1I6HI

Rna polymerase ii elongation complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(P*AP*AP*AP*TP*GP*CP*CP*TP*GP*GP*TP*CP*T)-3'
publication title Structural basis of transcription: an RNA polymerase II elongation complex at 3.3 A resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna-rna hybrid
total genus 9
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2001-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1i6hI02
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1i6hI01
2JA6I 3S1QI 3I4MI 4A3KI 4X6AI 3H0GI 3H3VJ 5IP9I 3EERA 3GCFA 2JA7I 1Y1VI 4Y52I 1L1OC 3GKQA 4QTTA 4A3GI 2RBLA 3VMGA 2DE6A 2JA8I 3GTKI 3GTQI 4A3BI 1R9TI 2BJOA 2JS4A 3K7AI 4NBFA 3RZOI 3HOUI 4Y7NI 3VMHA 3U50C 3M3YI 4NBBA 2NVYI 3S16I 3HOWI 1TWAI 5C4XI 3HOYI 2AKLA 4A3II 1USPB 1Y1VS 3S1MI 4XX2A 1I6HI 3PO3I 3LUSA 5FLMI 3GTOI 4NBAA 4BY1I 3S14I 3S2HI 4A3MI 5C3EI 4A3CI 1RLYA 2B63I 3I4NI 3VB9A 5C4JI 3ESWA 3S1RI 1TFIA 4A3DI 3S2DI 1ZB8A 4BY7I 4A3LI 3S1NI 2KPIA 3PO3S 1N2FA 2NVQI 4NB8A 4NBEA 3PO2I 3CQZI 3GTGI 2R7ZI 4NBGA 1QYPA 2P3YA 4BBSI 1I50I 5C44I 1NUIA 1I3QI 1RO4A 2VUMI 3GTJI 1YUAA 4A93I 2E2HI 4NBCA 2F4MA 2E2II 5IP7I 3D6WA 3FKII 1WCMI 1ML8A 2YU9I 1ZB9A 1TWCI 4A3EI 3RZDI 1PFTA 3HOVI 1VLAA 5CM2M 4NB9A 4BBRI 2DE7A 1USPA 2F4OA 3VMIA 4A3JI 1TWHI 1TWFI 3GTPI 3GTMI 2HF1A 4QTUA 2R93I 2JNYA 3I07A 2E2JI 1X3WA 2DE5A 4NBDA 1LQLA 1K83I 4NOZA 1Y1WI 3M4OI 2PK7A 2R92I 2K5RA 4NBHA 4MH4A 1DL6A 1SFOI 2J6AA 2JA5I 3GTLI 2JR6A 1TWGI 3S15I 3GTMS 2NVXI 3S17I 4BXXI 1WW9A 1X3ZA 3Q87A 3HOXI 4A3FI 3HOZI 2NVTI
chains in the Genus database with same CATH superfamily
1YHQZ 3I4MI 4X6AI 3H0GI 5IP9I 3CCUZ 3CCV1 2Q4ZA 3EERA 1QVFZ 1VQKZ 3GKQA 3TE5B 2RBLA 3VMGA 3I561 3CCS1 4A3BI 4RVDA 3U50C 4NBBA 5D1PA 1K9M1 3CCEZ 3NH4A 1VQ7Z 4XX2A 1S72Z 3CCQZ 3PO3I 3G71Z 3G4S1 1K8A2 5AN9F 1VQP1 2ZAEB 1VQNZ 3NDIA 3KIHA 3VB9A 2WB1A 3IR7A 3S2DI 1YUKA 4RV9A 2OOXB 1VQM1 1YIJZ 3PO3S 4RVFA 4NB8A 3CCJZ 1WJ2A 1VQ61 1I50I 2JIQA 1K732 3CCSZ 2QR1B 2VPXA 1RO4A 3CCM1 3CCL1 4NBCA 3D6WA 1WCMI 2OTL1 2YU9I 1TWCI 5LL6f 2M48A 3BG1B 3HOVI 4E30A 2P28A 4NB9A 2DE7A 1USPA 2F4OA 4A3JI 1K9M2 4MD9A 1VQPZ 1KQSY 1YJ9Z 5T64A 1M902 3GTMI 1Q811 5IT9b 2Y0SA 4QTUA 1YI2Z 3TDHB 2OTJ1 4E31A 3IF8A 1X3WA 1RQFA 1VQ81 2RHBA 5A2Qf 1LQLA 4S1TA 2QREB 3F3PC 1VQK1 2JIMA 4NH1C 2R92I 3JAMb 1FDIA 1JJ2Y 2J6AA 3GTMS 3S17I 3HOXI 2HU9A 2JA6I 3CMEZ 2V8JA 3S1QI 3H3VJ 2JA7I 3CCE1 4A3GI 2PM9A 1S721 3CXCY 3G711 2JIOA 2OOYB 1N8R1 1R9TI 3J7A4 4E2YA 1VQN1 3RZOI 2H85A 2VPZA 3OW2Z 2QRCB 2LEXA 2W04A 4MXUA 5C4XI 2JIPA 3CPWZ 3HOYI 1VQ4Z 4A3II 1USPB 1YIJ1 2OTJZ 2Q51A 2IZ3A 3FQMA 1NJI1 1Q812 2E9HA 1VQ8Z 5FLMI 3GTOI 4NBAA 3S14I 3S2HI 2JUBA 3CC71 4A3MI 3CCJ1 4A3CI 2AYDA 2B63I 2RIQA 5C4JI 3ESWA 3S1RI 1X0TA 3MONA 4A3DI 2GU2A 1KC82 3BG0B 1VQOZ 5D1OA 1Q861 2E7ZA 2KPIA 1QVGZ 5FLXf 3CQZI 3GTGI 1QYPA 1AA6A 3EEDA 3D9XA 1YITZ 4E2WA 3KIFA 3J80b 1YJ91 1YUAA 3F3FC 2E2HI 2VPYA 5IP7I 1P9NA 1N8R2 1YI21 2V45A 1Q7Y1 4A3EI 4MD8A 1PFTA 4DGLA 1QF8A 1VLAA 4DQYB 3VMIA 1VQ5Z 1VQ9Z 1KD11 4CL1A 1TWFI 2RPRA 3CC7Z 2W03A 1Q821 1WZNA 3P5JB 1NJI2 3IX0A 1SIWA 2JNYA 3I07A 3CD61 1W2BZ 2DE5A 2K3RA 2VUGA 3CME1 1QVFY 4NBDA 3NH5A 1NP6A 3JAMf 2K5RA 2GTIA 4E2ZA 1DL6A 2V3VA 1Q862 1YJWZ 1SFOI 3I551 1TWGI 3S15I 4BXXI 1X3ZA 4AYBA 1ZH1A 2VF1A 3CMAZ 2QLVB 3GCFA 1VQ41 4E33A 3G6EZ 1Y1VI 1FDOA 4Y52I 3QWUA 2WAQA 2JA8I 3CC2Z 4E2XA 3K7AI 3HOUI 4Y7NI 3IFUA 3CCRZ 3M3YI 2NVYI 3MZKB 3HOWI 2M6NA 1VQO1 2AKLA 1Q16A 1Y1VS 3S1MI 3CD6Z 1I6HI 2QKDA 4MONA 4BY1I 5C3EI 3CC4Z 2PMZA 3VTNA 3I4NI 1YIT1 3I55Z 1ZB8A 4BY7I 1YJNZ 3T4NB 4RS4A 1N2FA 1Z03A 4NBEA 2JIRA 2QRDB 2QEXZ 3PO2I 3FQQA 4EWCA 2IZ4A 1WIIA 5C44I 4HGYA 4NFRA 3J81b 1VQ91 1VQ51 3J80f 2VUMI 2F4MA 2E2II 3FKII 3HKZA 1ML8A 2LIYA 1Z02A 3RZDI 2IV2X 1VQLZ 2JMOA 2LFUA 4BBRI 1M1K1 1YJW1 2QA41 5T6BA 2HF1A 4MRIA 1K731 2R93I 1RO0A 2E2JI 5T67A 2RT9A 1K83I 3CMA1 1JWHC 3M4OI 2PK7A 3G6E1 4HH4A 4MH4A 2OZKA 4NBHA 2JA5I 3CC21 2NVXI 1KQSZ 2VPWA 1WW9A 3Q87A 4HGZA 2KI7B 3OW2Y 2NVTI 1M901 3NH8A 1RO2A 3CCR1 3CPWY 4A3KI 5IT9f 1L1OC 4QTTA 2DE6A 3GTKI 3GTQI 1JJ2Z 3CC41 2BJOA 2JS4A 4NBFA 3VMHA 2QA4Z 3S16I 2O53A 2V8IA 5D1OB 3CCVZ 1TWAI 5FLXb 3D2LA 1YJN1 1M1K2 1QVGY 3I56Z 3LUSA 1S7MA 4MD7A 2QEX1 2G2KA 3CXCZ 1RLYA 1Z01A 1TFIA 3MZLB 4A3LI 3S1NI 2NAPA 2YADA 1Q7Y2 3G4SZ 2NVQI 2R7ZI 4NBGA 1KD12 2P3YA 1Q822 1VQL1 4RVGA 4BBSI 4E32A 3J81f 1NUIA 1I3QI 4DK1A 1YHQ1 3GTJI 4A93I 1VQMZ 3CCU1 2EGTA 1W2BY 1KC81 1ZB9A 4RVHA 1VQ6Z 1QXFA 5CM2M 1TWHI 3CCMZ 3GTPI 3CCLZ 2I3CA 1K8A1 2GTHA 1VQ71 2OTLZ 3CCQ1 4TNUA 2R6MA 5A2Qb 4NOZA 1Y1WI 2V8KA 3NDJA 1RNIA 3GTLI 2JR6A 1Y8CA 3NFZA 4A3FI 3HOZI 2O4HA 1KRLA
chains in the Genus database with same CATH topology
1YHQZ 3I4MI 4X6AI 3H0GI 5IP9I 3CCUZ 3CCV1 2Q4ZA 3EERA 1QVFZ 1VQKZ 3GKQA 3TE5B 2RBLA 3VMGA 3I561 3CCS1 4A3BI 4RVDA 3U50C 4NBBA 5D1PA 1K9M1 3CCEZ 3NH4A 1VQ7Z 4XX2A 1S72Z 3CCQZ 3PO3I 3G71Z 3G4S1 1K8A2 5AN9F 1VQP1 2ZAEB 1VQNZ 3NDIA 3KIHA 3VB9A 2WB1A 3S2DI 1YUKA 4RV9A 2OOXB 1VQM1 1YIJZ 3PO3S 4RVFA 4NB8A 3CCJZ 1VQ61 1I50I 1K732 3CCSZ 2QR1B 1RO4A 3CCM1 3CCL1 4NBCA 3D6WA 1WCMI 2OTL1 2YU9I 1TWCI 5LL6f 2M48A 3BG1B 3HOVI 4E30A 2P28A 4NB9A 2DE7A 1USPA 2F4OA 4A3JI 1K9M2 4MD9A 1VQPZ 1KQSY 1YJ9Z 5T64A 1M902 3GTMI 1Q811 5IT9b 2Y0SA 4QTUA 1YI2Z 3TDHB 2OTJ1 4E31A 3IF8A 1X3WA 1RQFA 1VQ81 2RHBA 5A2Qf 1LQLA 4S1TA 2QREB 3F3PC 1VQK1 4NH1C 2R92I 3JAMb 1JJ2Y 2J6AA 3GTMS 3S17I 3HOXI 2HU9A 2JA6I 3CMEZ 2V8JA 3S1QI 3H3VJ 2JA7I 3CCE1 4A3GI 2PM9A 1S721 3CXCY 3G711 2OOYB 1N8R1 1R9TI 3J7A4 4E2YA 1VQN1 3RZOI 2H85A 3OW2Z 2QRCB 2W04A 4MXUA 5C4XI 3CPWZ 3HOYI 1VQ4Z 4A3II 1USPB 1YIJ1 2OTJZ 2Q51A 2IZ3A 3FQMA 1NJI1 1Q812 2E9HA 1VQ8Z 5FLMI 3GTOI 4NBAA 3S14I 3S2HI 2JUBA 3CC71 4A3MI 3CCJ1 4A3CI 2B63I 2RIQA 5C4JI 3ESWA 3S1RI 1X0TA 3MONA 4A3DI 2GU2A 1KC82 3BG0B 1VQOZ 5D1OA 1Q861 2KPIA 1QVGZ 5FLXf 3CQZI 3GTGI 1QYPA 3EEDA 3D9XA 1YITZ 4E2WA 3KIFA 3J80b 1YJ91 1YUAA 3F3FC 2E2HI 5IP7I 1P9NA 1N8R2 1YI21 1Q7Y1 4A3EI 4MD8A 1PFTA 4DGLA 1QF8A 1VLAA 4DQYB 3VMIA 1VQ5Z 1VQ9Z 1KD11 4CL1A 1TWFI 2RPRA 3CC7Z 2W03A 1Q821 3P5JB 1NJI2 3IX0A 2JNYA 3I07A 3CD61 1W2BZ 2DE5A 2K3RA 2VUGA 3CME1 1QVFY 4NBDA 3NH5A 1NP6A 3JAMf 2K5RA 2GTIA 4E2ZA 1DL6A 1Q862 1YJWZ 1SFOI 3I551 1TWGI 3S15I 4BXXI 1X3ZA 4AYBA 1ZH1A 2VF1A 3CMAZ 2QLVB 3GCFA 1VQ41 4E33A 3G6EZ 1Y1VI 4Y52I 3QWUA 2WAQA 2JA8I 3CC2Z 4E2XA 3K7AI 3HOUI 4Y7NI 3IFUA 3CCRZ 3M3YI 2NVYI 3MZKB 3HOWI 2M6NA 1VQO1 2AKLA 1Y1VS 3S1MI 3CD6Z 1I6HI 2QKDA 4MONA 4BY1I 5C3EI 3CC4Z 2PMZA 3VTNA 3I4NI 1YIT1 3I55Z 1ZB8A 4BY7I 1YJNZ 3T4NB 4RS4A 1N2FA 1Z03A 4NBEA 2QEXZ 2QRDB 3PO2I 3FQQA 4EWCA 2IZ4A 1WIIA 5C44I 4HGYA 1VQ51 1VQ91 4NFRA 3J81b 3J80f 2VUMI 2F4MA 2E2II 3FKII 3HKZA 1ML8A 2LIYA 1Z02A 3RZDI 1VQLZ 2JMOA 2LFUA 4BBRI 1M1K1 1YJW1 2QA41 5T6BA 2HF1A 4MRIA 1K731 2R93I 1RO0A 2E2JI 5T67A 2RT9A 1K83I 3CMA1 1JWHC 3M4OI 2PK7A 3G6E1 4HH4A 4MH4A 2OZKA 4NBHA 2JA5I 3CC21 2NVXI 1KQSZ 4HGZA 1WW9A 3Q87A 2KI7B 3OW2Y 2NVTI 1M901 3NH8A 1RO2A 3CCR1 3CPWY 4A3KI 5IT9f 1L1OC 4QTTA 2DE6A 3GTKI 3GTQI 1JJ2Z 3CC41 2BJOA 2JS4A 4NBFA 3VMHA 2QA4Z 3S16I 2O53A 2V8IA 5D1OB 3CCVZ 1TWAI 5FLXb 1YJN1 1M1K2 1QVGY 3I56Z 3LUSA 1S7MA 4MD7A 2QEX1 2G2KA 3CXCZ 1RLYA 1Z01A 1TFIA 3MZLB 4A3LI 3S1NI 2YADA 1Q7Y2 3G4SZ 2NVQI 2R7ZI 4NBGA 1KD12 2P3YA 1Q822 1VQL1 4RVGA 4BBSI 4E32A 3J81f 1NUIA 1I3QI 4DK1A 1YHQ1 3GTJI 4A93I 1VQMZ 3CCU1 2EGTA 1W2BY 1KC81 1ZB9A 4RVHA 1VQ6Z 5CM2M 1TWHI 3CCMZ 3GTPI 3CCLZ 2I3CA 1K8A1 2GTHA 1VQ71 2OTLZ 3CCQ1 4TNUA 2R6MA 5A2Qb 4NOZA 1Y1WI 2V8KA 3NDJA 1RNIA 3GTLI 2JR6A 3NFZA 4A3FI 3HOZI 2O4HA 1KRLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA6 I;  3S1Q I;  3I4M I;  4A3K I;  4X6A I;  3H0G I;  3H3V J;  5IP9 I;  3EER A;  3GCF A;  2JA7 I;  1Y1V I;  4Y52 I;  1L1O C;  3GKQ A;  4QTT A;  4A3G I;  2RBL A;  3VMG A;  2DE6 A;  2JA8 I;  3GTK I;  3GTQ I;  4A3B I;  1R9T I;  2BJO A;  2JS4 A;  3K7A I;  4NBF A;  3RZO I;  3HOU I;  4Y7N I;  3VMH A;  3U50 C;  3M3Y I;  4NBB A;  2NVY I;  3S16 I;  3HOW I;  1TWA I;  5C4X I;  3HOY I;  2AKL A;  4A3I I;  1USP B;  1Y1V S;  3S1M I;  4XX2 A;  1I6H I;  3PO3 I;  3LUS A;  5FLM I;  3GTO I;  4NBA A;  4BY1 I;  3S14 I;  3S2H I;  4A3M I;  5C3E I;  4A3C I;  1RLY A;  2B63 I;  3I4N I;  3VB9 A;  5C4J I;  3ESW A;  3S1R I;  1TFI A;  4A3D I;  3S2D I;  1ZB8 A;  4BY7 I;  4A3L I;  3S1N I;  2KPI A;  3PO3 S;  1N2F A;  2NVQ I;  4NB8 A;  4NBE A;  3PO2 I;  3CQZ I;  3GTG I;  2R7Z I;  4NBG A;  1QYP A;  2P3Y A;  4BBS I;  1I50 I;  5C44 I;  1NUI A;  1I3Q I;  1RO4 A;  2VUM I;  3GTJ I;  1YUA A;  4A93 I;  2E2H I;  4NBC A;  2F4M A;  2E2I I;  5IP7 I;  3D6W A;  3FKI I;  1WCM I;  1ML8 A;  2YU9 I;  1ZB9 A;  1TWC I;  4A3E I;  3RZD I;  1PFT A;  3HOV I;  1VLA A;  5CM2 M;  4NB9 A;  4BBR I;  2DE7 A;  1USP A;  2F4O A;  3VMI A;  4A3J I;  1TWH I;  1TWF I;  3GTP I;  3GTM I;  2HF1 A;  4QTU A;  2R93 I;  2JNY A;  3I07 A;  2E2J I;  1X3W A;  2DE5 A;  4NBD A;  1LQL A;  1K83 I;  4NOZ A;  1Y1W I;  3M4O I;  2PK7 A;  2R92 I;  2K5R A;  4NBH A;  4MH4 A;  1DL6 A;  1SFO I;  2J6A A;  2JA5 I;  3GTL I;  2JR6 A;  1TWG I;  3S15 I;  3GTM S;  2NVX I;  3S17 I;  4BXX I;  1WW9 A;  1X3Z A;  3Q87 A;  3HOX I;  4A3F I;  3HOZ I;  2NVT I; 
#chains in the Genus database with same CATH topology
 1YHQ Z;  3I4M I;  4X6A I;  3H0G I;  5IP9 I;  3CCU Z;  3CCV 1;  2Q4Z A;  3EER A;  1QVF Z;  1VQK Z;  3GKQ A;  3TE5 B;  2RBL A;  3VMG A;  3I56 1;  3CCS 1;  4A3B I;  4RVD A;  3U50 C;  4NBB A;  5D1P A;  1K9M 1;  3CCE Z;  3NH4 A;  1VQ7 Z;  4XX2 A;  1S72 Z;  3CCQ Z;  3PO3 I;  3G71 Z;  3G4S 1;  1K8A 2;  5AN9 F;  1VQP 1;  2ZAE B;  1VQN Z;  3NDI A;  3KIH A;  3VB9 A;  2WB1 A;  3IR7 A;  3S2D I;  1YUK A;  4RV9 A;  2OOX B;  1VQM 1;  1YIJ Z;  3PO3 S;  4RVF A;  4NB8 A;  3CCJ Z;  1WJ2 A;  1VQ6 1;  1I50 I;  2JIQ A;  1K73 2;  3CCS Z;  2QR1 B;  2VPX A;  1RO4 A;  3CCM 1;  3CCL 1;  4NBC A;  3D6W A;  1WCM I;  2OTL 1;  2YU9 I;  1TWC I;  5LL6 f;  2M48 A;  3BG1 B;  3HOV I;  4E30 A;  2P28 A;  4NB9 A;  2DE7 A;  1USP A;  2F4O A;  4A3J I;  1K9M 2;  4MD9 A;  1VQP Z;  1KQS Y;  1YJ9 Z;  5T64 A;  1M90 2;  3GTM I;  1Q81 1;  5IT9 b;  2Y0S A;  4QTU A;  1YI2 Z;  3TDH B;  2OTJ 1;  4E31 A;  3IF8 A;  1X3W A;  1RQF A;  1VQ8 1;  2RHB A;  5A2Q f;  1LQL A;  4S1T A;  2QRE B;  3F3P C;  1VQK 1;  2JIM A;  4NH1 C;  2R92 I;  3JAM b;  1FDI A;  1JJ2 Y;  2J6A A;  3GTM S;  3S17 I;  3HOX I;  2HU9 A;  2JA6 I;  3CME Z;  2V8J A;  3S1Q I;  3H3V J;  2JA7 I;  3CCE 1;  4A3G I;  2PM9 A;  1S72 1;  3CXC Y;  3G71 1;  2JIO A;  2OOY B;  1N8R 1;  1R9T I;  3J7A 4;  4E2Y A;  1VQN 1;  3RZO I;  2H85 A;  2VPZ A;  3OW2 Z;  2QRC B;  2LEX A;  2W04 A;  4MXU A;  5C4X I;  2JIP A;  3CPW Z;  3HOY I;  1VQ4 Z;  4A3I I;  1USP B;  1YIJ 1;  2OTJ Z;  2Q51 A;  2IZ3 A;  3FQM A;  1NJI 1;  1Q81 2;  2E9H A;  1VQ8 Z;  5FLM I;  3GTO I;  4NBA A;  3S14 I;  3S2H I;  2JUB A;  3CC7 1;  4A3M I;  3CCJ 1;  4A3C I;  2AYD A;  2B63 I;  2RIQ A;  5C4J I;  3ESW A;  3S1R I;  1X0T A;  3MON A;  4A3D I;  2GU2 A;  1KC8 2;  3BG0 B;  1VQO Z;  5D1O A;  1Q86 1;  2E7Z A;  2KPI A;  1QVG Z;  5FLX f;  3CQZ I;  3GTG I;  1QYP A;  1AA6 A;  3EED A;  3D9X A;  1YIT Z;  4E2W A;  3KIF A;  3J80 b;  1YJ9 1;  1YUA A;  3F3F C;  2E2H I;  2VPY A;  5IP7 I;  1P9N A;  1N8R 2;  1YI2 1;  2V45 A;  1Q7Y 1;  4A3E I;  4MD8 A;  1PFT A;  4DGL A;  1QF8 A;  1VLA A;  4DQY B;  3VMI A;  1VQ5 Z;  1VQ9 Z;  1KD1 1;  4CL1 A;  1TWF I;  2RPR A;  3CC7 Z;  2W03 A;  1Q82 1;  1WZN A;  3P5J B;  1NJI 2;  3IX0 A;  1SIW A;  2JNY A;  3I07 A;  3CD6 1;  1W2B Z;  2DE5 A;  2K3R A;  2VUG A;  3CME 1;  1QVF Y;  4NBD A;  3NH5 A;  1NP6 A;  3JAM f;  2K5R A;  2GTI A;  4E2Z A;  1DL6 A;  2V3V A;  1Q86 2;  1YJW Z;  1SFO I;  3I55 1;  1TWG I;  3S15 I;  4BXX I;  1X3Z A;  4AYB A;  1ZH1 A;  2VF1 A;  3CMA Z;  2QLV B;  3GCF A;  1VQ4 1;  4E33 A;  3G6E Z;  1Y1V I;  1FDO A;  4Y52 I;  3QWU A;  2WAQ A;  2JA8 I;  3CC2 Z;  4E2X A;  3K7A I;  3HOU I;  4Y7N I;  3IFU A;  3CCR Z;  3M3Y I;  2NVY I;  3MZK B;  3HOW I;  2M6N A;  1VQO 1;  2AKL A;  1Q16 A;  1Y1V S;  3S1M I;  3CD6 Z;  1I6H I;  2QKD A;  4MON A;  4BY1 I;  5C3E I;  3CC4 Z;  2PMZ A;  3VTN A;  3I4N I;  1YIT 1;  3I55 Z;  1ZB8 A;  4BY7 I;  1YJN Z;  3T4N B;  4RS4 A;  1N2F A;  1Z03 A;  4NBE A;  2JIR A;  2QRD B;  2QEX Z;  3PO2 I;  3FQQ A;  4EWC A;  2IZ4 A;  1WII A;  5C44 I;  4HGY A;  4NFR A;  3J81 b;  1VQ9 1;  1VQ5 1;  3J80 f;  2VUM I;  2F4M A;  2E2I I;  3FKI I;  3HKZ A;  1ML8 A;  2LIY A;  1Z02 A;  3RZD I;  2IV2 X;  1VQL Z;  2JMO A;  2LFU A;  4BBR I;  1M1K 1;  1YJW 1;  2QA4 1;  5T6B A;  2HF1 A;  4MRI A;  1K73 1;  2R93 I;  1RO0 A;  2E2J I;  5T67 A;  2RT9 A;  1K83 I;  3CMA 1;  1JWH C;  3M4O I;  2PK7 A;  3G6E 1;  4HH4 A;  4MH4 A;  2OZK A;  4NBH A;  2JA5 I;  3CC2 1;  2NVX I;  1KQS Z;  2VPW A;  1WW9 A;  3Q87 A;  4HGZ A;  2KI7 B;  3OW2 Y;  2NVT I;  1M90 1;  3NH8 A;  1RO2 A;  3CCR 1;  3CPW Y;  4A3K I;  5IT9 f;  1L1O C;  4QTT A;  2DE6 A;  3GTK I;  3GTQ I;  1JJ2 Z;  3CC4 1;  2BJO A;  2JS4 A;  4NBF A;  3VMH A;  2QA4 Z;  3S16 I;  2O53 A;  2V8I A;  5D1O B;  3CCV Z;  1TWA I;  5FLX b;  3D2L A;  1YJN 1;  1M1K 2;  1QVG Y;  3I56 Z;  3LUS A;  1S7M A;  4MD7 A;  2QEX 1;  2G2K A;  3CXC Z;  1RLY A;  1Z01 A;  1TFI A;  3MZL B;  4A3L I;  3S1N I;  2NAP A;  2YAD A;  1Q7Y 2;  3G4S Z;  2NVQ I;  2R7Z I;  4NBG A;  1KD1 2;  2P3Y A;  1Q82 2;  1VQL 1;  4RVG A;  4BBS I;  4E32 A;  3J81 f;  1NUI A;  1I3Q I;  4DK1 A;  1YHQ 1;  3GTJ I;  4A93 I;  1VQM Z;  3CCU 1;  2EGT A;  1W2B Y;  1KC8 1;  1ZB9 A;  4RVH A;  1VQ6 Z;  1QXF A;  5CM2 M;  1TWH I;  3CCM Z;  3GTP I;  3CCL Z;  2I3C A;  1K8A 1;  2GTH A;  1VQ7 1;  2OTL Z;  3CCQ 1;  4TNU A;  2R6M A;  5A2Q b;  4NOZ A;  1Y1W I;  2V8K A;  3NDJ A;  1RNI A;  3GTL I;  2JR6 A;  1Y8C A;  3NFZ A;  4A3F I;  3HOZ I;  2O4H A;  1KRL A; 
#chains in the Genus database with same CATH homology
 1YHQ Z;  3I4M I;  4X6A I;  3H0G I;  5IP9 I;  3CCU Z;  3CCV 1;  2Q4Z A;  3EER A;  1QVF Z;  1VQK Z;  3GKQ A;  3TE5 B;  2RBL A;  3VMG A;  3I56 1;  3CCS 1;  4A3B I;  4RVD A;  3U50 C;  4NBB A;  5D1P A;  1K9M 1;  3CCE Z;  3NH4 A;  1VQ7 Z;  4XX2 A;  1S72 Z;  3CCQ Z;  3PO3 I;  3G71 Z;  3G4S 1;  1K8A 2;  5AN9 F;  1VQP 1;  2ZAE B;  1VQN Z;  3NDI A;  3KIH A;  3VB9 A;  2WB1 A;  3S2D I;  1YUK A;  4RV9 A;  2OOX B;  1VQM 1;  1YIJ Z;  3PO3 S;  4RVF A;  4NB8 A;  3CCJ Z;  1VQ6 1;  1I50 I;  1K73 2;  3CCS Z;  2QR1 B;  1RO4 A;  3CCM 1;  3CCL 1;  4NBC A;  3D6W A;  1WCM I;  2OTL 1;  2YU9 I;  1TWC I;  5LL6 f;  2M48 A;  3BG1 B;  3HOV I;  4E30 A;  2P28 A;  4NB9 A;  2DE7 A;  1USP A;  2F4O A;  4A3J I;  1K9M 2;  4MD9 A;  1VQP Z;  1KQS Y;  1YJ9 Z;  5T64 A;  1M90 2;  3GTM I;  1Q81 1;  5IT9 b;  2Y0S A;  4QTU A;  1YI2 Z;  3TDH B;  2OTJ 1;  4E31 A;  3IF8 A;  1X3W A;  1RQF A;  1VQ8 1;  2RHB A;  5A2Q f;  1LQL A;  4S1T A;  2QRE B;  3F3P C;  1VQK 1;  4NH1 C;  2R92 I;  3JAM b;  1JJ2 Y;  2J6A A;  3GTM S;  3S17 I;  3HOX I;  2HU9 A;  2JA6 I;  3CME Z;  2V8J A;  3S1Q I;  3H3V J;  2JA7 I;  3CCE 1;  4A3G I;  2PM9 A;  1S72 1;  3CXC Y;  3G71 1;  2OOY B;  1N8R 1;  1R9T I;  3J7A 4;  4E2Y A;  1VQN 1;  3RZO I;  2H85 A;  3OW2 Z;  2QRC B;  2W04 A;  4MXU A;  5C4X I;  3CPW Z;  3HOY I;  1VQ4 Z;  4A3I I;  1USP B;  1YIJ 1;  2OTJ Z;  2Q51 A;  2IZ3 A;  3FQM A;  1NJI 1;  1Q81 2;  2E9H A;  1VQ8 Z;  5FLM I;  3GTO I;  4NBA A;  3S14 I;  3S2H I;  2JUB A;  3CC7 1;  4A3M I;  3CCJ 1;  4A3C I;  2B63 I;  2RIQ A;  5C4J I;  3ESW A;  3S1R I;  1X0T A;  3MON A;  4A3D I;  2GU2 A;  1KC8 2;  3BG0 B;  1VQO Z;  5D1O A;  1Q86 1;  2KPI A;  1QVG Z;  5FLX f;  3CQZ I;  3GTG I;  1QYP A;  3EED A;  3D9X A;  1YIT Z;  4E2W A;  3KIF A;  3J80 b;  1YJ9 1;  1YUA A;  3F3F C;  2E2H I;  5IP7 I;  1P9N A;  1N8R 2;  1YI2 1;  1Q7Y 1;  4A3E I;  4MD8 A;  1PFT A;  4DGL A;  1QF8 A;  1VLA A;  4DQY B;  3VMI A;  1VQ5 Z;  1VQ9 Z;  1KD1 1;  4CL1 A;  1TWF I;  2RPR A;  3CC7 Z;  2W03 A;  1Q82 1;  3P5J B;  1NJI 2;  3IX0 A;  2JNY A;  3I07 A;  3CD6 1;  1W2B Z;  2DE5 A;  2K3R A;  2VUG A;  3CME 1;  1QVF Y;  4NBD A;  3NH5 A;  1NP6 A;  3JAM f;  2K5R A;  2GTI A;  4E2Z A;  1DL6 A;  1Q86 2;  1YJW Z;  1SFO I;  3I55 1;  1TWG I;  3S15 I;  4BXX I;  1X3Z A;  4AYB A;  1ZH1 A;  2VF1 A;  3CMA Z;  2QLV B;  3GCF A;  1VQ4 1;  4E33 A;  3G6E Z;  1Y1V I;  4Y52 I;  3QWU A;  2WAQ A;  2JA8 I;  3CC2 Z;  4E2X A;  3K7A I;  3HOU I;  4Y7N I;  3IFU A;  3CCR Z;  3M3Y I;  2NVY I;  3MZK B;  3HOW I;  2M6N A;  1VQO 1;  2AKL A;  1Y1V S;  3S1M I;  3CD6 Z;  1I6H I;  2QKD A;  4MON A;  4BY1 I;  5C3E I;  3CC4 Z;  2PMZ A;  3VTN A;  3I4N I;  1YIT 1;  3I55 Z;  1ZB8 A;  4BY7 I;  1YJN Z;  3T4N B;  4RS4 A;  1N2F A;  1Z03 A;  4NBE A;  2QEX Z;  2QRD B;  3PO2 I;  3FQQ A;  4EWC A;  2IZ4 A;  1WII A;  5C44 I;  4HGY A;  1VQ5 1;  1VQ9 1;  4NFR A;  3J81 b;  3J80 f;  2VUM I;  2F4M A;  2E2I I;  3FKI I;  3HKZ A;  1ML8 A;  2LIY A;  1Z02 A;  3RZD I;  1VQL Z;  2JMO A;  2LFU A;  4BBR I;  1M1K 1;  1YJW 1;  2QA4 1;  5T6B A;  2HF1 A;  4MRI A;  1K73 1;  2R93 I;  1RO0 A;  2E2J I;  5T67 A;  2RT9 A;  1K83 I;  3CMA 1;  1JWH C;  3M4O I;  2PK7 A;  3G6E 1;  4HH4 A;  4MH4 A;  2OZK A;  4NBH A;  2JA5 I;  3CC2 1;  2NVX I;  1KQS Z;  4HGZ A;  1WW9 A;  3Q87 A;  2KI7 B;  3OW2 Y;  2NVT I;  1M90 1;  3NH8 A;  1RO2 A;  3CCR 1;  3CPW Y;  4A3K I;  5IT9 f;  1L1O C;  4QTT A;  2DE6 A;  3GTK I;  3GTQ I;  1JJ2 Z;  3CC4 1;  2BJO A;  2JS4 A;  4NBF A;  3VMH A;  2QA4 Z;  3S16 I;  2O53 A;  2V8I A;  5D1O B;  3CCV Z;  1TWA I;  5FLX b;  1YJN 1;  1M1K 2;  1QVG Y;  3I56 Z;  3LUS A;  1S7M A;  4MD7 A;  2QEX 1;  2G2K A;  3CXC Z;  1RLY A;  1Z01 A;  1TFI A;  3MZL B;  4A3L I;  3S1N I;  2YAD A;  1Q7Y 2;  3G4S Z;  2NVQ I;  2R7Z I;  4NBG A;  1KD1 2;  2P3Y A;  1Q82 2;  1VQL 1;  4RVG A;  4BBS I;  4E32 A;  3J81 f;  1NUI A;  1I3Q I;  4DK1 A;  1YHQ 1;  3GTJ I;  4A93 I;  1VQM Z;  3CCU 1;  2EGT A;  1W2B Y;  1KC8 1;  1ZB9 A;  4RVH A;  1VQ6 Z;  5CM2 M;  1TWH I;  3CCM Z;  3GTP I;  3CCL Z;  2I3C A;  1K8A 1;  2GTH A;  1VQ7 1;  2OTL Z;  3CCQ 1;  4TNU A;  2R6M A;  5A2Q b;  4NOZ A;  1Y1W I;  2V8K A;  3NDJ A;  1RNI A;  3GTL I;  2JR6 A;  3NFZ A;  4A3F I;  3HOZ I;  2O4H A;  1KRL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...