3F3FC

Crystal structure of the nucleoporin pair nup85-seh1, space group p21
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
498
structure length
475
Chain Sequence
ILVPMTVNDQPIEKNGDKMPLKFKLGPLSYQNMAFITAKDKYKLYPVRIPRLDTSKEFSAYVSGLFEIYRDLGDDRVFNVVNSNFAKEHNATVNLAMEAILNELEVFIGRVKDQDGRVNRFYELEESLTVLNCLRTMYFILDGQDVEENRSEFIESLLNWINRSDGEPDEEYIEQVFSVAGKKVFETQYFWKLLNQLVLRGLLSQAIGCIERSDLLPYLSDTCAVSFDAVSDSIELLKQYPKDSSSTFREWKNLVLKLSQAFGSSATDISGELRDYIEDFLLVIGGNQRKILQYSRTWYESFCGFLLYYIPSLELSAEYLQMSLEANVVDITNDWEQPCVDIISGKIHSILPVMESLDSCTAAFTAMICEAKGLIENIFEGLEDLFSYRNGMASYMLNSFAFELCSLGDKELWPVAIGLIALSATGTRSAKKMVIAELLPHYPFVTNDDIEWMLSICVEWRLPEIAKEIYTTLGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords Nucleoporin SEH1
publication title A fence-like coat for the nuclear pore membrane.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 155
structure length 475
sequence length 498
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 2008-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.500 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3f3fC01
3F3FC 3F3PC
chains in the Genus database with same CATH superfamily
3VTNA 1YJW1 3CCR1 4A93I 4BBRI 2KPIA 4RV9A 1X3WA 2W04A 4HH4A 2GTIA 2RPRA 2G2KA 1VQNZ 1TWGI 1S72Z 3G4SZ 3CCUZ 2NVTI 2NVXI 3I4NI 1QVFZ 3M4OI 1Q821 5FLXf 1VQP1 4S1TA 5IP9I 1QYPA 2IV2X 1N8R1 5C3EI 5T6BA 4MRIA 4EWCA 2AKLA 1RO0A 4NOZA 3T4NB 3CCEZ 3CCMZ 3OW2Y 5FLXb 1VQKZ 1VQ7Z 2DE5A 2WB1A 3CPWY 4NBBA 3I561 2DE6A 1I6HI 3CC2Z 4X6AI 4A3KI 2LFUA 2R7ZI 2J6AA 3OW2Z 4E2ZA 1RNIA 3CPWZ 1X3ZA 4NBEA 1VQOZ 1M901 3IF8A 3GKQA 1Q862 1QVGY 4AYBA 2O4HA 2W03A 4E2YA 3S16I 1YITZ 1QF8A 3KIHA 4HGYA 3CC71 3CCVZ 1Y1VI 3K7AI 1Q7Y1 3CCLZ 3I551 2WAQA 3J80b 3CCSZ 3NDJA 2F4MA 1VQLZ 1Q811 2QLVB 2O53A 2DE7A 5IT9f 2YU9I 1YI2Z 2V45A 5C4XI 3NH8A 4Y7NI 2HU9A 1YHQZ 4E32A 1RO4A 5T67A 3S17I 2LEXA 4E2WA 2VPWA 3EEDA 1YUKA 1WW9A 4NH1C 3VMHA 2JNYA 3CME1 5D1PA 3TE5B 4RVFA 2RBLA 1VQ9Z 3G4S1 4MD8A 1K732 3CCU1 1Y1WI 2PK7A 3S1MI 3MONA 3HOWI 4BXXI 4A3JI 2OTLZ 5AN9F 4XX2A 5CM2M 2IZ4A 3I4MI 3GTLI 3CCE1 1JWHC 1KRLA 3CCM1 2QKDA 4NBAA 4CL1A 1Y1VS 2ZAEB 1YUAA 1M1K1 3F3FC 4A3CI 3S1NI 1KC81 1W2BY 2R6MA 1K8A2 4A3DI 1VQM1 1VQ81 2JIMA 5D1OB 1KD11 3IFUA 1WIIA 2QEX1 3FQMA 2QREB 1W2BZ 1YIT1 4NBFA 5T64A 1QVFY 3QWUA 3H3VJ 3GTPI 2M6NA 1VQ4Z 4DK1A 4A3BI 1P9NA 2IZ3A 3G71Z 4NFRA 1YJNZ 3CCJZ 3G6EZ 4A3EI 1DL6A 1FDOA 1NP6A 2QRCB 3GCFA 3S2DI 1VQ51 1K9M1 3CCQ1 1I3QI 2Y0SA 4BY7I 1PFTA 3EERA 2JA6I 3D6WA 3KIFA 1TWHI 3S1QI 1Z02A 2JA8I 3GTOI 4MD9A 3I07A 1X0TA 3J80f 4RVGA 3CC4Z 1QXFA 2NVYI 4NBDA 4NBHA 4Y52I 1Q16A 1NJI1 4A3LI 2QA41 3ESWA 3D9XA 1WZNA 3HOUI 2V8JA 2JIRA 2OTJ1 1YJWZ 1Z03A 3HOXI 3CCRZ 1YJ9Z 1YIJ1 2VF1A 2P28A 4NBGA 3RZDI 1R9TI 2AYDA 1Q822 3GTKI 1NUIA 1N8R2 3TDHB 1VQ41 2NVQI 1VQN1 3S2HI 2Q4ZA 2H85A 1S721 2GTHA 3G711 4MD7A 4E31A 1YJN1 1RQFA 2V3VA 4HGZA 2K5RA 3NDIA 2F4OA 3G6E1 2E2JI 1L1OC 2V8KA 3VMGA 5IP7I 3GTMI 1FDIA 2I3CA 2BJOA 2JIPA 3S14I 3LUSA 1VQK1 1M902 1VQ71 1RLYA 3MZKB 1TFIA 5D1OA 3CC21 5A2Qf 4BBSI 4A3II 1USPA 2HF1A 3FKII 4MH4A 3IR7A 3PO2I 1Q7Y2 3CD6Z 3PO3I 3J7A4 1VQO1 4TNUA 4NB8A 2YADA 3CMAZ 2V8IA 1USPB 2QR1B 5A2Qb 2E2HI 1Q812 3CC7Z 3CC41 3HOVI 2OOXB 1VQ6Z 3VB9A 1Q861 2VPZA 3I55Z 3CCV1 1JJ2Y 4DQYB 4A3FI 2B63I 2JS4A 2RIQA 3CCL1 1TWAI 3CCS1 2LIYA 1VQL1 4QTUA 3HKZA 2JIQA 1YI21 1JJ2Z 1WCMI 3NH5A 2KI7B 2PMZA 1YJ91 4A3MI 1YHQ1 3GTJI 3GTMS 2P3YA 2VUGA 4MONA 3D2LA 4E30A 4BY1I 3CMEZ 3CXCY 2JA5I 3GTGI 3F3PC 1VQ91 3CQZI 3CXCZ 1M1K2 3PO3S 1TWFI 4RVDA 2OTL1 2E2II 1K731 1KC82 3MZLB 3GTQI 1AA6A 1KQSY 1KD12 2JIOA 3J81f 3S15I 1TWCI 3BG1B 2OOYB 5LL6f 1VQMZ 2VPYA 1VQ8Z 3J81b 1KQSZ 3P5JB 1ZB9A 2QEXZ 3CD61 2JR6A 2OZKA 3CMA1 1K8A1 5FLMI 5C44I 4A3GI 3BG0B 1VQ61 1QVGZ 2M48A 4E33A 3HOYI 3RZOI 2E9HA 4DGLA 2RHBA 2RT9A 2PM9A 3S1RI 3NFZA 4RVHA 1VQPZ 3U50C 1LQLA 3H0GI 2EGTA 1K9M2 4NB9A 2E7ZA 1ZB8A 3CCJ1 2JA7I 5IT9b 3FQQA 1ML8A 3JAMf 2GU2A 1VQ5Z 3CCQZ 3I56Z 1S7MA 4NBCA 1SFOI 2K3RA 4MXUA 3JAMb 4QTTA 3HOZI 2NAPA 5C4JI 1N2FA 1VLAA 1SIWA 3Q87A 4E2XA 2VUMI 1I50I 1RO2A 1NJI2 2R92I 3NH4A 1Y8CA 2JUBA 1ZH1A 2QRDB 1Z01A 4RS4A 2R93I 2QA4Z 3M3YI 1WJ2A 2OTJZ 2Q51A 2JMOA 3VMIA 1K83I 3IX0A 1YIJZ 2VPXA
chains in the Genus database with same CATH topology
3VTNA 1YJW1 3CCR1 4A93I 4BBRI 2KPIA 4RV9A 1X3WA 2W04A 4HH4A 2GTIA 2RPRA 2G2KA 1VQNZ 1TWGI 1S72Z 3G4SZ 3CCUZ 2NVTI 2NVXI 3I4NI 1QVFZ 3M4OI 1Q821 5FLXf 1VQP1 4S1TA 5IP9I 1QYPA 1N8R1 5C3EI 5T6BA 4MRIA 4EWCA 2AKLA 1RO0A 4NOZA 3T4NB 3CCEZ 3CCMZ 3OW2Y 5FLXb 1VQKZ 1VQ7Z 2DE5A 2WB1A 3CPWY 4NBBA 3I561 2DE6A 1I6HI 3CC2Z 4X6AI 4A3KI 2LFUA 2R7ZI 2J6AA 3OW2Z 4E2ZA 1RNIA 3CPWZ 1X3ZA 4NBEA 1VQOZ 1M901 3IF8A 3GKQA 1Q862 1QVGY 4AYBA 2O4HA 2W03A 4E2YA 3S16I 1YITZ 1QF8A 3KIHA 4HGYA 3CC71 3CCVZ 1Y1VI 3K7AI 1Q7Y1 3CCLZ 3I551 2WAQA 3J80b 3CCSZ 3NDJA 2F4MA 1VQLZ 1Q811 2QLVB 2O53A 2DE7A 5IT9f 2YU9I 1YI2Z 5C4XI 3NH8A 4Y7NI 2HU9A 1YHQZ 4E32A 1RO4A 5T67A 3S17I 4E2WA 3EEDA 1YUKA 1WW9A 4NH1C 3VMHA 2JNYA 3CME1 5D1PA 3TE5B 4RVFA 2RBLA 1VQ9Z 3G4S1 4MD8A 1K732 3CCU1 1Y1WI 2PK7A 3S1MI 3MONA 3HOWI 4BXXI 4A3JI 2OTLZ 5AN9F 4XX2A 5CM2M 2IZ4A 3I4MI 3GTLI 3CCE1 1JWHC 1KRLA 3CCM1 2QKDA 4NBAA 4CL1A 1Y1VS 2ZAEB 1YUAA 1M1K1 3F3FC 4A3CI 3S1NI 1KC81 1W2BY 2R6MA 1K8A2 4A3DI 1VQM1 1VQ81 5D1OB 1KD11 3IFUA 1WIIA 2QEX1 3FQMA 2QREB 1W2BZ 1YIT1 4NBFA 5T64A 1QVFY 3QWUA 3H3VJ 3GTPI 2M6NA 1VQ4Z 4DK1A 4A3BI 1P9NA 2IZ3A 3G71Z 4NFRA 1YJNZ 3CCJZ 3G6EZ 4A3EI 1DL6A 1NP6A 2QRCB 3GCFA 3S2DI 1VQ51 1K9M1 3CCQ1 1I3QI 2Y0SA 4BY7I 1PFTA 3EERA 2JA6I 3D6WA 3KIFA 1TWHI 3S1QI 1Z02A 2JA8I 3GTOI 4MD9A 3I07A 1X0TA 3J80f 4RVGA 3CC4Z 2NVYI 4NBDA 4NBHA 4Y52I 1NJI1 4A3LI 2QA41 3ESWA 3D9XA 3HOUI 2V8JA 2OTJ1 1YJWZ 1Z03A 3HOXI 3CCRZ 1YJ9Z 1YIJ1 2VF1A 2P28A 4NBGA 3RZDI 1R9TI 1Q822 3GTKI 1NUIA 1N8R2 3TDHB 1VQ41 2NVQI 1VQN1 3S2HI 2Q4ZA 2H85A 1S721 2GTHA 3G711 4MD7A 4E31A 1YJN1 1RQFA 4HGZA 2K5RA 3NDIA 2F4OA 3G6E1 2E2JI 1L1OC 2V8KA 3VMGA 5IP7I 3GTMI 2I3CA 2BJOA 3S14I 3LUSA 1VQK1 1M902 1VQ71 1RLYA 3MZKB 1TFIA 5D1OA 3CC21 5A2Qf 4BBSI 4A3II 1USPA 2HF1A 3FKII 4MH4A 3PO2I 1Q7Y2 3CD6Z 3PO3I 3J7A4 1VQO1 4TNUA 4NB8A 2YADA 3CMAZ 2V8IA 1USPB 2QR1B 5A2Qb 2E2HI 1Q812 3CC7Z 3CC41 3HOVI 2OOXB 1VQ6Z 3VB9A 1Q861 3I55Z 3CCV1 1JJ2Y 4DQYB 4A3FI 2B63I 2JS4A 2RIQA 3CCL1 1TWAI 3CCS1 2LIYA 1VQL1 4QTUA 3HKZA 1YI21 1JJ2Z 1WCMI 3NH5A 2KI7B 2PMZA 1YJ91 4A3MI 1YHQ1 3GTJI 3GTMS 2P3YA 2VUGA 4MONA 4E30A 4BY1I 3CMEZ 3CXCY 2JA5I 3GTGI 3F3PC 1VQ91 3CQZI 3CXCZ 1M1K2 3PO3S 1TWFI 4RVDA 2OTL1 2E2II 1K731 1KC82 3MZLB 3GTQI 1KQSY 1KD12 3J81f 3S15I 1TWCI 3BG1B 2OOYB 5LL6f 1VQMZ 1VQ8Z 3J81b 1KQSZ 3P5JB 1ZB9A 2QEXZ 3CD61 2JR6A 2OZKA 3CMA1 1K8A1 5FLMI 5C44I 4A3GI 3BG0B 1VQ61 1QVGZ 2M48A 4E33A 3HOYI 3RZOI 2E9HA 4DGLA 2RHBA 2RT9A 2PM9A 3S1RI 3NFZA 4RVHA 1VQPZ 3U50C 1LQLA 3H0GI 2EGTA 1K9M2 4NB9A 3CCJ1 1ZB8A 2JA7I 5IT9b 3FQQA 1ML8A 3JAMf 2GU2A 1VQ5Z 3CCQZ 3I56Z 1S7MA 4NBCA 1SFOI 2K3RA 4MXUA 3JAMb 4QTTA 3HOZI 5C4JI 1N2FA 1VLAA 4E2XA 3Q87A 2VUMI 1I50I 1RO2A 1NJI2 2R92I 3NH4A 2JUBA 1ZH1A 2QRDB 1Z01A 4RS4A 2R93I 2QA4Z 3M3YI 2OTJZ 2Q51A 2JMOA 3VMIA 1K83I 3IX0A 1YIJZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F3F C;  3F3P C; 
#chains in the Genus database with same CATH topology
 3VTN A;  1YJW 1;  3CCR 1;  4A93 I;  4BBR I;  2KPI A;  4RV9 A;  1X3W A;  2W04 A;  4HH4 A;  2GTI A;  2RPR A;  2G2K A;  1VQN Z;  1TWG I;  1S72 Z;  3G4S Z;  3CCU Z;  2NVT I;  2NVX I;  3I4N I;  1QVF Z;  3M4O I;  1Q82 1;  5FLX f;  1VQP 1;  4S1T A;  5IP9 I;  1QYP A;  2IV2 X;  1N8R 1;  5C3E I;  5T6B A;  4MRI A;  4EWC A;  2AKL A;  1RO0 A;  4NOZ A;  3T4N B;  3CCE Z;  3CCM Z;  3OW2 Y;  5FLX b;  1VQK Z;  1VQ7 Z;  2DE5 A;  2WB1 A;  3CPW Y;  4NBB A;  3I56 1;  2DE6 A;  1I6H I;  3CC2 Z;  4X6A I;  4A3K I;  2LFU A;  2R7Z I;  2J6A A;  3OW2 Z;  4E2Z A;  1RNI A;  3CPW Z;  1X3Z A;  4NBE A;  1VQO Z;  1M90 1;  3IF8 A;  3GKQ A;  1Q86 2;  1QVG Y;  4AYB A;  2O4H A;  2W03 A;  4E2Y A;  3S16 I;  1YIT Z;  1QF8 A;  3KIH A;  4HGY A;  3CC7 1;  3CCV Z;  1Y1V I;  3K7A I;  1Q7Y 1;  3CCL Z;  3I55 1;  2WAQ A;  3J80 b;  3CCS Z;  3NDJ A;  2F4M A;  1VQL Z;  1Q81 1;  2QLV B;  2O53 A;  2DE7 A;  5IT9 f;  2YU9 I;  1YI2 Z;  2V45 A;  5C4X I;  3NH8 A;  4Y7N I;  2HU9 A;  1YHQ Z;  4E32 A;  1RO4 A;  5T67 A;  3S17 I;  2LEX A;  4E2W A;  2VPW A;  3EED A;  1YUK A;  1WW9 A;  4NH1 C;  3VMH A;  2JNY A;  3CME 1;  5D1P A;  3TE5 B;  4RVF A;  2RBL A;  1VQ9 Z;  3G4S 1;  4MD8 A;  1K73 2;  3CCU 1;  1Y1W I;  2PK7 A;  3S1M I;  3MON A;  3HOW I;  4BXX I;  4A3J I;  2OTL Z;  5AN9 F;  4XX2 A;  5CM2 M;  2IZ4 A;  3I4M I;  3GTL I;  3CCE 1;  1JWH C;  1KRL A;  3CCM 1;  2QKD A;  4NBA A;  4CL1 A;  1Y1V S;  2ZAE B;  1YUA A;  1M1K 1;  3F3F C;  4A3C I;  3S1N I;  1KC8 1;  1W2B Y;  2R6M A;  1K8A 2;  4A3D I;  1VQM 1;  1VQ8 1;  2JIM A;  5D1O B;  1KD1 1;  3IFU A;  1WII A;  2QEX 1;  3FQM A;  2QRE B;  1W2B Z;  1YIT 1;  4NBF A;  5T64 A;  1QVF Y;  3QWU A;  3H3V J;  3GTP I;  2M6N A;  1VQ4 Z;  4DK1 A;  4A3B I;  1P9N A;  2IZ3 A;  3G71 Z;  4NFR A;  1YJN Z;  3CCJ Z;  3G6E Z;  4A3E I;  1DL6 A;  1FDO A;  1NP6 A;  2QRC B;  3GCF A;  3S2D I;  1VQ5 1;  1K9M 1;  3CCQ 1;  1I3Q I;  2Y0S A;  4BY7 I;  1PFT A;  3EER A;  2JA6 I;  3D6W A;  3KIF A;  1TWH I;  3S1Q I;  1Z02 A;  2JA8 I;  3GTO I;  4MD9 A;  3I07 A;  1X0T A;  3J80 f;  4RVG A;  3CC4 Z;  1QXF A;  2NVY I;  4NBD A;  4NBH A;  4Y52 I;  1Q16 A;  1NJI 1;  4A3L I;  2QA4 1;  3ESW A;  3D9X A;  1WZN A;  3HOU I;  2V8J A;  2JIR A;  2OTJ 1;  1YJW Z;  1Z03 A;  3HOX I;  3CCR Z;  1YJ9 Z;  1YIJ 1;  2VF1 A;  2P28 A;  4NBG A;  3RZD I;  1R9T I;  2AYD A;  1Q82 2;  3GTK I;  1NUI A;  1N8R 2;  3TDH B;  1VQ4 1;  2NVQ I;  1VQN 1;  3S2H I;  2Q4Z A;  2H85 A;  1S72 1;  2GTH A;  3G71 1;  4MD7 A;  4E31 A;  1YJN 1;  1RQF A;  2V3V A;  4HGZ A;  2K5R A;  3NDI A;  2F4O A;  3G6E 1;  2E2J I;  1L1O C;  2V8K A;  3VMG A;  5IP7 I;  3GTM I;  1FDI A;  2I3C A;  2BJO A;  2JIP A;  3S14 I;  3LUS A;  1VQK 1;  1M90 2;  1VQ7 1;  1RLY A;  3MZK B;  1TFI A;  5D1O A;  3CC2 1;  5A2Q f;  4BBS I;  4A3I I;  1USP A;  2HF1 A;  3FKI I;  4MH4 A;  3IR7 A;  3PO2 I;  1Q7Y 2;  3CD6 Z;  3PO3 I;  3J7A 4;  1VQO 1;  4TNU A;  4NB8 A;  2YAD A;  3CMA Z;  2V8I A;  1USP B;  2QR1 B;  5A2Q b;  2E2H I;  1Q81 2;  3CC7 Z;  3CC4 1;  3HOV I;  2OOX B;  1VQ6 Z;  3VB9 A;  1Q86 1;  2VPZ A;  3I55 Z;  3CCV 1;  1JJ2 Y;  4DQY B;  4A3F I;  2B63 I;  2JS4 A;  2RIQ A;  3CCL 1;  1TWA I;  3CCS 1;  2LIY A;  1VQL 1;  4QTU A;  3HKZ A;  2JIQ A;  1YI2 1;  1JJ2 Z;  1WCM I;  3NH5 A;  2KI7 B;  2PMZ A;  1YJ9 1;  4A3M I;  1YHQ 1;  3GTJ I;  3GTM S;  2P3Y A;  2VUG A;  4MON A;  3D2L A;  4E30 A;  4BY1 I;  3CME Z;  3CXC Y;  2JA5 I;  3GTG I;  3F3P C;  1VQ9 1;  3CQZ I;  3CXC Z;  1M1K 2;  3PO3 S;  1TWF I;  4RVD A;  2OTL 1;  2E2I I;  1K73 1;  1KC8 2;  3MZL B;  3GTQ I;  1AA6 A;  1KQS Y;  1KD1 2;  2JIO A;  3J81 f;  3S15 I;  1TWC I;  3BG1 B;  2OOY B;  5LL6 f;  1VQM Z;  2VPY A;  1VQ8 Z;  3J81 b;  1KQS Z;  3P5J B;  1ZB9 A;  2QEX Z;  3CD6 1;  2JR6 A;  2OZK A;  3CMA 1;  1K8A 1;  5FLM I;  5C44 I;  4A3G I;  3BG0 B;  1VQ6 1;  1QVG Z;  2M48 A;  4E33 A;  3HOY I;  3RZO I;  2E9H A;  4DGL A;  2RHB A;  2RT9 A;  2PM9 A;  3S1R I;  3NFZ A;  4RVH A;  1VQP Z;  3U50 C;  1LQL A;  3H0G I;  2EGT A;  1K9M 2;  4NB9 A;  2E7Z A;  1ZB8 A;  3CCJ 1;  2JA7 I;  5IT9 b;  3FQQ A;  1ML8 A;  3JAM f;  2GU2 A;  1VQ5 Z;  3CCQ Z;  3I56 Z;  1S7M A;  4NBC A;  1SFO I;  2K3R A;  4MXU A;  3JAM b;  4QTT A;  3HOZ I;  2NAP A;  5C4J I;  1N2F A;  1VLA A;  1SIW A;  3Q87 A;  4E2X A;  2VUM I;  1I50 I;  1RO2 A;  1NJI 2;  2R92 I;  3NH4 A;  1Y8C A;  2JUB A;  1ZH1 A;  2QRD B;  1Z01 A;  4RS4 A;  2R93 I;  2QA4 Z;  3M3Y I;  1WJ2 A;  2OTJ Z;  2Q51 A;  2JMO A;  3VMI A;  1K83 I;  3IX0 A;  1YIJ Z;  2VPX A; 
#chains in the Genus database with same CATH homology
 3VTN A;  1YJW 1;  3CCR 1;  4A93 I;  4BBR I;  2KPI A;  4RV9 A;  1X3W A;  2W04 A;  4HH4 A;  2GTI A;  2RPR A;  2G2K A;  1VQN Z;  1TWG I;  1S72 Z;  3G4S Z;  3CCU Z;  2NVT I;  2NVX I;  3I4N I;  1QVF Z;  3M4O I;  1Q82 1;  5FLX f;  1VQP 1;  4S1T A;  5IP9 I;  1QYP A;  1N8R 1;  5C3E I;  5T6B A;  4MRI A;  4EWC A;  2AKL A;  1RO0 A;  4NOZ A;  3T4N B;  3CCE Z;  3CCM Z;  3OW2 Y;  5FLX b;  1VQK Z;  1VQ7 Z;  2DE5 A;  2WB1 A;  3CPW Y;  4NBB A;  3I56 1;  2DE6 A;  1I6H I;  3CC2 Z;  4X6A I;  4A3K I;  2LFU A;  2R7Z I;  2J6A A;  3OW2 Z;  4E2Z A;  1RNI A;  3CPW Z;  1X3Z A;  4NBE A;  1VQO Z;  1M90 1;  3IF8 A;  3GKQ A;  1Q86 2;  1QVG Y;  4AYB A;  2O4H A;  2W03 A;  4E2Y A;  3S16 I;  1YIT Z;  1QF8 A;  3KIH A;  4HGY A;  3CC7 1;  3CCV Z;  1Y1V I;  3K7A I;  1Q7Y 1;  3CCL Z;  3I55 1;  2WAQ A;  3J80 b;  3CCS Z;  3NDJ A;  2F4M A;  1VQL Z;  1Q81 1;  2QLV B;  2O53 A;  2DE7 A;  5IT9 f;  2YU9 I;  1YI2 Z;  5C4X I;  3NH8 A;  4Y7N I;  2HU9 A;  1YHQ Z;  4E32 A;  1RO4 A;  5T67 A;  3S17 I;  4E2W A;  3EED A;  1YUK A;  1WW9 A;  4NH1 C;  3VMH A;  2JNY A;  3CME 1;  5D1P A;  3TE5 B;  4RVF A;  2RBL A;  1VQ9 Z;  3G4S 1;  4MD8 A;  1K73 2;  3CCU 1;  1Y1W I;  2PK7 A;  3S1M I;  3MON A;  3HOW I;  4BXX I;  4A3J I;  2OTL Z;  5AN9 F;  4XX2 A;  5CM2 M;  2IZ4 A;  3I4M I;  3GTL I;  3CCE 1;  1JWH C;  1KRL A;  3CCM 1;  2QKD A;  4NBA A;  4CL1 A;  1Y1V S;  2ZAE B;  1YUA A;  1M1K 1;  3F3F C;  4A3C I;  3S1N I;  1KC8 1;  1W2B Y;  2R6M A;  1K8A 2;  4A3D I;  1VQM 1;  1VQ8 1;  5D1O B;  1KD1 1;  3IFU A;  1WII A;  2QEX 1;  3FQM A;  2QRE B;  1W2B Z;  1YIT 1;  4NBF A;  5T64 A;  1QVF Y;  3QWU A;  3H3V J;  3GTP I;  2M6N A;  1VQ4 Z;  4DK1 A;  4A3B I;  1P9N A;  2IZ3 A;  3G71 Z;  4NFR A;  1YJN Z;  3CCJ Z;  3G6E Z;  4A3E I;  1DL6 A;  1NP6 A;  2QRC B;  3GCF A;  3S2D I;  1VQ5 1;  1K9M 1;  3CCQ 1;  1I3Q I;  2Y0S A;  4BY7 I;  1PFT A;  3EER A;  2JA6 I;  3D6W A;  3KIF A;  1TWH I;  3S1Q I;  1Z02 A;  2JA8 I;  3GTO I;  4MD9 A;  3I07 A;  1X0T A;  3J80 f;  4RVG A;  3CC4 Z;  2NVY I;  4NBD A;  4NBH A;  4Y52 I;  1NJI 1;  4A3L I;  2QA4 1;  3ESW A;  3D9X A;  3HOU I;  2V8J A;  2OTJ 1;  1YJW Z;  1Z03 A;  3HOX I;  3CCR Z;  1YJ9 Z;  1YIJ 1;  2VF1 A;  2P28 A;  4NBG A;  3RZD I;  1R9T I;  1Q82 2;  3GTK I;  1NUI A;  1N8R 2;  3TDH B;  1VQ4 1;  2NVQ I;  1VQN 1;  3S2H I;  2Q4Z A;  2H85 A;  1S72 1;  2GTH A;  3G71 1;  4MD7 A;  4E31 A;  1YJN 1;  1RQF A;  4HGZ A;  2K5R A;  3NDI A;  2F4O A;  3G6E 1;  2E2J I;  1L1O C;  2V8K A;  3VMG A;  5IP7 I;  3GTM I;  2I3C A;  2BJO A;  3S14 I;  3LUS A;  1VQK 1;  1M90 2;  1VQ7 1;  1RLY A;  3MZK B;  1TFI A;  5D1O A;  3CC2 1;  5A2Q f;  4BBS I;  4A3I I;  1USP A;  2HF1 A;  3FKI I;  4MH4 A;  3PO2 I;  1Q7Y 2;  3CD6 Z;  3PO3 I;  3J7A 4;  1VQO 1;  4TNU A;  4NB8 A;  2YAD A;  3CMA Z;  2V8I A;  1USP B;  2QR1 B;  5A2Q b;  2E2H I;  1Q81 2;  3CC7 Z;  3CC4 1;  3HOV I;  2OOX B;  1VQ6 Z;  3VB9 A;  1Q86 1;  3I55 Z;  3CCV 1;  1JJ2 Y;  4DQY B;  4A3F I;  2B63 I;  2JS4 A;  2RIQ A;  3CCL 1;  1TWA I;  3CCS 1;  2LIY A;  1VQL 1;  4QTU A;  3HKZ A;  1YI2 1;  1JJ2 Z;  1WCM I;  3NH5 A;  2KI7 B;  2PMZ A;  1YJ9 1;  4A3M I;  1YHQ 1;  3GTJ I;  3GTM S;  2P3Y A;  2VUG A;  4MON A;  4E30 A;  4BY1 I;  3CME Z;  3CXC Y;  2JA5 I;  3GTG I;  3F3P C;  1VQ9 1;  3CQZ I;  3CXC Z;  1M1K 2;  3PO3 S;  1TWF I;  4RVD A;  2OTL 1;  2E2I I;  1K73 1;  1KC8 2;  3MZL B;  3GTQ I;  1KQS Y;  1KD1 2;  3J81 f;  3S15 I;  1TWC I;  3BG1 B;  2OOY B;  5LL6 f;  1VQM Z;  1VQ8 Z;  3J81 b;  1KQS Z;  3P5J B;  1ZB9 A;  2QEX Z;  3CD6 1;  2JR6 A;  2OZK A;  3CMA 1;  1K8A 1;  5FLM I;  5C44 I;  4A3G I;  3BG0 B;  1VQ6 1;  1QVG Z;  2M48 A;  4E33 A;  3HOY I;  3RZO I;  2E9H A;  4DGL A;  2RHB A;  2RT9 A;  2PM9 A;  3S1R I;  3NFZ A;  4RVH A;  1VQP Z;  3U50 C;  1LQL A;  3H0G I;  2EGT A;  1K9M 2;  4NB9 A;  3CCJ 1;  1ZB8 A;  2JA7 I;  5IT9 b;  3FQQ A;  1ML8 A;  3JAM f;  2GU2 A;  1VQ5 Z;  3CCQ Z;  3I56 Z;  1S7M A;  4NBC A;  1SFO I;  2K3R A;  4MXU A;  3JAM b;  4QTT A;  3HOZ I;  5C4J I;  1N2F A;  1VLA A;  4E2X A;  3Q87 A;  2VUM I;  1I50 I;  1RO2 A;  1NJI 2;  2R92 I;  3NH4 A;  2JUB A;  1ZH1 A;  2QRD B;  1Z01 A;  4RS4 A;  2R93 I;  2QA4 Z;  3M3Y I;  2OTJ Z;  2Q51 A;  2JMO A;  3VMI A;  1K83 I;  3IX0 A;  1YIJ Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...