A 1I50I 3J81b 5FLMI 2QEXZ 1M902 2K5RA 2VPZA 3K7AI 2JA6I 1Q7Y1 3KIHA 2E2HI 1VQMZ 1WW9A 4NBBA 1KC81 2NAPA 3NFZA 2OTJZ 1YJW1 3CC7Z 3LUSA 4RVDA 4NFRA 1YITZ 2V45A 2EGTA 1W2BZ 1Q861 1K9M2 2I3CA 5D1OB 3EEDA 1Q822 3IX0A 1L1OC 3G4S1 1YHQZ 3CMAZ 1SFOI 2HU9A 4MXUA 1KD11 2O4HA 1P9NA 2QA41 2LIYA 5A2Qf 2NVXI 1K8A1 1RLYA 1FDIA 2R92I 2IV2X 3CCQZ 3GTOI 1USPA 2Q51A 2M6NA 4E32A 3HOZI 2E7ZA 1ZH1A 2PM9A 1WCMI 4XX2A 3GKQA 4A3EI 1YIJ1 2HF1A 3GTJI 3TDHB 4S1TA 3CCM1 2QR1B 3D9XA 4A3GI 2JA7I 1JJ2Y 2F4OA 2NVQI 3CCJ1 4MONA 1FDOA 4NB9A 2OTL1 5A2Qb 1YJWZ 2WB1A 1JWHC 3CPWZ 1Q811 2B63I 1Y1VS 5IT9f 4NBGA 4MRIA 1VQP1 3G4SZ 3HOXI 4A3MI 4CL1A 1M1K2 2JIOA 3RZOI 3T4NB 1KQSZ 3GTQI 2RT9A 2QA4Z 3MZLB 1VQ41 1TWGI 1ZB9A 4A3II 4MD7A 2W04A 2G2KA 3IFUA 5IT9b 4NBFA 1YIJZ 2M48A 3NDIA 4AYBA 4E2ZA 2DE5A 2GTIA 3CCMZ 1USPB 5IP9I 2O53A 2R6MA 2KI7B 4A3KI 1Y1WI 2E2JI 2H85A 3CCJZ 3CQZI 5C4XI 4MD9A 3FKII 3CPWY 1M901 2OTLZ 2K3RA 1VQ81 1KRLA 1TWAI 3CXCY 1VQO1 5T6BA 2J6AA 3NH8A 2JIQA 2QRDB 2RPRA 3I07A 3HOWI 1VQPZ 5IP7I 3S1QI 3GTKI 1KQSY 3Q87A 1JJ2Z 2WAQA 5T64A 3VMGA 3VB9A 3PO3I 1Q821 1ZB8A 3IF8A 3CD61 1SIWA 2OZKA 3CCU1 4E30A 1VQ4Z 4BY1I 4A3CI 4HH4A 5C4JI 2QLVB 3D6WA 3S17I 4MH4A 1RO2A 4NBAA 4Y52I 4HGYA 2VUMI 1KC82 1VQ91 1VLAA 1AA6A 1RO0A 2E2II 3M4OI 3CCV1 3GTPI 1VQN1 3GTMI 2VPYA 1LQLA 2OOYB 2GTHA 2QREB 1VQL1 1VQ61 4RV9A 1VQ8Z 2ZAEB 3ESWA 4E33A 5CM2M 1VQOZ 1N8R1 2NVTI 3S2HI 3I551 1YUKA 1KD12 3S15I 1VQK1 1NJI1 1K8A2 1YI21 2JIPA 2RIQA 1RQFA 2R7ZI
chains in the Genus database with same CATH topology
4TNUA 2AKLA 3CD6Z 3S14I 3CCUZ 3CCR1 4NBDA 1Z02A 1PFTA 3CXCZ 1ML8A 3CCL1 5D1PA 3CC21 3PO3S 3GTLI 2PK7A 1QF8A 2IZ3A 3JAMf 1YJ91 1VQ9Z 5T67A 3I561 2QEX1 3OW2Z 4BXXI 2Q4ZA 3VMIA 3F3PC 3S16I 4DQYB 4BBSI 2YU9I 3CCVZ 1S721 1Q812 4NH1C 4A3JI 1VQNZ 5FLXf 4A3BI 1DL6A 2YADA 2RBLA 3I4NI 1VQLZ 3CC71 1TWCI 4DGLA 4A3DI 1RO4A 3VMHA 2OOXB 4MD8A 3S1MI 3I55Z 4DK1A 1QVGY 1NUIA 2V8KA 1QVFY 3HOUI 2W03A 3JAMb 3CMA1 4E2XA 3CC41 5LL6f 4RVGA 2R93I 2V8JA 1WIIA 2P3YA 5C3EI 3CCRZ 2RHBA 1TWFI 2V8IA 5FLXb 3H3VJ 3M3YI 3CCLZ 4A3FI 1I6HI 2E9HA 4E2WA 4X6AI 3CC2Z 1K732 2GU2A 1VQ71 3OW2Y 1YJN1 1K9M1 4NBEA 1YJ9Z 1NP6A 3J7A4 3I56Z 3TE5B 2P28A 1Z03A 2JMOA 4BBRI 1S72Z 1Q7Y2 1S7MA 1QYPA 1Y1VI 3S1RI 4RVFA 2JA5I 3MZKB 3G6E1 3J80f 2VUGA 1Z01A 3S2DI 3U50C 1Q862 2DE6A 2JR6A 3G711 2NVYI 4NBCA 3CC4Z 3CME1 1YUAA 1N2FA 3FQMA 2LFUA 2VF1A 3CCS1 2QRCB 1VQ51 3HOYI 2PMZA 4RVHA 1X0TA 1X3WA 3J80b 1QVGZ 1VQ7Z 1YJNZ 4Y7NI 1QVFZ 4E2YA 2BJOA 4EWCA 1TWHI 3NH4A 2QKDA 2KPIA 3KIFA 3HKZA 3CCE1 2IZ4A 3BG1B 3GCFA 3FQQA 1M1K1 4NB8A 1N8R2 3P5JB 3GTGI 3S1NI 3F3FC 4NBHA 4QTUA 2Y0SA 1TFIA 3G6EZ 2F4MA 1W2BY 1X3ZA 1NJI2 3QWUA 4E31A 4BY7I 3BG0B 3H0GI 2JNYA 1VQM1 3VTNA 5D1OA 1I3QI 3G71Z 4NOZA 4A3LI 2OTJ1 4QTTA 1VQ6Z 3CMEZ 4HGZA 3NH5A 1R9TI 3MONA 5AN9F 1YIT1 1K83I 3J81f 3HOVI 2DE7A 3GTMS 3NDJA 3CCSZ 1VQ5Z 2JA8I 1VQKZ 1YHQ1 1YI2Z 3EERA 3I4MI 5C44I 1RNIA 3RZDI 3CCEZ 2JUBA 4RS4A 3CCQ1 1K731 3PO2I 4A93I 2JS4A 1I50I 3J81b 5FLMI 2QEXZ 1M902 2K5RA 3K7AI 2JA6I 1Q7Y1 3KIHA 2E2HI 1VQMZ 1WW9A 4NBBA 1KC81 3NFZA 2OTJZ 1YJW1 3CC7Z 3LUSA 4RVDA 4NFRA 1YITZ 2EGTA 1W2BZ 1Q861 1K9M2 2I3CA 5D1OB 3EEDA 1Q822 3IX0A 1L1OC 3G4S1 1YHQZ 3CMAZ 1SFOI 2HU9A 4MXUA 1KD11 2O4HA 1P9NA 2QA41 2LIYA 5A2Qf 2NVXI 1K8A1 1RLYA 2R92I 3CCQZ 3GTOI 1USPA 2Q51A 2M6NA 4E32A 3HOZI 1ZH1A 2PM9A 1WCMI 4XX2A 3GKQA 4A3EI 1YIJ1 2HF1A 3GTJI 3TDHB 4S1TA 3CCM1 2QR1B 3D9XA 4A3GI 2JA7I 1JJ2Y 2F4OA 2NVQI 3CCJ1 4MONA 4NB9A 2OTL1 5A2Qb 1YJWZ 2WB1A 1JWHC 3CPWZ 1Q811 2B63I 1Y1VS 5IT9f 4NBGA 4MRIA 1VQP1 3G4SZ 3HOXI 4A3MI 4CL1A 1M1K2 3RZOI 3T4NB 1KQSZ 3GTQI 2RT9A 2QA4Z 3MZLB 1VQ41 1TWGI 1ZB9A 4A3II 4MD7A 2W04A 2G2KA 3IFUA 5IT9b 4NBFA 1YIJZ 2M48A 3NDIA 4AYBA 4E2ZA 2DE5A 2GTIA 3CCMZ 1USPB 5IP9I 2O53A 2R6MA 2KI7B 4A3KI 1Y1WI 2E2JI 2H85A 3CCJZ 3CQZI 5C4XI 4MD9A 3FKII 3CPWY 1M901 2OTLZ 2K3RA 1VQ81 1KRLA 1TWAI 3CXCY 1VQO1 5T6BA 2J6AA 3NH8A 2QRDB 2RPRA 3I07A 3HOWI 1VQPZ 5IP7I 3S1QI 3GTKI 1KQSY 3Q87A 1JJ2Z 2WAQA 5T64A 3VMGA 3VB9A 3PO3I 1Q821 1ZB8A 3IF8A 3CD61 2OZKA 3CCU1 4E30A 1VQ4Z 4BY1I 4A3CI 4HH4A 5C4JI 2QLVB 3D6WA 3S17I 4MH4A 1RO2A 4NBAA 4Y52I 4HGYA 2VUMI 1KC82 1VQ91 1VLAA 1RO0A 2E2II 3M4OI 3CCV1 3GTPI 1VQN1 3GTMI 1LQLA 2OOYB 2GTHA 2QREB 1VQL1 1VQ61 4RV9A 1VQ8Z 2ZAEB 3ESWA 4E33A 5CM2M 1VQOZ 1N8R1 2NVTI 3S2HI 3I551 1YUKA 1KD12 3S15I 1VQK1 1NJI1 1K8A2 1YI21 2RIQA 1RQFA 2R7ZI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F3P C;  3F3F C; 
#chains in the Genus database with same CATH topology
 4TNU A;  2AKL A;  3CD6 Z;  3S14 I;  3CCU Z;  3CCR 1;  4NBD A;  1Z02 A;  1PFT A;  3CXC Z;  1ML8 A;  3CCL 1;  5D1P A;  3CC2 1;  3PO3 S;  3GTL I;  2PK7 A;  2IZ3 A;  1QF8 A;  3JAM f;  1YJ9 1;  1VQ9 Z;  5T67 A;  3I56 1;  2QEX 1;  3OW2 Z;  4BXX I;  2Q4Z A;  3VMI A;  3F3P C;  3S16 I;  4DQY B;  4BBS I;  2YU9 I;  3CCV Z;  1S72 1;  1Q81 2;  4NH1 C;  4A3J I;  1VQN Z;  5FLX f;  4A3B I;  1DL6 A;  2YAD A;  2RBL A;  3I4N I;  1VQL Z;  1WJ2 A;  3CC7 1;  1TWC I;  4DGL A;  4A3D I;  1QXF A;  1RO4 A;  3VMH A;  2OOX B;  4MD8 A;  3S1M I;  3I55 Z;  4DK1 A;  1QVG Y;  1NUI A;  2V8K A;  1QVF Y;  3HOU I;  2W03 A;  3JAM b;  3CMA 1;  4E2X A;  3CC4 1;  5LL6 f;  4RVG A;  2R93 I;  2V8J A;  1WII A;  2P3Y A;  5C3E I;  2AYD A;  1Y8C A;  3CCR Z;  2RHB A;  1TWF I;  3IR7 A;  2V8I A;  5FLX b;  3H3V J;  2JIM A;  3M3Y I;  3CCL Z;  4A3F I;  1I6H I;  2E9H A;  4E2W A;  4X6A I;  3CC2 Z;  1K73 2;  2GU2 A;  1VQ7 1;  3OW2 Y;  1YJN 1;  2LEX A;  1K9M 1;  4NBE A;  1YJ9 Z;  1NP6 A;  3J7A 4;  3I56 Z;  3TE5 B;  2P28 A;  1Z03 A;  2JMO A;  4BBR I;  2JIR A;  1S72 Z;  1Q7Y 2;  1S7M A;  1QYP A;  1Y1V I;  3S1R I;  4RVF A;  2JA5 I;  3MZK B;  3G6E 1;  2VPX A;  3J80 f;  2VUG A;  1Z01 A;  3S2D I;  3U50 C;  1Q86 2;  1WZN A;  2DE6 A;  2JR6 A;  3G71 1;  2NVY I;  4NBC A;  3CC4 Z;  3CME 1;  1YUA A;  1N2F A;  3FQM A;  2LFU A;  2VF1 A;  3CCS 1;  2QRC B;  1VQ5 1;  3HOY I;  2PMZ A;  4RVH A;  1X0T A;  1X3W A;  3J80 b;  1QVG Z;  1VQ7 Z;  1YJN Z;  4Y7N I;  1QVF Z;  4E2Y A;  2BJO A;  3D2L A;  4EWC A;  1TWH I;  3NH4 A;  2QKD A;  2KPI A;  3KIF A;  3HKZ A;  3CCE 1;  2IZ4 A;  3BG1 B;  3GCF A;  3FQQ A;  1M1K 1;  4NB8 A;  2VPW A;  1N8R 2;  3P5J B;  3GTG I;  3S1N I;  3F3F C;  4NBH A;  4QTU A;  2Y0S A;  1TFI A;  3G6E Z;  2F4M A;  1W2B Y;  1X3Z A;  1NJI 2;  3QWU A;  4E31 A;  4BY7 I;  1Q16 A;  3BG0 B;  2V3V A;  3H0G I;  2JNY A;  1VQM 1;  3VTN A;  5D1O A;  1I3Q I;  3G71 Z;  4NOZ A;  4A3L I;  2OTJ 1;  4QTT A;  1VQ6 Z;  3CME Z;  4HGZ A;  3NH5 A;  1R9T I;  3MON A;  5AN9 F;  1YIT 1;  1K83 I;  3J81 f;  3HOV I;  2DE7 A;  3GTM S;  3NDJ A;  3CCS Z;  1VQ5 Z;  2JA8 I;  1VQK Z;  1YHQ 1;  1YI2 Z;  3EER A;  3I4M I;  5C44 I;  1RNI A;  3RZD I;  3CCE Z;  2JUB A;  4RS4 A;  3CCQ 1;  1K73 1;  3PO2 I;  4A93 I;  2JS4 A;  1I50 I;  3J81 b;  5FLM I;  2QEX Z;  1M90 2;  2K5R A;  2VPZ A;  3K7A I;  2JA6 I;  1Q7Y 1;  3KIH A;  2E2H I;  1VQM Z;  1WW9 A;  4NBB A;  1KC8 1;  2NAP A;  3NFZ A;  2OTJ Z;  1YJW 1;  3CC7 Z;  3LUS A;  4RVD A;  4NFR A;  1YIT Z;  2V45 A;  2EGT A;  1W2B Z;  1Q86 1;  1K9M 2;  2I3C A;  5D1O B;  3EED A;  1Q82 2;  3IX0 A;  1L1O C;  3G4S 1;  1YHQ Z;  3CMA Z;  1SFO I;  2HU9 A;  4MXU A;  1KD1 1;  2O4H A;  1P9N A;  2QA4 1;  2LIY A;  5A2Q f;  2NVX I;  1K8A 1;  1RLY A;  1FDI A;  2R92 I;  2IV2 X;  3CCQ Z;  3GTO I;  1USP A;  2Q51 A;  2M6N A;  4E32 A;  3HOZ I;  2E7Z A;  1ZH1 A;  2PM9 A;  1WCM I;  4XX2 A;  3GKQ A;  4A3E I;  1YIJ 1;  2HF1 A;  3GTJ I;  3TDH B;  4S1T A;  3CCM 1;  2QR1 B;  3D9X A;  4A3G I;  2JA7 I;  1JJ2 Y;  2F4O A;  2NVQ I;  3CCJ 1;  4MON A;  1FDO A;  4NB9 A;  2OTL 1;  5A2Q b;  1YJW Z;  2WB1 A;  1JWH C;  3CPW Z;  1Q81 1;  2B63 I;  1Y1V S;  5IT9 f;  4NBG A;  4MRI A;  1VQP 1;  3G4S Z;  3HOX I;  4A3M I;  4CL1 A;  1M1K 2;  2JIO A;  3RZO I;  3T4N B;  1KQS Z;  3GTQ I;  2RT9 A;  2QA4 Z;  3MZL B;  1VQ4 1;  1TWG I;  1ZB9 A;  4A3I I;  4MD7 A;  2W04 A;  2G2K A;  3IFU A;  5IT9 b;  4NBF A;  1YIJ Z;  2M48 A;  3NDI A;  4AYB A;  4E2Z A;  2DE5 A;  2GTI A;  3CCM Z;  1USP B;  5IP9 I;  2O53 A;  2R6M A;  2KI7 B;  4A3K I;  1Y1W I;  2E2J I;  2H85 A;  3CCJ Z;  3CQZ I;  5C4X I;  4MD9 A;  3FKI I;  3CPW Y;  1M90 1;  2OTL Z;  2K3R A;  1VQ8 1;  1KRL A;  1TWA I;  3CXC Y;  1VQO 1;  5T6B A;  2J6A A;  3NH8 A;  2JIQ A;  2QRD B;  2RPR A;  3I07 A;  3HOW I;  1VQP Z;  5IP7 I;  3S1Q I;  3GTK I;  1KQS Y;  3Q87 A;  1JJ2 Z;  2WAQ A;  5T64 A;  3VMG A;  3VB9 A;  3PO3 I;  1Q82 1;  1ZB8 A;  3IF8 A;  3CD6 1;  1SIW A;  2OZK A;  3CCU 1;  4E30 A;  1VQ4 Z;  4BY1 I;  4A3C I;  4HH4 A;  5C4J I;  2QLV B;  3D6W A;  3S17 I;  4MH4 A;  1RO2 A;  4NBA A;  4Y52 I;  4HGY A;  2VUM I;  1KC8 2;  1VQ9 1;  1VLA A;  1AA6 A;  1RO0 A;  2E2I I;  3M4O I;  3CCV 1;  3GTP I;  1VQN 1;  3GTM I;  2VPY A;  1LQL A;  2OOY B;  2GTH A;  2QRE B;  1VQL 1;  1VQ6 1;  4RV9 A;  1VQ8 Z;  2ZAE B;  3ESW A;  4E33 A;  5CM2 M;  1VQO Z;  1N8R 1;  2NVT I;  3S2H I;  3I55 1;  1YUK A;  1KD1 2;  3S15 I;  1VQK 1;  1NJI 1;  1K8A 2;  1YI2 1;  2JIP A;  2RIQ A;  1RQF A;  2R7Z I; 
#chains in the Genus database with same CATH homology
 4TNU A;  2AKL A;  3CD6 Z;  3S14 I;  3CCU Z;  3CCR 1;  4NBD A;  1Z02 A;  1PFT A;  3CXC Z;  1ML8 A;  3CCL 1;  5D1P A;  3CC2 1;  3PO3 S;  3GTL I;  2PK7 A;  1QF8 A;  2IZ3 A;  3JAM f;  1YJ9 1;  1VQ9 Z;  5T67 A;  3I56 1;  2QEX 1;  3OW2 Z;  4BXX I;  2Q4Z A;  3VMI A;  3F3P C;  3S16 I;  4DQY B;  4BBS I;  2YU9 I;  3CCV Z;  1S72 1;  1Q81 2;  4NH1 C;  4A3J I;  1VQN Z;  5FLX f;  4A3B I;  1DL6 A;  2YAD A;  2RBL A;  3I4N I;  1VQL Z;  3CC7 1;  1TWC I;  4DGL A;  4A3D I;  1RO4 A;  3VMH A;  2OOX B;  4MD8 A;  3S1M I;  3I55 Z;  4DK1 A;  1QVG Y;  1NUI A;  2V8K A;  1QVF Y;  3HOU I;  2W03 A;  3JAM b;  3CMA 1;  4E2X A;  3CC4 1;  5LL6 f;  4RVG A;  2R93 I;  2V8J A;  1WII A;  2P3Y A;  5C3E I;  3CCR Z;  2RHB A;  1TWF I;  2V8I A;  5FLX b;  3H3V J;  3M3Y I;  3CCL Z;  4A3F I;  1I6H I;  2E9H A;  4E2W A;  4X6A I;  3CC2 Z;  1K73 2;  2GU2 A;  1VQ7 1;  3OW2 Y;  1YJN 1;  1K9M 1;  4NBE A;  1YJ9 Z;  1NP6 A;  3J7A 4;  3I56 Z;  3TE5 B;  2P28 A;  1Z03 A;  2JMO A;  4BBR I;  1S72 Z;  1Q7Y 2;  1S7M A;  1QYP A;  1Y1V I;  3S1R I;  4RVF A;  2JA5 I;  3MZK B;  3G6E 1;  3J80 f;  2VUG A;  1Z01 A;  3S2D I;  3U50 C;  1Q86 2;  2DE6 A;  2JR6 A;  3G71 1;  2NVY I;  4NBC A;  3CC4 Z;  3CME 1;  1YUA A;  1N2F A;  3FQM A;  2LFU A;  2VF1 A;  3CCS 1;  2QRC B;  1VQ5 1;  3HOY I;  2PMZ A;  4RVH A;  1X0T A;  1X3W A;  3J80 b;  1QVG Z;  1VQ7 Z;  1YJN Z;  4Y7N I;  1QVF Z;  4E2Y A;  2BJO A;  4EWC A;  1TWH I;  3NH4 A;  2QKD A;  2KPI A;  3KIF A;  3HKZ A;  3CCE 1;  2IZ4 A;  3BG1 B;  3GCF A;  3FQQ A;  1M1K 1;  4NB8 A;  1N8R 2;  3P5J B;  3GTG I;  3S1N I;  3F3F C;  4NBH A;  4QTU A;  2Y0S A;  1TFI A;  3G6E Z;  2F4M A;  1W2B Y;  1X3Z A;  1NJI 2;  3QWU A;  4E31 A;  4BY7 I;  3BG0 B;  3H0G I;  2JNY A;  1VQM 1;  3VTN A;  5D1O A;  1I3Q I;  3G71 Z;  4NOZ A;  4A3L I;  2OTJ 1;  4QTT A;  1VQ6 Z;  3CME Z;  4HGZ A;  3NH5 A;  1R9T I;  3MON A;  5AN9 F;  1YIT 1;  1K83 I;  3J81 f;  3HOV I;  2DE7 A;  3GTM S;  3NDJ A;  3CCS Z;  1VQ5 Z;  2JA8 I;  1VQK Z;  1YHQ 1;  1YI2 Z;  3EER A;  3I4M I;  5C44 I;  1RNI A;  3RZD I;  3CCE Z;  2JUB A;  4RS4 A;  3CCQ 1;  1K73 1;  3PO2 I;  4A93 I;  2JS4 A;  1I50 I;  3J81 b;  5FLM I;  2QEX Z;  1M90 2;  2K5R A;  3K7A I;  2JA6 I;  1Q7Y 1;  3KIH A;  2E2H I;  1VQM Z;  1WW9 A;  4NBB A;  1KC8 1;  3NFZ A;  2OTJ Z;  1YJW 1;  3CC7 Z;  3LUS A;  4RVD A;  4NFR A;  1YIT Z;  2EGT A;  1W2B Z;  1Q86 1;  1K9M 2;  2I3C A;  5D1O B;  3EED A;  1Q82 2;  3IX0 A;  1L1O C;  3G4S 1;  1YHQ Z;  3CMA Z;  1SFO I;  2HU9 A;  4MXU A;  1KD1 1;  2O4H A;  1P9N A;  2QA4 1;  2LIY A;  5A2Q f;  2NVX I;  1K8A 1;  1RLY A;  2R92 I;  3CCQ Z;  3GTO I;  1USP A;  2Q51 A;  2M6N A;  4E32 A;  3HOZ I;  1ZH1 A;  2PM9 A;  1WCM I;  4XX2 A;  3GKQ A;  4A3E I;  1YIJ 1;  2HF1 A;  3GTJ I;  3TDH B;  4S1T A;  3CCM 1;  2QR1 B;  3D9X A;  4A3G I;  2JA7 I;  1JJ2 Y;  2F4O A;  2NVQ I;  3CCJ 1;  4MON A;  4NB9 A;  2OTL 1;  5A2Q b;  1YJW Z;  2WB1 A;  1JWH C;  3CPW Z;  1Q81 1;  2B63 I;  1Y1V S;  5IT9 f;  4NBG A;  4MRI A;  1VQP 1;  3G4S Z;  3HOX I;  4A3M I;  4CL1 A;  1M1K 2;  3RZO I;  3T4N B;  1KQS Z;  3GTQ I;  2RT9 A;  2QA4 Z;  3MZL B;  1VQ4 1;  1TWG I;  1ZB9 A;  4A3I I;  4MD7 A;  2W04 A;  2G2K A;  3IFU A;  5IT9 b;  4NBF A;  1YIJ Z;  2M48 A;  3NDI A;  4AYB A;  4E2Z A;  2DE5 A;  2GTI A;  3CCM Z;  1USP B;  5IP9 I;  2O53 A;  2R6M A;  2KI7 B;  4A3K I;  1Y1W I;  2E2J I;  2H85 A;  3CCJ Z;  3CQZ I;  5C4X I;  4MD9 A;  3FKI I;  3CPW Y;  1M90 1;  2OTL Z;  2K3R A;  1VQ8 1;  1KRL A;  1TWA I;  3CXC Y;  1VQO 1;  5T6B A;  2J6A A;  3NH8 A;  2QRD B;  2RPR A;  3I07 A;  3HOW I;  1VQP Z;  5IP7 I;  3S1Q I;  3GTK I;  1KQS Y;  3Q87 A;  1JJ2 Z;  2WAQ A;  5T64 A;  3VMG A;  3VB9 A;  3PO3 I;  1Q82 1;  1ZB8 A;  3IF8 A;  3CD6 1;  2OZK A;  3CCU 1;  4E30 A;  1VQ4 Z;  4BY1 I;  4A3C I;  4HH4 A;  5C4J I;  2QLV B;  3D6W A;  3S17 I;  4MH4 A;  1RO2 A;  4NBA A;  4Y52 I;  4HGY A;  2VUM I;  1KC8 2;  1VQ9 1;  1VLA A;  1RO0 A;  2E2I I;  3M4O I;  3CCV 1;  3GTP I;  1VQN 1;  3GTM I;  1LQL A;  2OOY B;  2GTH A;  2QRE B;  1VQL 1;  1VQ6 1;  4RV9 A;  1VQ8 Z;  2ZAE B;  3ESW A;  4E33 A;  5CM2 M;  1VQO Z;  1N8R 1;  2NVT I;  3S2H I;  3I55 1;  1YUK A;  1KD1 2;  3S15 I;  1VQK 1;  1NJI 1;  1K8A 2;  1YI2 1;  2RIQ A;  1RQF A;  2R7Z I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...