1I6HI

Rna polymerase ii elongation complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
119
structure length
119
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(P*AP*AP*AP*TP*GP*CP*CP*TP*GP*GP*TP*CP*T)-3'
publication title Structural basis of transcription: an RNA polymerase II elongation complex at 3.3 A resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna-rna hybrid
total genus 9
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2001-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1i6hI02
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1i6hI01
1TWFI 3HOUI 3GTMS 3GTPI 2JA7I 1VLAA 2DE6A 4NBEA 2NVQI 3Q87A 3FKII 2JA6I 2DE5A 1I6HI 1NUIA 1TFIA 1ZB8A 2R7ZI 4A3DI 2JA5I 2J6AA 3GCFA 1Y1WI 5C44I 4A3CI 4Y52I 1PFTA 4A3FI 2JA8I 3RZOI 1QYPA 5C4JI 2YU9I 4NOZA 2E2JI 1I50I 4BY7I 3GKQA 4A3KI 4A93I 5IP9I 5C4XI 1WCMI 4QTTA 2P3YA 3HOVI 4NBDA 1K83I 3H3VJ 2NVTI 1RO4A 1LQLA 1X3ZA 3I07A 3S1MI 3S1NI 3S2DI 3I4MI 2K5RA 4A3EI 2B63I 3VMIA 2NVYI 1USPA 4A3BI 3EERA 3I4NI 3S1QI 4NBGA 4QTUA 1N2FA 2F4OA 2DE7A 4NBBA 4XX2A 2KPIA 3LUSA 1TWGI 4NBAA 1Y1VI 4NB9A 2E2HI 3GTLI 3HOYI 3HOWI 2R93I 3GTQI 3M4OI 1TWHI 1X3WA 4A3II 2JR6A 1WW9A 5IP7I 1RLYA 4A3LI 1Y1VS 3VMHA 3H0GI 4NB8A 3GTKI 1TWCI 4NBFA 4A3JI 3S14I 4BY1I 1ML8A 3S15I 3K7AI 1I3QI 2BJOA 5FLMI 3RZDI 5C3EI 1L1OC 4BBSI 5CM2M 3S16I 2JS4A 3HOZI 2PK7A 3S1RI 1ZB9A 3D6WA 3U50C 1USPB 3GTGI 2RBLA 3PO2I 2JNYA 2R92I 1SFOI 2F4MA 1TWAI 2E2II 2HF1A 4NBHA 2AKLA 4A3MI 1YUAA 3GTJI 2VUMI 4X6AI 4NBCA 4Y7NI 4BXXI 3CQZI 4MH4A 3VMGA 2NVXI 3PO3I 1DL6A 4BBRI 3S17I 3GTOI 3HOXI 3S2HI 3M3YI 4A3GI 3ESWA 3GTMI 3PO3S 3VB9A 1R9TI
chains in the Genus database with same CATH superfamily
3I551 1VQMZ 2JA7I 2JIOA 2OOYB 2VF1A 3CCQZ 1VQKZ 3CCEZ 2NVQI 3Q87A 3CMAZ 2JA6I 2EGTA 1I6HI 2LFUA 1VQL1 1YJW1 3FQMA 1RO2A 3KIHA 4NH1C 2O53A 3RZOI 2JIQA 4NOZA 1I50I 1VQ41 4A3KI 3CME1 5IP9I 5C4XI 1Q811 1SIWA 3HOVI 1FDIA 1X0TA 3OW2Y 5T64A 4HH4A 4E2ZA 4A3EI 2P28A 4EWCA 2QKDA 2V3VA 1QVGZ 1YJN1 2NAPA 3I56Z 1VQP1 3QWUA 4NBGA 1N2FA 4NFRA 2RT9A 2LEXA 1Q16A 4RVFA 1ZH1A 2WAQA 2JUBA 5D1PA 2R93I 1TWGI 2E2HI 3CCLZ 3GTLI 1VQ51 3HOYI 2QLVB 3JAMb 4A3II 5T67A 1YIJZ 3G71Z 5FLXb 3VMHA 3H0GI 1Z02A 4NBFA 3IX0A 4E2YA 3CCV1 1VQNZ 3S14I 2G2KA 5D1OB 5FLMI 2OZKA 1VQO1 1KQSY 3J80f 2JS4A 1Q821 2V8JA 1ZB9A 2M48A 1USPB 2RPRA 3GTGI 2RBLA 4DGLA 3PO2I 2R92I 1SFOI 3CC2Z 1S721 3CPWZ 3BG1B 2AKLA 4A3MI 1YI21 1QVFZ 1YUAA 5A2Qb 2YADA 4X6AI 4E32A 4BXXI 1YHQZ 1WIIA 2QA4Z 3F3FC 3PO3I 4TNUA 4BBRI 3S17I 3S2HI 4A3GI 3ESWA 3GTMI 2JMOA 2GTIA 1TWFI 3GTPI 1VLAA 2DE6A 4E31A 3CCU1 3FKII 2M6NA 1NUIA 1FDOA 1VQM1 1VQK1 2R7ZI 3HKZA 3CMA1 3GCFA 4Y52I 4MD7A 1PFTA 2JIPA 4A3FI 2JA8I 1Z01A 2YU9I 3NFZA 4BY7I 3GKQA 1N8R2 1YITZ 1QXFA 2P3YA 2Q51A 1K83I 3CCSZ 1RO4A 1LQLA 1Z03A 4RVHA 3EEDA 1YJ9Z 3S2DI 3CXCZ 4RS4A 2B63I 2LIYA 3VMIA 4E33A 1KC82 3G6E1 3IF8A 2W03A 3JAMf 5FLXf 2GTHA 1Y8CA 3I4NI 3S1QI 4QTUA 3CCJ1 3CC7Z 1W2BZ 3D9XA 4DK1A 4MD9A 4AYBA 4NBBA 4NBAA 1Y1VI 3IR7A 2R6MA 1TWHI 1X3WA 1VQ81 5IP7I 1RLYA 4HGZA 2QRDB 4S1TA 4RV9A 1M902 4NB8A 3CCL1 1WJ2A 2E9HA 3CCRZ 1KD12 1ML8A 2QR1B 1YIJ1 3G711 2BJOA 3CD6Z 4MONA 1JJ2Z 1VQ7Z 2Q4ZA 2K3RA 3I55Z 3BG0B 5A2Qf 2O4HA 3D6WA 1K732 1TWAI 4E30A 1VQLZ 1YJWZ 3CC41 3F3PC 2W04A 1Q862 4NBCA 4Y7NI 1Q7Y2 3P5JB 4MH4A 3VMGA 3J81b 2RIQA 3HOXI 3OW2Z 3M3YI 1VQ91 3PO3S 2PMZA 3VB9A 1N8R1 2IZ4A 3MZLB 3T4NB 3HOUI 1YJNZ 3GTMS 1VQPZ 4NBEA 1S7MA 1KC81 5LL6f 5T6BA 3TDHB 1VQ61 4A3DI 2WB1A 2JA5I 2J6AA 3NH8A 4HGYA 1Y1WI 5C44I 4MXUA 2QRCB 2E2JI 3CCVZ 1RQFA 1K8A2 4A93I 5D1OA 2QEX1 2OTL1 4NBDA 3NDJA 3S1MI 3I4MI 2K5RA 1M901 1WZNA 3CCMZ 4MRIA 1USPA 4A3BI 2V8KA 3EERA 5AN9F 1KD11 4CL1A 3CCQ1 3CCE1 1S72Z 3KIFA 1AA6A 4XX2A 4NB9A 3LUSA 1YI2Z 3CC71 1K731 3GTQI 3M4OI 1K9M2 1WW9A 4A3LI 1Y1VS 5IT9b 1TWCI 1KRLA 4E2WA 4A3JI 3S15I 2IZ3A 1Q861 1NP6A 1Q7Y1 2H85A 5CM2M 3S16I 1RNIA 1QVGY 2PK7A 2VPZA 3CCUZ 2JIMA 3CD61 3I561 2V8IA 1VQ71 3J81f 2F4MA 2ZAEB 3TE5B 4NBHA 1YUKA 2OTJZ 1RO0A 3CQZI 3G4SZ 1VQN1 3GTOI 2VPYA 3G6EZ 2E7ZA 1NJI2 1K8A1 2QREB 3CCJZ 2DE5A 1M1K2 3CC21 1TFIA 3CPWY 3MONA 3NH4A 1VQ4Z 3CMEZ 1ZB8A 1VQ8Z 3J7A4 3D2LA 1QVFY 4A3CI 1QYPA 5C4JI 2Y0SA 1WCMI 4QTTA 2QA41 1YHQ1 3H3VJ 2NVTI 1K9M1 1X3ZA 2JIRA 3I07A 3S1NI 1JWHC 2RHBA 3NDIA 2NVYI 2VUGA 3NH5A 4RVGA 5IT9f 1VQ5Z 3CCM1 2F4OA 3MZKB 2IV2X 3CC4Z 2DE7A 2KPIA 1Q812 3HOWI 2HU9A 2JR6A 2PM9A 1VQOZ 3GTKI 1YIT1 4BY1I 1KQSZ 3CCS1 1VQ9Z 3K7AI 1I3QI 3CXCY 3RZDI 1YJ91 5C3EI 2I3CA 4MD8A 1L1OC 4BBSI 4RVDA 2AYDA 3HOZI 1P9NA 3S1RI 3U50C 2VPWA 1W2BY 2JNYA 1NJI1 2KI7B 4E2XA 2E2II 2HF1A 1VQ6Z 3FQQA 3IFUA 2GU2A 3J80b 1M1K1 3GTJI 2VUMI 1QF8A 4DQYB 2QEXZ 2OTLZ 2OOXB 3VTNA 2NVXI 2VPXA 1DL6A 3CCR1 1Q822 2OTJ1 1JJ2Y 2V45A 1R9TI 3G4S1
chains in the Genus database with same CATH topology
3I551 1VQMZ 2JA7I 2VF1A 2OOYB 3CCQZ 1VQKZ 3CCEZ 2NVQI 3Q87A 3CMAZ 2JA6I 2EGTA 1I6HI 2LFUA 1VQL1 1YJW1 3FQMA 1RO2A 3KIHA 4NH1C 2O53A 3RZOI 4NOZA 1I50I 1VQ41 4A3KI 3CME1 5IP9I 5C4XI 1Q811 3HOVI 1X0TA 3OW2Y 5T64A 4HH4A 4E2ZA 4A3EI 2P28A 4EWCA 2QKDA 1QVGZ 1YJN1 3I56Z 1VQP1 3QWUA 4NBGA 1N2FA 4NFRA 2RT9A 4RVFA 1ZH1A 2WAQA 2JUBA 5D1PA 2R93I 1TWGI 2E2HI 3CCLZ 3GTLI 1VQ51 3HOYI 2QLVB 3JAMb 4A3II 5T67A 1YIJZ 3G71Z 5FLXb 3VMHA 3H0GI 1Z02A 4NBFA 3IX0A 4E2YA 3CCV1 1VQNZ 3S14I 2G2KA 5D1OB 5FLMI 2OZKA 1VQO1 1KQSY 3J80f 2JS4A 1Q821 2V8JA 1ZB9A 2M48A 1USPB 2RPRA 3GTGI 2RBLA 4DGLA 3PO2I 2R92I 1SFOI 3CC2Z 1S721 3CPWZ 3BG1B 2AKLA 4A3MI 1YI21 1QVFZ 1YUAA 5A2Qb 2YADA 4X6AI 4E32A 4BXXI 1YHQZ 1WIIA 2QA4Z 3F3FC 3PO3I 4TNUA 4BBRI 3S17I 3S2HI 4A3GI 3ESWA 3GTMI 2JMOA 2GTIA 1TWFI 3GTPI 1VLAA 2DE6A 4E31A 3CCU1 3FKII 2M6NA 1NUIA 1VQM1 1VQK1 2R7ZI 3HKZA 3CMA1 3GCFA 4Y52I 4MD7A 1PFTA 4A3FI 2JA8I 1Z01A 2YU9I 3NFZA 4BY7I 3GKQA 1N8R2 1YITZ 2P3YA 2Q51A 1K83I 3CCSZ 1RO4A 1LQLA 1Z03A 4RVHA 3EEDA 1YJ9Z 3S2DI 3CXCZ 4RS4A 2B63I 2LIYA 3VMIA 4E33A 1KC82 3G6E1 3IF8A 2W03A 3JAMf 5FLXf 2GTHA 3I4NI 3S1QI 4QTUA 3CCJ1 3CC7Z 1W2BZ 3D9XA 4DK1A 4MD9A 4AYBA 4NBBA 4NBAA 1Y1VI 2R6MA 1TWHI 1X3WA 1VQ81 5IP7I 1RLYA 4HGZA 2QRDB 4S1TA 4RV9A 1M902 4NB8A 3CCL1 2E9HA 3CCRZ 1KD12 1ML8A 2QR1B 1YIJ1 3G711 2BJOA 3CD6Z 4MONA 1JJ2Z 1VQ7Z 2Q4ZA 2K3RA 3I55Z 3BG0B 5A2Qf 2O4HA 3D6WA 1K732 1TWAI 4E30A 1VQLZ 1YJWZ 3CC41 3F3PC 2W04A 1Q862 4NBCA 4Y7NI 1Q7Y2 3P5JB 4MH4A 3VMGA 3J81b 2RIQA 3HOXI 3OW2Z 3M3YI 1VQ91 3PO3S 2PMZA 3VB9A 1N8R1 2IZ4A 3MZLB 3T4NB 3HOUI 1YJNZ 3GTMS 1VQPZ 4NBEA 1S7MA 1KC81 5LL6f 5T6BA 3TDHB 1VQ61 4A3DI 2WB1A 2JA5I 2J6AA 3NH8A 4HGYA 1Y1WI 5C44I 4MXUA 2QRCB 2E2JI 3CCVZ 1RQFA 1K8A2 4A93I 5D1OA 2QEX1 2OTL1 4NBDA 3NDJA 3S1MI 3I4MI 2K5RA 1M901 3CCMZ 4MRIA 1USPA 4A3BI 2V8KA 3EERA 5AN9F 1KD11 4CL1A 3CCQ1 3CCE1 1S72Z 3KIFA 4XX2A 4NB9A 3LUSA 1YI2Z 3CC71 1K731 3GTQI 3M4OI 1K9M2 1WW9A 4A3LI 1Y1VS 5IT9b 1TWCI 1KRLA 4E2WA 4A3JI 3S15I 2IZ3A 1Q861 1NP6A 1Q7Y1 2H85A 5CM2M 3S16I 1RNIA 1QVGY 2PK7A 3CCUZ 3CD61 3I561 2V8IA 1VQ71 3J81f 2F4MA 2ZAEB 3TE5B 4NBHA 1YUKA 2OTJZ 1RO0A 3CQZI 3G4SZ 1VQN1 3GTOI 3G6EZ 1K8A1 1NJI2 2QREB 3CCJZ 2DE5A 1M1K2 3CC21 1TFIA 3CPWY 3MONA 3NH4A 1VQ4Z 3CMEZ 1ZB8A 1VQ8Z 3J7A4 1QVFY 4A3CI 1QYPA 5C4JI 2Y0SA 1WCMI 4QTTA 2QA41 1YHQ1 3H3VJ 2NVTI 1K9M1 1X3ZA 3I07A 3S1NI 1JWHC 2RHBA 3NDIA 2NVYI 2VUGA 3NH5A 4RVGA 5IT9f 1VQ5Z 3CCM1 2F4OA 3MZKB 3CC4Z 2DE7A 2KPIA 1Q812 3HOWI 2HU9A 2JR6A 2PM9A 1VQOZ 3GTKI 1YIT1 4BY1I 1KQSZ 3CCS1 1VQ9Z 3K7AI 1I3QI 3CXCY 3RZDI 1YJ91 5C3EI 2I3CA 4MD8A 1L1OC 4BBSI 4RVDA 3HOZI 1P9NA 3S1RI 3U50C 1W2BY 2JNYA 1NJI1 2KI7B 4E2XA 2E2II 2HF1A 1VQ6Z 3FQQA 3IFUA 2GU2A 3J80b 1M1K1 3GTJI 2VUMI 1QF8A 4DQYB 2QEXZ 2OTLZ 2OOXB 3VTNA 2NVXI 1DL6A 3CCR1 1Q822 2OTJ1 1JJ2Y 1R9TI 3G4S1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWF I;  3HOU I;  3GTM S;  3GTP I;  2JA7 I;  1VLA A;  2DE6 A;  4NBE A;  2NVQ I;  3Q87 A;  3FKI I;  2JA6 I;  2DE5 A;  1I6H I;  1NUI A;  1TFI A;  1ZB8 A;  2R7Z I;  4A3D I;  2JA5 I;  2J6A A;  3GCF A;  1Y1W I;  5C44 I;  4A3C I;  4Y52 I;  1PFT A;  4A3F I;  2JA8 I;  3RZO I;  1QYP A;  5C4J I;  2YU9 I;  4NOZ A;  2E2J I;  1I50 I;  4BY7 I;  3GKQ A;  4A3K I;  4A93 I;  5IP9 I;  5C4X I;  1WCM I;  4QTT A;  2P3Y A;  3HOV I;  4NBD A;  1K83 I;  3H3V J;  2NVT I;  1RO4 A;  1LQL A;  1X3Z A;  3I07 A;  3S1M I;  3S1N I;  3S2D I;  3I4M I;  2K5R A;  4A3E I;  2B63 I;  3VMI A;  2NVY I;  1USP A;  4A3B I;  3EER A;  3I4N I;  3S1Q I;  4NBG A;  4QTU A;  1N2F A;  2F4O A;  2DE7 A;  4NBB A;  4XX2 A;  2KPI A;  3LUS A;  1TWG I;  4NBA A;  1Y1V I;  4NB9 A;  2E2H I;  3GTL I;  3HOY I;  3HOW I;  2R93 I;  3GTQ I;  3M4O I;  1TWH I;  1X3W A;  4A3I I;  2JR6 A;  1WW9 A;  5IP7 I;  1RLY A;  4A3L I;  1Y1V S;  3VMH A;  3H0G I;  4NB8 A;  3GTK I;  1TWC I;  4NBF A;  4A3J I;  3S14 I;  4BY1 I;  1ML8 A;  3S15 I;  3K7A I;  1I3Q I;  2BJO A;  5FLM I;  3RZD I;  5C3E I;  1L1O C;  4BBS I;  5CM2 M;  3S16 I;  2JS4 A;  3HOZ I;  2PK7 A;  3S1R I;  1ZB9 A;  3D6W A;  3U50 C;  1USP B;  3GTG I;  2RBL A;  3PO2 I;  2JNY A;  2R92 I;  1SFO I;  2F4M A;  1TWA I;  2E2I I;  2HF1 A;  4NBH A;  2AKL A;  4A3M I;  1YUA A;  3GTJ I;  2VUM I;  4X6A I;  4NBC A;  4Y7N I;  4BXX I;  3CQZ I;  4MH4 A;  3VMG A;  2NVX I;  3PO3 I;  1DL6 A;  4BBR I;  3S17 I;  3GTO I;  3HOX I;  3S2H I;  3M3Y I;  4A3G I;  3ESW A;  3GTM I;  3PO3 S;  3VB9 A;  1R9T I; 
#chains in the Genus database with same CATH topology
 3I55 1;  1VQM Z;  2JA7 I;  2JIO A;  2OOY B;  2VF1 A;  3CCQ Z;  1VQK Z;  3CCE Z;  2NVQ I;  3Q87 A;  3CMA Z;  2JA6 I;  2EGT A;  1I6H I;  2LFU A;  1VQL 1;  1YJW 1;  3FQM A;  1RO2 A;  3KIH A;  4NH1 C;  2O53 A;  3RZO I;  2JIQ A;  4NOZ A;  1I50 I;  1VQ4 1;  4A3K I;  3CME 1;  5IP9 I;  5C4X I;  1Q81 1;  1SIW A;  3HOV I;  1FDI A;  1X0T A;  3OW2 Y;  5T64 A;  4HH4 A;  4E2Z A;  4A3E I;  2P28 A;  4EWC A;  2QKD A;  2V3V A;  1QVG Z;  1YJN 1;  2NAP A;  3I56 Z;  1VQP 1;  3QWU A;  4NBG A;  1N2F A;  4NFR A;  2RT9 A;  2LEX A;  1Q16 A;  4RVF A;  1ZH1 A;  2WAQ A;  2JUB A;  5D1P A;  2R93 I;  1TWG I;  2E2H I;  3CCL Z;  3GTL I;  1VQ5 1;  3HOY I;  2QLV B;  3JAM b;  4A3I I;  5T67 A;  1YIJ Z;  3G71 Z;  5FLX b;  3VMH A;  3H0G I;  1Z02 A;  4NBF A;  3IX0 A;  4E2Y A;  3CCV 1;  1VQN Z;  3S14 I;  2G2K A;  5D1O B;  5FLM I;  2OZK A;  1VQO 1;  1KQS Y;  3J80 f;  2JS4 A;  1Q82 1;  2V8J A;  1ZB9 A;  2M48 A;  1USP B;  2RPR A;  3GTG I;  2RBL A;  4DGL A;  3PO2 I;  2R92 I;  1SFO I;  3CC2 Z;  1S72 1;  3CPW Z;  3BG1 B;  2AKL A;  4A3M I;  1YI2 1;  1QVF Z;  1YUA A;  5A2Q b;  2YAD A;  4X6A I;  4E32 A;  4BXX I;  1YHQ Z;  1WII A;  2QA4 Z;  3F3F C;  3PO3 I;  4TNU A;  4BBR I;  3S17 I;  3S2H I;  4A3G I;  3ESW A;  3GTM I;  2JMO A;  2GTI A;  1TWF I;  3GTP I;  1VLA A;  2DE6 A;  4E31 A;  3CCU 1;  3FKI I;  2M6N A;  1NUI A;  1FDO A;  1VQM 1;  1VQK 1;  2R7Z I;  3HKZ A;  3CMA 1;  3GCF A;  4Y52 I;  4MD7 A;  1PFT A;  2JIP A;  4A3F I;  2JA8 I;  1Z01 A;  2YU9 I;  3NFZ A;  4BY7 I;  3GKQ A;  1N8R 2;  1YIT Z;  1QXF A;  2P3Y A;  2Q51 A;  1K83 I;  3CCS Z;  1RO4 A;  1LQL A;  1Z03 A;  4RVH A;  3EED A;  1YJ9 Z;  3S2D I;  3CXC Z;  4RS4 A;  2B63 I;  2LIY A;  3VMI A;  4E33 A;  1KC8 2;  3G6E 1;  3IF8 A;  2W03 A;  3JAM f;  5FLX f;  2GTH A;  1Y8C A;  3I4N I;  3S1Q I;  4QTU A;  3CCJ 1;  3CC7 Z;  1W2B Z;  3D9X A;  4DK1 A;  4MD9 A;  4AYB A;  4NBB A;  4NBA A;  1Y1V I;  3IR7 A;  2R6M A;  1TWH I;  1X3W A;  1VQ8 1;  5IP7 I;  1RLY A;  4HGZ A;  2QRD B;  4S1T A;  4RV9 A;  1M90 2;  4NB8 A;  3CCL 1;  1WJ2 A;  2E9H A;  3CCR Z;  1KD1 2;  1ML8 A;  2QR1 B;  1YIJ 1;  3G71 1;  2BJO A;  3CD6 Z;  4MON A;  1JJ2 Z;  1VQ7 Z;  2Q4Z A;  2K3R A;  3I55 Z;  3BG0 B;  5A2Q f;  2O4H A;  3D6W A;  1K73 2;  1TWA I;  4E30 A;  1VQL Z;  1YJW Z;  3CC4 1;  3F3P C;  2W04 A;  1Q86 2;  4NBC A;  4Y7N I;  1Q7Y 2;  3P5J B;  4MH4 A;  3VMG A;  3J81 b;  2RIQ A;  3HOX I;  3OW2 Z;  3M3Y I;  1VQ9 1;  3PO3 S;  2PMZ A;  3VB9 A;  1N8R 1;  2IZ4 A;  3MZL B;  3T4N B;  3HOU I;  1YJN Z;  3GTM S;  1VQP Z;  4NBE A;  1S7M A;  1KC8 1;  5LL6 f;  5T6B A;  3TDH B;  1VQ6 1;  4A3D I;  2WB1 A;  2JA5 I;  2J6A A;  3NH8 A;  4HGY A;  1Y1W I;  5C44 I;  4MXU A;  2QRC B;  2E2J I;  3CCV Z;  1RQF A;  1K8A 2;  4A93 I;  5D1O A;  2QEX 1;  2OTL 1;  4NBD A;  3NDJ A;  3S1M I;  3I4M I;  2K5R A;  1M90 1;  1WZN A;  3CCM Z;  4MRI A;  1USP A;  4A3B I;  2V8K A;  3EER A;  5AN9 F;  1KD1 1;  4CL1 A;  3CCQ 1;  3CCE 1;  1S72 Z;  3KIF A;  1AA6 A;  4XX2 A;  4NB9 A;  3LUS A;  1YI2 Z;  3CC7 1;  1K73 1;  3GTQ I;  3M4O I;  1K9M 2;  1WW9 A;  4A3L I;  1Y1V S;  5IT9 b;  1TWC I;  1KRL A;  4E2W A;  4A3J I;  3S15 I;  2IZ3 A;  1Q86 1;  1NP6 A;  1Q7Y 1;  2H85 A;  5CM2 M;  3S16 I;  1RNI A;  1QVG Y;  2PK7 A;  2VPZ A;  3CCU Z;  2JIM A;  3CD6 1;  3I56 1;  2V8I A;  1VQ7 1;  3J81 f;  2F4M A;  2ZAE B;  3TE5 B;  4NBH A;  1YUK A;  2OTJ Z;  1RO0 A;  3CQZ I;  3G4S Z;  1VQN 1;  3GTO I;  2VPY A;  3G6E Z;  2E7Z A;  1NJI 2;  1K8A 1;  2QRE B;  3CCJ Z;  2DE5 A;  1M1K 2;  3CC2 1;  1TFI A;  3CPW Y;  3MON A;  3NH4 A;  1VQ4 Z;  3CME Z;  1ZB8 A;  1VQ8 Z;  3J7A 4;  3D2L A;  1QVF Y;  4A3C I;  1QYP A;  5C4J I;  2Y0S A;  1WCM I;  4QTT A;  2QA4 1;  1YHQ 1;  3H3V J;  2NVT I;  1K9M 1;  1X3Z A;  2JIR A;  3I07 A;  3S1N I;  1JWH C;  2RHB A;  3NDI A;  2NVY I;  2VUG A;  3NH5 A;  4RVG A;  5IT9 f;  1VQ5 Z;  3CCM 1;  2F4O A;  3MZK B;  2IV2 X;  3CC4 Z;  2DE7 A;  2KPI A;  1Q81 2;  3HOW I;  2HU9 A;  2JR6 A;  2PM9 A;  1VQO Z;  3GTK I;  1YIT 1;  4BY1 I;  1KQS Z;  3CCS 1;  1VQ9 Z;  3K7A I;  1I3Q I;  3CXC Y;  3RZD I;  1YJ9 1;  5C3E I;  2I3C A;  4MD8 A;  1L1O C;  4BBS I;  4RVD A;  2AYD A;  3HOZ I;  1P9N A;  3S1R I;  3U50 C;  2VPW A;  1W2B Y;  2JNY A;  1NJI 1;  2KI7 B;  4E2X A;  2E2I I;  2HF1 A;  1VQ6 Z;  3FQQ A;  3IFU A;  2GU2 A;  3J80 b;  1M1K 1;  3GTJ I;  2VUM I;  1QF8 A;  4DQY B;  2QEX Z;  2OTL Z;  2OOX B;  3VTN A;  2NVX I;  2VPX A;  1DL6 A;  3CCR 1;  1Q82 2;  2OTJ 1;  1JJ2 Y;  2V45 A;  1R9T I;  3G4S 1; 
#chains in the Genus database with same CATH homology
 3I55 1;  1VQM Z;  2JA7 I;  2VF1 A;  2OOY B;  3CCQ Z;  1VQK Z;  3CCE Z;  2NVQ I;  3Q87 A;  3CMA Z;  2JA6 I;  2EGT A;  1I6H I;  2LFU A;  1VQL 1;  1YJW 1;  3FQM A;  1RO2 A;  3KIH A;  4NH1 C;  2O53 A;  3RZO I;  4NOZ A;  1I50 I;  1VQ4 1;  4A3K I;  3CME 1;  5IP9 I;  5C4X I;  1Q81 1;  3HOV I;  1X0T A;  3OW2 Y;  5T64 A;  4HH4 A;  4E2Z A;  4A3E I;  2P28 A;  4EWC A;  2QKD A;  1QVG Z;  1YJN 1;  3I56 Z;  1VQP 1;  3QWU A;  4NBG A;  1N2F A;  4NFR A;  2RT9 A;  4RVF A;  1ZH1 A;  2WAQ A;  2JUB A;  5D1P A;  2R93 I;  1TWG I;  2E2H I;  3CCL Z;  3GTL I;  1VQ5 1;  3HOY I;  2QLV B;  3JAM b;  4A3I I;  5T67 A;  1YIJ Z;  3G71 Z;  5FLX b;  3VMH A;  3H0G I;  1Z02 A;  4NBF A;  3IX0 A;  4E2Y A;  3CCV 1;  1VQN Z;  3S14 I;  2G2K A;  5D1O B;  5FLM I;  2OZK A;  1VQO 1;  1KQS Y;  3J80 f;  2JS4 A;  1Q82 1;  2V8J A;  1ZB9 A;  2M48 A;  1USP B;  2RPR A;  3GTG I;  2RBL A;  4DGL A;  3PO2 I;  2R92 I;  1SFO I;  3CC2 Z;  1S72 1;  3CPW Z;  3BG1 B;  2AKL A;  4A3M I;  1YI2 1;  1QVF Z;  1YUA A;  5A2Q b;  2YAD A;  4X6A I;  4E32 A;  4BXX I;  1YHQ Z;  1WII A;  2QA4 Z;  3F3F C;  3PO3 I;  4TNU A;  4BBR I;  3S17 I;  3S2H I;  4A3G I;  3ESW A;  3GTM I;  2JMO A;  2GTI A;  1TWF I;  3GTP I;  1VLA A;  2DE6 A;  4E31 A;  3CCU 1;  3FKI I;  2M6N A;  1NUI A;  1VQM 1;  1VQK 1;  2R7Z I;  3HKZ A;  3CMA 1;  3GCF A;  4Y52 I;  4MD7 A;  1PFT A;  4A3F I;  2JA8 I;  1Z01 A;  2YU9 I;  3NFZ A;  4BY7 I;  3GKQ A;  1N8R 2;  1YIT Z;  2P3Y A;  2Q51 A;  1K83 I;  3CCS Z;  1RO4 A;  1LQL A;  1Z03 A;  4RVH A;  3EED A;  1YJ9 Z;  3S2D I;  3CXC Z;  4RS4 A;  2B63 I;  2LIY A;  3VMI A;  4E33 A;  1KC8 2;  3G6E 1;  3IF8 A;  2W03 A;  3JAM f;  5FLX f;  2GTH A;  3I4N I;  3S1Q I;  4QTU A;  3CCJ 1;  3CC7 Z;  1W2B Z;  3D9X A;  4DK1 A;  4MD9 A;  4AYB A;  4NBB A;  4NBA A;  1Y1V I;  2R6M A;  1TWH I;  1X3W A;  1VQ8 1;  5IP7 I;  1RLY A;  4HGZ A;  2QRD B;  4S1T A;  4RV9 A;  1M90 2;  4NB8 A;  3CCL 1;  2E9H A;  3CCR Z;  1KD1 2;  1ML8 A;  2QR1 B;  1YIJ 1;  3G71 1;  2BJO A;  3CD6 Z;  4MON A;  1JJ2 Z;  1VQ7 Z;  2Q4Z A;  2K3R A;  3I55 Z;  3BG0 B;  5A2Q f;  2O4H A;  3D6W A;  1K73 2;  1TWA I;  4E30 A;  1VQL Z;  1YJW Z;  3CC4 1;  3F3P C;  2W04 A;  1Q86 2;  4NBC A;  4Y7N I;  1Q7Y 2;  3P5J B;  4MH4 A;  3VMG A;  3J81 b;  2RIQ A;  3HOX I;  3OW2 Z;  3M3Y I;  1VQ9 1;  3PO3 S;  2PMZ A;  3VB9 A;  1N8R 1;  2IZ4 A;  3MZL B;  3T4N B;  3HOU I;  1YJN Z;  3GTM S;  1VQP Z;  4NBE A;  1S7M A;  1KC8 1;  5LL6 f;  5T6B A;  3TDH B;  1VQ6 1;  4A3D I;  2WB1 A;  2JA5 I;  2J6A A;  3NH8 A;  4HGY A;  1Y1W I;  5C44 I;  4MXU A;  2QRC B;  2E2J I;  3CCV Z;  1RQF A;  1K8A 2;  4A93 I;  5D1O A;  2QEX 1;  2OTL 1;  4NBD A;  3NDJ A;  3S1M I;  3I4M I;  2K5R A;  1M90 1;  3CCM Z;  4MRI A;  1USP A;  4A3B I;  2V8K A;  3EER A;  5AN9 F;  1KD1 1;  4CL1 A;  3CCQ 1;  3CCE 1;  1S72 Z;  3KIF A;  4XX2 A;  4NB9 A;  3LUS A;  1YI2 Z;  3CC7 1;  1K73 1;  3GTQ I;  3M4O I;  1K9M 2;  1WW9 A;  4A3L I;  1Y1V S;  5IT9 b;  1TWC I;  1KRL A;  4E2W A;  4A3J I;  3S15 I;  2IZ3 A;  1Q86 1;  1NP6 A;  1Q7Y 1;  2H85 A;  5CM2 M;  3S16 I;  1RNI A;  1QVG Y;  2PK7 A;  3CCU Z;  3CD6 1;  3I56 1;  2V8I A;  1VQ7 1;  3J81 f;  2F4M A;  2ZAE B;  3TE5 B;  4NBH A;  1YUK A;  2OTJ Z;  1RO0 A;  3CQZ I;  3G4S Z;  1VQN 1;  3GTO I;  3G6E Z;  1K8A 1;  1NJI 2;  2QRE B;  3CCJ Z;  2DE5 A;  1M1K 2;  3CC2 1;  1TFI A;  3CPW Y;  3MON A;  3NH4 A;  1VQ4 Z;  3CME Z;  1ZB8 A;  1VQ8 Z;  3J7A 4;  1QVF Y;  4A3C I;  1QYP A;  5C4J I;  2Y0S A;  1WCM I;  4QTT A;  2QA4 1;  1YHQ 1;  3H3V J;  2NVT I;  1K9M 1;  1X3Z A;  3I07 A;  3S1N I;  1JWH C;  2RHB A;  3NDI A;  2NVY I;  2VUG A;  3NH5 A;  4RVG A;  5IT9 f;  1VQ5 Z;  3CCM 1;  2F4O A;  3MZK B;  3CC4 Z;  2DE7 A;  2KPI A;  1Q81 2;  3HOW I;  2HU9 A;  2JR6 A;  2PM9 A;  1VQO Z;  3GTK I;  1YIT 1;  4BY1 I;  1KQS Z;  3CCS 1;  1VQ9 Z;  3K7A I;  1I3Q I;  3CXC Y;  3RZD I;  1YJ9 1;  5C3E I;  2I3C A;  4MD8 A;  1L1O C;  4BBS I;  4RVD A;  3HOZ I;  1P9N A;  3S1R I;  3U50 C;  1W2B Y;  2JNY A;  1NJI 1;  2KI7 B;  4E2X A;  2E2I I;  2HF1 A;  1VQ6 Z;  3FQQ A;  3IFU A;  2GU2 A;  3J80 b;  1M1K 1;  3GTJ I;  2VUM I;  1QF8 A;  4DQY B;  2QEX Z;  2OTL Z;  2OOX B;  3VTN A;  2NVX I;  1DL6 A;  3CCR 1;  1Q82 2;  2OTJ 1;  1JJ2 Y;  1R9T I;  3G4S 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...