3F3FC

Crystal structure of the nucleoporin pair nup85-seh1, space group p21
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
498
structure length
475
Chain Sequence
ILVPMTVNDQPIEKNGDKMPLKFKLGPLSYQNMAFITAKDKYKLYPVRIPRLDTSKEFSAYVSGLFEIYRDLGDDRVFNVVNSNFAKEHNATVNLAMEAILNELEVFIGRVKDQDGRVNRFYELEESLTVLNCLRTMYFILDGQDVEENRSEFIESLLNWINRSDGEPDEEYIEQVFSVAGKKVFETQYFWKLLNQLVLRGLLSQAIGCIERSDLLPYLSDTCAVSFDAVSDSIELLKQYPKDSSSTFREWKNLVLKLSQAFGSSATDISGELRDYIEDFLLVIGGNQRKILQYSRTWYESFCGFLLYYIPSLELSAEYLQMSLEANVVDITNDWEQPCVDIISGKIHSILPVMESLDSCTAAFTAMICEAKGLIENIFEGLEDLFSYRNGMASYMLNSFAFELCSLGDKELWPVAIGLIALSATGTRSAKKMVIAELLPHYPFVTNDDIEWMLSICVEWRLPEIAKEIYTTLGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nucleoporin SEH1
publication title A fence-like coat for the nuclear pore membrane.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 155
structure length 475
sequence length 498
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 2008-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.500 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3f3fC01
3F3PC 3F3FC
chains in the Genus database with same CATH superfamily
3NDJA 1YJW1 1VQPZ 2DE5A 1VQ4Z 1YJ91 3M3YI 1I3QI 3FKII 3VMHA 1Q862 3GCFA 1VQ8Z 1VQ51 3K7AI 3J81b 3IR7A 3G6E1 1JJ2Z 4NB9A 4X6AI 1YUKA 5AN9F 2QA4Z 1KC81 2JA8I 2H85A 2JA7I 2O4HA 1USPA 1K731 3T4NB 3CMEZ 1TWGI 2LFUA 2JA5I 2JUBA 1NJI1 4XX2A 2DE6A 3CCE1 2O53A 3CC21 2NVTI 2OZKA 1NUIA 1VQP1 1WW9A 2NVYI 1VQ41 3HOWI 1X3WA 4A3BI 2P3YA 3BG0B 1TWAI 2QEXZ 1VQ81 1K8A2 1M1K1 2QR1B 1YJNZ 1Z03A 3S17I 4NFRA 2QA41 3KIHA 1ZH1A 3VTNA 1M902 4DGLA 1RNIA 4MRIA 2E2II 2LIYA 4BY7I 1YIJZ 3CME1 2QKDA 3S2HI 2JR6A 3F3FC 1JJ2Y 3IX0A 1KD11 1QVFZ 1S7MA 3CC7Z 2P28A 4E2WA 1AA6A 4NBGA 2W03A 3MZLB 3KIFA 2VF1A 2OOYB 2R6MA 4A3FI 2JMOA 1DL6A 1TFIA 1TWHI 2QEX1 4MH4A 4NBBA 1Q822 3S15I 5IT9b 1YJN1 2VPXA 4A3MI 2Q51A 2V3VA 3J80b 2JIOA 2GTIA 1X3ZA 2GU2A 3GKQA 2R92I 3VB9A 4MONA 3H0GI 3HOYI 1YIJ1 1X0TA 3RZDI 4BXXI 3GTQI 3G4SZ 3P5JB 1RO4A 2F4OA 1S72Z 1Y8CA 1Q861 3D9XA 5D1PA 4EWCA 1K9M2 3CCRZ 2WAQA 3CC71 2OTLZ 2E2HI 2JIPA 1FDIA 2DE7A 3JAMf 2JIMA 5A2Qb 5IP7I 1QVFY 3PO3S 2B63I 3M4OI 3CCV1 1WZNA 2RBLA 4QTUA 1SIWA 1W2BZ 3TDHB 5C3EI 1KRLA 4NB8A 2OTJZ 3CC4Z 2RHBA 4RVFA 4QTTA 3JAMb 1WIIA 3CCJZ 3CCUZ 3NFZA 3G4S1 1S721 3CCMZ 3J7A4 5FLXf 3OW2Z 1K8A1 3CCR1 4S1TA 2OTL1 2R93I 4HGYA 4E30A 2NVQI 4A3II 1N2FA 3IFUA 1YITZ 1TWFI 3CCQZ 1Q7Y2 1QXFA 2E7ZA 3GTMS 4NBHA 1NP6A 1QF8A 1WJ2A 2VPZA 1Q16A 3VMIA 4MXUA 4AYBA 3HOXI 2HU9A 5FLXb 3BG1B 1KC82 3F3PC 2OTJ1 4HH4A 3CC41 4CL1A 3CXCZ 4E2XA 1VQKZ 1SFOI 1RQFA 3PO3I 3CCJ1 3I07A 3CCU1 1RLYA 4A3JI 1W2BY 3CCM1 1Q812 4TNUA 1Q821 4A3GI 4NOZA 2AKLA 2PK7A 3GTLI 4NBAA 1VQ6Z 2PM9A 4BY1I 2K3RA 1YIT1 3CCQ1 2NAPA 2RPRA 1VQ9Z 2BJOA 4RV9A 5LL6f 2AYDA 2I3CA 2F4MA 4E2YA 3GTOI 3GTJI 2LEXA 2NVXI 3CCLZ 4RVGA 2EGTA 3CMAZ 3D6WA 1N8R2 2E2JI 2QRCB 1ZB8A 1VQK1 3GTMI 3FQMA 4A3KI 1RO0A 2JA6I 5C4JI 4A3DI 2JS4A 2JNYA 2E9HA 3CPWZ 1VQ61 1RO2A 4RVDA 1VQOZ 2WB1A 4A3LI 1VQMZ 1VQ91 3GTKI 2K5RA 4HGZA 2QREB 3I56Z 1YHQZ 1ZB9A 3HOZI 3GTGI 4NBCA 3CCL1 3PO2I 1PFTA 3HKZA 4BBRI 3CC2Z 2VUMI 2VPWA 2RIQA 2G2KA 5C44I 1QVGZ 5D1OB 1Y1VI 1Q7Y1 1KQSZ 1VQNZ 5T64A 1I6HI 3VMGA 3CD6Z 1ML8A 2V8IA 3H3VJ 3IF8A 5T6BA 4E31A 4NBFA 3HOVI 4MD9A 2J6AA 1VQO1 4DQYB 4Y7NI 1VQM1 5C4XI 3MONA 1M901 4NBEA 4BBSI 1L1OC 3TE5B 2R7ZI 3I561 1YHQ1 4A3EI 1TWCI 3CPWY 3FQQA 3S2DI 4MD8A 1YI2Z 1K83I 3CQZI 2JIRA 2ZAEB 1Q811 3NH4A 3GTPI 3S16I 1VLAA 1QYPA 2RT9A 3CCSZ 1Z02A 4NBDA 1K732 2OOXB 3Q87A 2YU9I 3NH5A 1R9TI 1VQN1 1JWHC 3S1QI 1VQLZ 3U50C 5FLMI 1NJI2 2YADA 3EERA 4DK1A 3CD61 5D1OA 2IV2X 3LUSA 5CM2M 3S1NI 1QVGY 2Q4ZA 1VQ7Z 1I50I 1P9NA 3D2LA 1N8R1 4A93I 1KQSY 3S1MI 2VPYA 5IP9I 1FDOA 4RS4A 1M1K2 1Z01A 5IT9f 3OW2Y 3S14I 2VUGA 1Y1VS 3J80f 1YI21 2QRDB 4NH1C 2W04A 5T67A 4Y52I 3I55Z 2M6NA 3NDIA 2M48A 1K9M1 3G71Z 2IZ3A 2Y0SA 2QLVB 3CCS1 2GTHA 1YJWZ 3S1RI 1YJ9Z 1LQLA 1VQL1 3MZKB 2V8KA 3I4NI 2PMZA 1KD12 1VQ5Z 3CCVZ 3I4MI 3HOUI 3CXCY 3G6EZ 3ESWA 1USPB 5A2Qf 1YUAA 4A3CI 1VQ71 4MD7A 4E2ZA 2V8JA 4RVHA 2KPIA 3EEDA 4E32A 2JIQA 1WCMI 2IZ4A 3J81f 1Y1WI 2HF1A 2V45A 3NH8A 3RZOI 3I551 2KI7B 3CMA1 3CCEZ 3QWUA 3G711 4E33A
chains in the Genus database with same CATH topology
3NDJA 1YJW1 1VQPZ 2DE5A 1VQ4Z 1YJ91 3M3YI 1I3QI 3FKII 3VMHA 1Q862 3GCFA 1VQ8Z 1VQ51 3K7AI 3J81b 3G6E1 1JJ2Z 4NB9A 4X6AI 1YUKA 5AN9F 2QA4Z 1KC81 2JA8I 2H85A 2JA7I 2O4HA 1USPA 1K731 3T4NB 3CMEZ 1TWGI 2LFUA 2JA5I 2JUBA 1NJI1 4XX2A 2DE6A 3CCE1 2O53A 3CC21 2NVTI 2OZKA 1NUIA 1VQP1 1WW9A 2NVYI 1VQ41 3HOWI 1X3WA 4A3BI 2P3YA 3BG0B 1TWAI 2QEXZ 1VQ81 1K8A2 1M1K1 2QR1B 1YJNZ 1Z03A 3S17I 4NFRA 2QA41 3KIHA 1ZH1A 3VTNA 1M902 4DGLA 1RNIA 4MRIA 2E2II 2LIYA 4BY7I 1YIJZ 3CME1 2QKDA 3S2HI 2JR6A 3F3FC 1JJ2Y 3IX0A 1KD11 1QVFZ 1S7MA 3CC7Z 2P28A 4E2WA 4NBGA 2W03A 3MZLB 3KIFA 2VF1A 2OOYB 2R6MA 4A3FI 2JMOA 1DL6A 1TFIA 1TWHI 2QEX1 4MH4A 4NBBA 1Q822 3S15I 5IT9b 1YJN1 4A3MI 2Q51A 3J80b 2GTIA 1X3ZA 2GU2A 3GKQA 2R92I 3VB9A 4MONA 3H0GI 3HOYI 1YIJ1 1X0TA 3RZDI 4BXXI 3GTQI 3G4SZ 3P5JB 1RO4A 2F4OA 1S72Z 1Q861 3D9XA 5D1PA 4EWCA 1K9M2 3CCRZ 2WAQA 3CC71 2OTLZ 2E2HI 2DE7A 3JAMf 5A2Qb 5IP7I 1QVFY 3PO3S 2B63I 3M4OI 3CCV1 2RBLA 4QTUA 1W2BZ 3TDHB 5C3EI 1KRLA 4NB8A 2OTJZ 3CC4Z 2RHBA 4RVFA 4QTTA 3JAMb 1WIIA 3CCJZ 3CCUZ 3NFZA 3G4S1 1S721 3CCMZ 3J7A4 5FLXf 3OW2Z 1K8A1 3CCR1 4S1TA 2OTL1 2R93I 4HGYA 4E30A 2NVQI 4A3II 1N2FA 3IFUA 1YITZ 1TWFI 3CCQZ 1Q7Y2 3GTMS 4NBHA 1NP6A 1QF8A 3VMIA 4MXUA 4AYBA 3HOXI 2HU9A 5FLXb 3BG1B 1KC82 3F3PC 2OTJ1 4HH4A 3CC41 4CL1A 3CXCZ 4E2XA 1VQKZ 1SFOI 1RQFA 3PO3I 3CCJ1 3I07A 3CCU1 1RLYA 4A3JI 1W2BY 3CCM1 1Q812 4TNUA 1Q821 4A3GI 4NOZA 2AKLA 2PK7A 3GTLI 4NBAA 1VQ6Z 2PM9A 4BY1I 2K3RA 1YIT1 3CCQ1 2RPRA 1VQ9Z 2BJOA 4RV9A 5LL6f 2I3CA 2F4MA 4E2YA 3GTOI 3GTJI 2NVXI 3CCLZ 4RVGA 2EGTA 3CMAZ 3D6WA 1N8R2 2E2JI 2QRCB 1ZB8A 1VQK1 3GTMI 3FQMA 4A3KI 1RO0A 2JA6I 5C4JI 4A3DI 2JS4A 2JNYA 2E9HA 3CPWZ 1VQ61 1RO2A 4RVDA 1VQOZ 2WB1A 4A3LI 1VQMZ 1VQ91 3GTKI 2K5RA 4HGZA 2QREB 3I56Z 1YHQZ 1ZB9A 3HOZI 3GTGI 4NBCA 3CCL1 3PO2I 1PFTA 3HKZA 4BBRI 3CC2Z 2VUMI 2RIQA 2G2KA 5C44I 1QVGZ 5D1OB 1Y1VI 1Q7Y1 1KQSZ 1VQNZ 5T64A 1I6HI 3VMGA 3CD6Z 1ML8A 2V8IA 3H3VJ 3IF8A 5T6BA 4E31A 4NBFA 3HOVI 4MD9A 2J6AA 1VQO1 4DQYB 4Y7NI 1VQM1 5C4XI 3MONA 1M901 4NBEA 4BBSI 1L1OC 3TE5B 2R7ZI 3I561 1YHQ1 4A3EI 1TWCI 3CPWY 3FQQA 3S2DI 4MD8A 1YI2Z 1K83I 3CQZI 2ZAEB 1Q811 3NH4A 3GTPI 3S16I 1VLAA 1QYPA 2RT9A 3CCSZ 1Z02A 4NBDA 1K732 2OOXB 3Q87A 2YU9I 3NH5A 1R9TI 1VQN1 1JWHC 3S1QI 1VQLZ 3U50C 5FLMI 1NJI2 2YADA 3EERA 4DK1A 3CD61 5D1OA 3LUSA 5CM2M 3S1NI 1QVGY 2Q4ZA 1VQ7Z 1I50I 1P9NA 1N8R1 4A93I 1KQSY 3S1MI 5IP9I 4RS4A 1M1K2 1Z01A 5IT9f 3OW2Y 3S14I 2VUGA 1Y1VS 3J80f 1YI21 2QRDB 4NH1C 2W04A 5T67A 4Y52I 3I55Z 2M6NA 3NDIA 2M48A 1K9M1 3G71Z 2IZ3A 2Y0SA 2QLVB 3CCS1 2GTHA 1YJWZ 3S1RI 1YJ9Z 1LQLA 1VQL1 3MZKB 2V8KA 3I4NI 2PMZA 1KD12 1VQ5Z 3CCVZ 3I4MI 3HOUI 3CXCY 3G6EZ 3ESWA 1USPB 5A2Qf 1YUAA 4A3CI 1VQ71 4MD7A 4E2ZA 2V8JA 4RVHA 2KPIA 3EEDA 4E32A 1WCMI 2IZ4A 3J81f 1Y1WI 2HF1A 3NH8A 3RZOI 3I551 2KI7B 3CMA1 3CCEZ 3QWUA 3G711 4E33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F3P C;  3F3F C; 
#chains in the Genus database with same CATH topology
 3NDJ A;  1YJW 1;  1VQP Z;  2DE5 A;  1VQ4 Z;  1YJ9 1;  3M3Y I;  1I3Q I;  3FKI I;  3VMH A;  1Q86 2;  3GCF A;  1VQ8 Z;  1VQ5 1;  3K7A I;  3J81 b;  3IR7 A;  3G6E 1;  1JJ2 Z;  4NB9 A;  4X6A I;  1YUK A;  5AN9 F;  2QA4 Z;  1KC8 1;  2JA8 I;  2H85 A;  2JA7 I;  2O4H A;  1USP A;  1K73 1;  3T4N B;  3CME Z;  1TWG I;  2LFU A;  2JA5 I;  2JUB A;  1NJI 1;  4XX2 A;  2DE6 A;  3CCE 1;  2O53 A;  3CC2 1;  2NVT I;  2OZK A;  1NUI A;  1VQP 1;  1WW9 A;  2NVY I;  1VQ4 1;  3HOW I;  1X3W A;  4A3B I;  2P3Y A;  3BG0 B;  1TWA I;  2QEX Z;  1VQ8 1;  1K8A 2;  1M1K 1;  2QR1 B;  1YJN Z;  1Z03 A;  3S17 I;  4NFR A;  2QA4 1;  3KIH A;  1ZH1 A;  3VTN A;  1M90 2;  4DGL A;  1RNI A;  4MRI A;  2E2I I;  2LIY A;  4BY7 I;  1YIJ Z;  3CME 1;  2QKD A;  3S2H I;  2JR6 A;  3F3F C;  1JJ2 Y;  3IX0 A;  1KD1 1;  1QVF Z;  1S7M A;  3CC7 Z;  2P28 A;  4E2W A;  1AA6 A;  4NBG A;  2W03 A;  3MZL B;  3KIF A;  2VF1 A;  2OOY B;  2R6M A;  4A3F I;  2JMO A;  1DL6 A;  1TFI A;  1TWH I;  2QEX 1;  4MH4 A;  4NBB A;  1Q82 2;  3S15 I;  5IT9 b;  1YJN 1;  2VPX A;  4A3M I;  2Q51 A;  2V3V A;  3J80 b;  2JIO A;  2GTI A;  1X3Z A;  2GU2 A;  3GKQ A;  2R92 I;  3VB9 A;  4MON A;  3H0G I;  3HOY I;  1YIJ 1;  1X0T A;  3RZD I;  4BXX I;  3GTQ I;  3G4S Z;  3P5J B;  1RO4 A;  2F4O A;  1S72 Z;  1Y8C A;  1Q86 1;  3D9X A;  5D1P A;  4EWC A;  1K9M 2;  3CCR Z;  2WAQ A;  3CC7 1;  2OTL Z;  2E2H I;  2JIP A;  1FDI A;  2DE7 A;  3JAM f;  2JIM A;  5A2Q b;  5IP7 I;  1QVF Y;  3PO3 S;  2B63 I;  3M4O I;  3CCV 1;  1WZN A;  2RBL A;  4QTU A;  1SIW A;  1W2B Z;  3TDH B;  5C3E I;  1KRL A;  4NB8 A;  2OTJ Z;  3CC4 Z;  2RHB A;  4RVF A;  4QTT A;  3JAM b;  1WII A;  3CCJ Z;  3CCU Z;  3NFZ A;  3G4S 1;  1S72 1;  3CCM Z;  3J7A 4;  5FLX f;  3OW2 Z;  1K8A 1;  3CCR 1;  4S1T A;  2OTL 1;  2R93 I;  4HGY A;  4E30 A;  2NVQ I;  4A3I I;  1N2F A;  3IFU A;  1YIT Z;  1TWF I;  3CCQ Z;  1Q7Y 2;  1QXF A;  2E7Z A;  3GTM S;  4NBH A;  1NP6 A;  1QF8 A;  1WJ2 A;  2VPZ A;  1Q16 A;  3VMI A;  4MXU A;  4AYB A;  3HOX I;  2HU9 A;  5FLX b;  3BG1 B;  1KC8 2;  3F3P C;  2OTJ 1;  4HH4 A;  3CC4 1;  4CL1 A;  3CXC Z;  4E2X A;  1VQK Z;  1SFO I;  1RQF A;  3PO3 I;  3CCJ 1;  3I07 A;  3CCU 1;  1RLY A;  4A3J I;  1W2B Y;  3CCM 1;  1Q81 2;  4TNU A;  1Q82 1;  4A3G I;  4NOZ A;  2AKL A;  2PK7 A;  3GTL I;  4NBA A;  1VQ6 Z;  2PM9 A;  4BY1 I;  2K3R A;  1YIT 1;  3CCQ 1;  2NAP A;  2RPR A;  1VQ9 Z;  2BJO A;  4RV9 A;  5LL6 f;  2AYD A;  2I3C A;  2F4M A;  4E2Y A;  3GTO I;  3GTJ I;  2LEX A;  2NVX I;  3CCL Z;  4RVG A;  2EGT A;  3CMA Z;  3D6W A;  1N8R 2;  2E2J I;  2QRC B;  1ZB8 A;  1VQK 1;  3GTM I;  3FQM A;  4A3K I;  1RO0 A;  2JA6 I;  5C4J I;  4A3D I;  2JS4 A;  2JNY A;  2E9H A;  3CPW Z;  1VQ6 1;  1RO2 A;  4RVD A;  1VQO Z;  2WB1 A;  4A3L I;  1VQM Z;  1VQ9 1;  3GTK I;  2K5R A;  4HGZ A;  2QRE B;  3I56 Z;  1YHQ Z;  1ZB9 A;  3HOZ I;  3GTG I;  4NBC A;  3CCL 1;  3PO2 I;  1PFT A;  3HKZ A;  4BBR I;  3CC2 Z;  2VUM I;  2VPW A;  2RIQ A;  2G2K A;  5C44 I;  1QVG Z;  5D1O B;  1Y1V I;  1Q7Y 1;  1KQS Z;  1VQN Z;  5T64 A;  1I6H I;  3VMG A;  3CD6 Z;  1ML8 A;  2V8I A;  3H3V J;  3IF8 A;  5T6B A;  4E31 A;  4NBF A;  3HOV I;  4MD9 A;  2J6A A;  1VQO 1;  4DQY B;  4Y7N I;  1VQM 1;  5C4X I;  3MON A;  1M90 1;  4NBE A;  4BBS I;  1L1O C;  3TE5 B;  2R7Z I;  3I56 1;  1YHQ 1;  4A3E I;  1TWC I;  3CPW Y;  3FQQ A;  3S2D I;  4MD8 A;  1YI2 Z;  1K83 I;  3CQZ I;  2JIR A;  2ZAE B;  1Q81 1;  3NH4 A;  3GTP I;  3S16 I;  1VLA A;  1QYP A;  2RT9 A;  3CCS Z;  1Z02 A;  4NBD A;  1K73 2;  2OOX B;  3Q87 A;  2YU9 I;  3NH5 A;  1R9T I;  1VQN 1;  1JWH C;  3S1Q I;  1VQL Z;  3U50 C;  5FLM I;  1NJI 2;  2YAD A;  3EER A;  4DK1 A;  3CD6 1;  5D1O A;  2IV2 X;  3LUS A;  5CM2 M;  3S1N I;  1QVG Y;  2Q4Z A;  1VQ7 Z;  1I50 I;  1P9N A;  3D2L A;  1N8R 1;  4A93 I;  1KQS Y;  3S1M I;  2VPY A;  5IP9 I;  1FDO A;  4RS4 A;  1M1K 2;  1Z01 A;  5IT9 f;  3OW2 Y;  3S14 I;  2VUG A;  1Y1V S;  3J80 f;  1YI2 1;  2QRD B;  4NH1 C;  2W04 A;  5T67 A;  4Y52 I;  3I55 Z;  2M6N A;  3NDI A;  2M48 A;  1K9M 1;  3G71 Z;  2IZ3 A;  2Y0S A;  2QLV B;  3CCS 1;  2GTH A;  1YJW Z;  3S1R I;  1YJ9 Z;  1LQL A;  1VQL 1;  3MZK B;  2V8K A;  3I4N I;  2PMZ A;  1KD1 2;  1VQ5 Z;  3CCV Z;  3I4M I;  3HOU I;  3CXC Y;  3G6E Z;  3ESW A;  1USP B;  5A2Q f;  1YUA A;  4A3C I;  1VQ7 1;  4MD7 A;  4E2Z A;  2V8J A;  4RVH A;  2KPI A;  3EED A;  4E32 A;  2JIQ A;  1WCM I;  2IZ4 A;  3J81 f;  1Y1W I;  2HF1 A;  2V45 A;  3NH8 A;  3RZO I;  3I55 1;  2KI7 B;  3CMA 1;  3CCE Z;  3QWU A;  3G71 1;  4E33 A; 
#chains in the Genus database with same CATH homology
 3NDJ A;  1YJW 1;  1VQP Z;  2DE5 A;  1VQ4 Z;  1YJ9 1;  3M3Y I;  1I3Q I;  3FKI I;  3VMH A;  1Q86 2;  3GCF A;  1VQ8 Z;  1VQ5 1;  3K7A I;  3J81 b;  3G6E 1;  1JJ2 Z;  4NB9 A;  4X6A I;  1YUK A;  5AN9 F;  2QA4 Z;  1KC8 1;  2JA8 I;  2H85 A;  2JA7 I;  2O4H A;  1USP A;  1K73 1;  3T4N B;  3CME Z;  1TWG I;  2LFU A;  2JA5 I;  2JUB A;  1NJI 1;  4XX2 A;  2DE6 A;  3CCE 1;  2O53 A;  3CC2 1;  2NVT I;  2OZK A;  1NUI A;  1VQP 1;  1WW9 A;  2NVY I;  1VQ4 1;  3HOW I;  1X3W A;  4A3B I;  2P3Y A;  3BG0 B;  1TWA I;  2QEX Z;  1VQ8 1;  1K8A 2;  1M1K 1;  2QR1 B;  1YJN Z;  1Z03 A;  3S17 I;  4NFR A;  2QA4 1;  3KIH A;  1ZH1 A;  3VTN A;  1M90 2;  4DGL A;  1RNI A;  4MRI A;  2E2I I;  2LIY A;  4BY7 I;  1YIJ Z;  3CME 1;  2QKD A;  3S2H I;  2JR6 A;  3F3F C;  1JJ2 Y;  3IX0 A;  1KD1 1;  1QVF Z;  1S7M A;  3CC7 Z;  2P28 A;  4E2W A;  4NBG A;  2W03 A;  3MZL B;  3KIF A;  2VF1 A;  2OOY B;  2R6M A;  4A3F I;  2JMO A;  1DL6 A;  1TFI A;  1TWH I;  2QEX 1;  4MH4 A;  4NBB A;  1Q82 2;  3S15 I;  5IT9 b;  1YJN 1;  4A3M I;  2Q51 A;  3J80 b;  2GTI A;  1X3Z A;  2GU2 A;  3GKQ A;  2R92 I;  3VB9 A;  4MON A;  3H0G I;  3HOY I;  1YIJ 1;  1X0T A;  3RZD I;  4BXX I;  3GTQ I;  3G4S Z;  3P5J B;  1RO4 A;  2F4O A;  1S72 Z;  1Q86 1;  3D9X A;  5D1P A;  4EWC A;  1K9M 2;  3CCR Z;  2WAQ A;  3CC7 1;  2OTL Z;  2E2H I;  2DE7 A;  3JAM f;  5A2Q b;  5IP7 I;  1QVF Y;  3PO3 S;  2B63 I;  3M4O I;  3CCV 1;  2RBL A;  4QTU A;  1W2B Z;  3TDH B;  5C3E I;  1KRL A;  4NB8 A;  2OTJ Z;  3CC4 Z;  2RHB A;  4RVF A;  4QTT A;  3JAM b;  1WII A;  3CCJ Z;  3CCU Z;  3NFZ A;  3G4S 1;  1S72 1;  3CCM Z;  3J7A 4;  5FLX f;  3OW2 Z;  1K8A 1;  3CCR 1;  4S1T A;  2OTL 1;  2R93 I;  4HGY A;  4E30 A;  2NVQ I;  4A3I I;  1N2F A;  3IFU A;  1YIT Z;  1TWF I;  3CCQ Z;  1Q7Y 2;  3GTM S;  4NBH A;  1NP6 A;  1QF8 A;  3VMI A;  4MXU A;  4AYB A;  3HOX I;  2HU9 A;  5FLX b;  3BG1 B;  1KC8 2;  3F3P C;  2OTJ 1;  4HH4 A;  3CC4 1;  4CL1 A;  3CXC Z;  4E2X A;  1VQK Z;  1SFO I;  1RQF A;  3PO3 I;  3CCJ 1;  3I07 A;  3CCU 1;  1RLY A;  4A3J I;  1W2B Y;  3CCM 1;  1Q81 2;  4TNU A;  1Q82 1;  4A3G I;  4NOZ A;  2AKL A;  2PK7 A;  3GTL I;  4NBA A;  1VQ6 Z;  2PM9 A;  4BY1 I;  2K3R A;  1YIT 1;  3CCQ 1;  2RPR A;  1VQ9 Z;  2BJO A;  4RV9 A;  5LL6 f;  2I3C A;  2F4M A;  4E2Y A;  3GTO I;  3GTJ I;  2NVX I;  3CCL Z;  4RVG A;  2EGT A;  3CMA Z;  3D6W A;  1N8R 2;  2E2J I;  2QRC B;  1ZB8 A;  1VQK 1;  3GTM I;  3FQM A;  4A3K I;  1RO0 A;  2JA6 I;  5C4J I;  4A3D I;  2JS4 A;  2JNY A;  2E9H A;  3CPW Z;  1VQ6 1;  1RO2 A;  4RVD A;  1VQO Z;  2WB1 A;  4A3L I;  1VQM Z;  1VQ9 1;  3GTK I;  2K5R A;  4HGZ A;  2QRE B;  3I56 Z;  1YHQ Z;  1ZB9 A;  3HOZ I;  3GTG I;  4NBC A;  3CCL 1;  3PO2 I;  1PFT A;  3HKZ A;  4BBR I;  3CC2 Z;  2VUM I;  2RIQ A;  2G2K A;  5C44 I;  1QVG Z;  5D1O B;  1Y1V I;  1Q7Y 1;  1KQS Z;  1VQN Z;  5T64 A;  1I6H I;  3VMG A;  3CD6 Z;  1ML8 A;  2V8I A;  3H3V J;  3IF8 A;  5T6B A;  4E31 A;  4NBF A;  3HOV I;  4MD9 A;  2J6A A;  1VQO 1;  4DQY B;  4Y7N I;  1VQM 1;  5C4X I;  3MON A;  1M90 1;  4NBE A;  4BBS I;  1L1O C;  3TE5 B;  2R7Z I;  3I56 1;  1YHQ 1;  4A3E I;  1TWC I;  3CPW Y;  3FQQ A;  3S2D I;  4MD8 A;  1YI2 Z;  1K83 I;  3CQZ I;  2ZAE B;  1Q81 1;  3NH4 A;  3GTP I;  3S16 I;  1VLA A;  1QYP A;  2RT9 A;  3CCS Z;  1Z02 A;  4NBD A;  1K73 2;  2OOX B;  3Q87 A;  2YU9 I;  3NH5 A;  1R9T I;  1VQN 1;  1JWH C;  3S1Q I;  1VQL Z;  3U50 C;  5FLM I;  1NJI 2;  2YAD A;  3EER A;  4DK1 A;  3CD6 1;  5D1O A;  3LUS A;  5CM2 M;  3S1N I;  1QVG Y;  2Q4Z A;  1VQ7 Z;  1I50 I;  1P9N A;  1N8R 1;  4A93 I;  1KQS Y;  3S1M I;  5IP9 I;  4RS4 A;  1M1K 2;  1Z01 A;  5IT9 f;  3OW2 Y;  3S14 I;  2VUG A;  1Y1V S;  3J80 f;  1YI2 1;  2QRD B;  4NH1 C;  2W04 A;  5T67 A;  4Y52 I;  3I55 Z;  2M6N A;  3NDI A;  2M48 A;  1K9M 1;  3G71 Z;  2IZ3 A;  2Y0S A;  2QLV B;  3CCS 1;  2GTH A;  1YJW Z;  3S1R I;  1YJ9 Z;  1LQL A;  1VQL 1;  3MZK B;  2V8K A;  3I4N I;  2PMZ A;  1KD1 2;  1VQ5 Z;  3CCV Z;  3I4M I;  3HOU I;  3CXC Y;  3G6E Z;  3ESW A;  1USP B;  5A2Q f;  1YUA A;  4A3C I;  1VQ7 1;  4MD7 A;  4E2Z A;  2V8J A;  4RVH A;  2KPI A;  3EED A;  4E32 A;  1WCM I;  2IZ4 A;  3J81 f;  1Y1W I;  2HF1 A;  3NH8 A;  3RZO I;  3I55 1;  2KI7 B;  3CMA 1;  3CCE Z;  3QWU A;  3G71 1;  4E33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...