1I6HI

Rna polymerase ii elongation complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna-rna hybrid
molecule keywords 5'-D(P*AP*AP*AP*TP*GP*CP*CP*TP*GP*GP*TP*CP*T)-3'
publication title Structural basis of transcription: an RNA polymerase II elongation complex at 3.3 A resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 9
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2001-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1i6hI02
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1i6hI01
1WCMI 3ESWA 3VB9A 4A3KI 4NB8A 3S1NI 5IP9I 4A93I 2VUMI 4NOZA 2AKLA 2KPIA 1I3QI 3GTMI 3EERA 1USPB 3PO3S 2R7ZI 4X6AI 3GCFA 3VMIA 1TWGI 1TWFI 3I07A 3GTPI 3M3YI 4A3EI 3S15I 3HOYI 4BY7I 4BBSI 3RZOI 4A3GI 1TWHI 3VMGA 2DE5A 2E2II 1N2FA 1NUIA 3S2HI 2F4OA 3K7AI 2NVYI 5C3EI 3GTMS 1LQLA 1TWAI 3GTKI 5C4XI 1R9TI 4NBCA 4MH4A 4BBRI 4XX2A 5FLMI 3HOVI 4A3II 1Y1VI 2BJOA 2DE7A 3D6WA 1DL6A 3GKQA 5IP7I 2RBLA 1RO4A 2JR6A 3I4NI 2JA7I 1TFIA 3VMHA 3HOXI 4QTTA 4A3FI 2R93I 4A3DI 4A3JI 3H0GI 2K5RA 1I6HI 3CQZI 4NBBA 2E2JI 3RZDI 1ML8A 4NB9A 3FKII 1Y1VS 2YU9I 1RLYA 3S1QI 3S16I 3GTOI 1ZB9A 1Y1WI 2J6AA 4Y52I 2JNYA 2B63I 1L1OC 3Q87A 2NVTI 2E2HI 4NBEA 3S17I 3HOUI 1ZB8A 4A3LI 2JA6I 1USPA 3I4MI 4BXXI 3U50C 1I50I 2HF1A 1K83I 3S1RI 2R92I 4NBHA 1X3WA 2P3YA 2NVXI 1YUAA 2JA5I 4NBAA 3PO2I 3H3VJ 3GTLI 2NVQI 3GTQI 5CM2M 5C4JI 4A3BI 4NBGA 3GTJI 1X3ZA 3S14I 2JS4A 4BY1I 2F4MA 1QYPA 5C44I 2PK7A 3S2DI 3HOZI 4QTUA 4A3MI 4Y7NI 2DE6A 1WW9A 3GTGI 4A3CI 1PFTA 3LUSA 3PO3I 1TWCI 1VLAA 4NBDA 2JA8I 3M4OI 1SFOI 4NBFA 3HOWI 3S1MI
chains in the Genus database with same CATH superfamily
2QEXZ 1S7MA 5IP9I 3CCM1 2KPIA 1M902 1K9M2 2E7ZA 1USPB 1VQ9Z 2JIRA 1KC81 1TWFI 3GTPI 2QR1B 2VPYA 2Q51A 3CCVZ 3HOYI 2OOXB 3CC21 1YJW1 2OTL1 3CCLZ 5D1OB 5FLXb 1YITZ 1M1K1 1YHQ1 3K7AI 2OTJZ 1YJ91 2NVYI 3GTMS 2QA4Z 1R9TI 4BBRI 1N8R2 4E2WA 3CCJ1 3CC4Z 2BJOA 2DE7A 2K3RA 3D6WA 3GKQA 2RBLA 2JMOA 2JIQA 4RS4A 2JA7I 3I561 1FDIA 3VMHA 2VF1A 2R93I 2H85A 3H0GI 1AA6A 1I6HI 1VQNZ 2E2JI 1WZNA 2LIYA 2IZ4A 4HGYA 4NB9A 1Q811 3CC71 2YU9I 3G71Z 1L1OC 3BG1B 2E2HI 3G4SZ 2GTIA 3HOUI 2E9HA 3IF8A 1Q822 2JA6I 3VTNA 4BXXI 1YJNZ 2RHBA 1VQKZ 2R92I 2VUGA 2RT9A 4E33A 4DK1A 3MZLB 1QVGY 1NJI2 2Q4ZA 4NBAA 1VQ6Z 4DGLA 4A3BI 3GTJI 1YI2Z 5T67A 4BY1I 1QYPA 1Z02A 3HOZI 2QKDA 4E2YA 4A3MI 2DE6A 3GTGI 4A3CI 3IX0A 3J81f 5AN9F 1W2BY 1TWCI 1SIWA 2QRDB 1VQP1 1VQL1 1VQ81 2JA8I 2QLVB 1SFOI 4HGZA 3S1MI 1VQ51 2WAQA 1W2BZ 3BG0B 1M901 4NOZA 4MD9A 1VQ7Z 3GCFA 3VMIA 3J80b 1YIJZ 3M3YI 3RZOI 1TWHI 1VQO1 2W03A 2DE5A 3CD61 3J7A4 1N2FA 3I56Z 1NUIA 1VQ4Z 3G6EZ 1QF8A 1LQLA 4NH1C 2ZAEB 3CCE1 4NBCA 4MH4A 3CMAZ 4XX2A 3J81b 3CC7Z 1Q861 2LFUA 1DL6A 4MD7A 1Z01A 4QTTA 3NH4A 3CME1 2K5RA 4NBBA 1K731 1Y1VS 2P28A 3MONA 3GTOI 1VQM1 2J6AA 2B63I 2IZ3A 4RVGA 4NBEA 2PMZA 1KRLA 3NH5A 3MZKB 3I4MI 1K8A1 1I50I 2HF1A 3NH8A 1K83I 3S1RI 3I551 3CCR1 3IR7A 4NBHA 1KD12 1YUAA 2JA5I 1RO2A 3PO2I 2Y0SA 3GTLI 2R6MA 3GTQI 2V8IA 5C4JI 1FDOA 1P9NA 2JS4A 1S721 4QTUA 1KC82 2IV2X 3NFZA 4Y7NI 2GU2A 3QWUA 4NFRA 1VLAA 2QEX1 4NBDA 3M4OI 3CCS1 4RVFA 1JJ2Y 3J80f 3VB9A 4A3KI 3S1NI 2M48A 3CXCY 4A93I 4E31A 3CCV1 1JJ2Z 1I3QI 3GTMI 3CCEZ 1NP6A 3PO3S 2EGTA 3CCMZ 1TWGI 3FQQA 3CXCZ 3HKZA 3S15I 2OTJ1 3VMGA 4E2XA 3P5JB 2QA41 3CCU1 3S2HI 3CC2Z 1YJWZ 2OTLZ 1JWHC 3CMEZ 1TWAI 3GTKI 1Q812 1YHQZ 2WB1A 5FLMI 1YJ9Z 1K9M1 4A3II 3EEDA 2W04A 4E32A 5T6BA 2RIQA 5IP7I 1YUKA 1RO4A 2JR6A 4MONA 3TDHB 3I4NI 3CCJZ 3NDIA 5LL6f 3HOXI 4HH4A 3D9XA 2O4HA 3RZDI 3G711 1ML8A 3FKII 3I55Z 1N8R1 1RLYA 3CCRZ 1QXFA 3S16I 3G4S1 2RPRA 1ZB9A 1Y1WI 2KI7B 4Y52I 2JNYA 3Q87A 3F3PC 2NVTI 4RVHA 3S17I 2GTHA 2V8JA 5IT9f 4A3LI 2PM9A 4S1TA 3U50C 1Q16A 4E2ZA 1WJ2A 1VQ61 1KD11 1WIIA 1X3WA 4EWCA 1YI21 2P3YA 3CCSZ 2LEXA 1QVFY 4NBGA 4MXUA 3S14I 5T64A 2V3VA 2F4MA 1KQSY 5C44I 3F3FC 3KIHA 3TE5B 1QVFZ 1Q821 1WW9A 1Q7Y2 1KQSZ 1RO0A 3OW2Y 1Y8CA 3HOWI 4NBFA 1VQ71 1NJI1 1WCMI 3ESWA 3CCUZ 2O53A 1VQPZ 1VQLZ 1VQ8Z 5IT9b 4NB8A 3JAMb 3OW2Z 2VUMI 1YIJ1 2AKLA 4AYBA 1VQ5Z 3KIFA 3FQMA 3EERA 5A2Qb 2V8KA 3CCQ1 2AYDA 1Q862 2R7ZI 4X6AI 4CL1A 3I07A 4A3EI 4BY7I 4BBSI 1VQ41 4A3GI 2JIOA 3G6E1 1Z03A 2E2II 3CMA1 2OOYB 2F4OA 2V45A 1M1K2 1K732 1VQOZ 5C3EI 5C4XI 3CD6Z 2VPXA 2M6NA 1VQ91 3HOVI 1Y1VI 2YADA 2HU9A 3CCL1 2I3CA 4E30A 1TFIA 1YIT1 4A3FI 4A3DI 4A3JI 1K8A2 4MD8A 4RVDA 3CQZI 3NDJA 4DQYB 2VPZA 3CC41 3S1QI 4TNUA 1QVGZ 3CPWY 2VPWA 1VQMZ 1ZB8A 1VQN1 1USPA 3IFUA 3T4NB 2OZKA 2JIMA 3CPWZ 5D1OA 2NVXI 3H3VJ 2NVQI 1X0TA 5CM2M 5FLXf 1X3ZA 5D1PA 4MRIA 2PK7A 3S2DI 3D2LA 1YJN1 1Q7Y1 1RNIA 3CCQZ 2QREB 3JAMf 1PFTA 3LUSA 1VQK1 3PO3I 1RQFA 2JUBA 1S72Z 2JIPA 2QRCB 2NAPA 5A2Qf 2G2KA 4RV9A 1ZH1A
chains in the Genus database with same CATH topology
2QEXZ 1S7MA 5IP9I 3CCM1 2KPIA 1M902 1K9M2 1USPB 1VQ9Z 1KC81 1TWFI 3GTPI 2QR1B 3CCVZ 2Q51A 3HOYI 2OOXB 3CC21 1YJW1 2OTL1 3CCLZ 5D1OB 5FLXb 1YITZ 1M1K1 1YHQ1 3K7AI 2OTJZ 1YJ91 2NVYI 3GTMS 2QA4Z 1R9TI 4BBRI 1N8R2 4E2WA 3CCJ1 3CC4Z 2BJOA 2DE7A 2K3RA 3D6WA 3GKQA 2RBLA 2JMOA 4RS4A 2JA7I 3I561 3VMHA 2VF1A 2R93I 2H85A 3H0GI 1I6HI 1VQNZ 2E2JI 2LIYA 2IZ4A 4HGYA 4NB9A 1Q811 3CC71 2YU9I 3G71Z 1L1OC 3BG1B 2E2HI 3G4SZ 2GTIA 3HOUI 2E9HA 3IF8A 1Q822 2JA6I 3VTNA 4BXXI 1YJNZ 2RHBA 1VQKZ 2R92I 2VUGA 2RT9A 4E33A 4DK1A 3MZLB 1QVGY 1NJI2 2Q4ZA 4NBAA 1VQ6Z 4DGLA 4A3BI 3GTJI 1YI2Z 5T67A 4BY1I 1QYPA 1Z02A 3HOZI 2QKDA 4E2YA 4A3MI 2DE6A 3GTGI 4A3CI 3IX0A 3J81f 5AN9F 1W2BY 1TWCI 2QRDB 1VQP1 1VQL1 1VQ81 2JA8I 2QLVB 1SFOI 4HGZA 3S1MI 1VQ51 2WAQA 1W2BZ 3BG0B 1M901 4NOZA 4MD9A 1VQ7Z 3GCFA 3VMIA 3J80b 1YIJZ 3M3YI 3RZOI 1TWHI 1VQO1 2W03A 2DE5A 3CD61 3J7A4 1N2FA 3I56Z 1NUIA 1VQ4Z 3G6EZ 1QF8A 1LQLA 4NH1C 2ZAEB 3CCE1 4NBCA 4MH4A 3CMAZ 4XX2A 3J81b 3CC7Z 1Q861 2LFUA 1DL6A 4MD7A 1Z01A 4QTTA 3NH4A 3CME1 2K5RA 4NBBA 1K731 1Y1VS 2P28A 3MONA 3GTOI 1VQM1 2J6AA 2B63I 2IZ3A 4RVGA 4NBEA 2PMZA 1KRLA 3NH5A 3MZKB 3I4MI 1K8A1 1I50I 2HF1A 3NH8A 1K83I 3S1RI 3I551 3CCR1 4NBHA 1KD12 1YUAA 2JA5I 1RO2A 3PO2I 2Y0SA 3GTLI 2R6MA 3GTQI 2V8IA 5C4JI 1P9NA 2JS4A 1S721 4QTUA 1KC82 3NFZA 4Y7NI 2GU2A 3QWUA 4NFRA 1VLAA 2QEX1 4NBDA 3M4OI 3CCS1 4RVFA 1JJ2Y 3J80f 3VB9A 4A3KI 3S1NI 2M48A 3CXCY 4A93I 4E31A 3CCV1 1JJ2Z 1I3QI 3GTMI 3CCEZ 1NP6A 3PO3S 2EGTA 3CCMZ 1TWGI 3FQQA 3CXCZ 3HKZA 3S15I 2OTJ1 3VMGA 4E2XA 3P5JB 2QA41 3CCU1 3S2HI 3CC2Z 1YJWZ 2OTLZ 1JWHC 3CMEZ 1TWAI 3GTKI 1Q812 1YHQZ 2WB1A 5FLMI 1YJ9Z 1K9M1 4A3II 3EEDA 2W04A 4E32A 5T6BA 2RIQA 5IP7I 1YUKA 1RO4A 2JR6A 4MONA 3TDHB 3I4NI 3CCJZ 3NDIA 5LL6f 3HOXI 4HH4A 3D9XA 2O4HA 3RZDI 3G711 1ML8A 3FKII 3I55Z 1N8R1 1RLYA 3CCRZ 3S16I 3G4S1 2RPRA 1ZB9A 1Y1WI 2KI7B 4Y52I 2JNYA 3Q87A 3F3PC 2NVTI 4RVHA 3S17I 2GTHA 2V8JA 5IT9f 4A3LI 2PM9A 4S1TA 3U50C 4E2ZA 1VQ61 1KD11 1WIIA 1X3WA 4EWCA 1YI21 2P3YA 3CCSZ 1QVFY 4NBGA 4MXUA 3S14I 5T64A 1KQSY 2F4MA 5C44I 3F3FC 3KIHA 3TE5B 1QVFZ 1Q821 1WW9A 1Q7Y2 1KQSZ 1RO0A 3OW2Y 3HOWI 4NBFA 1VQ71 1NJI1 1WCMI 3ESWA 3CCUZ 2O53A 1VQPZ 1VQLZ 1VQ8Z 5IT9b 4NB8A 3JAMb 3OW2Z 2VUMI 1YIJ1 2AKLA 4AYBA 1VQ5Z 3KIFA 3FQMA 3EERA 5A2Qb 2V8KA 3CCQ1 2R7ZI 1Q862 4X6AI 4CL1A 3I07A 4A3EI 4BY7I 4BBSI 1VQ41 4A3GI 3G6E1 1Z03A 2E2II 3CMA1 2OOYB 2F4OA 1M1K2 1K732 1VQOZ 5C3EI 5C4XI 3CD6Z 2M6NA 1VQ91 3HOVI 1Y1VI 2YADA 2HU9A 3CCL1 2I3CA 4E30A 1TFIA 1YIT1 4A3FI 4A3DI 4A3JI 1K8A2 4MD8A 4RVDA 3CQZI 3NDJA 4DQYB 3CC41 3S1QI 4TNUA 1QVGZ 3CPWY 1VQMZ 1ZB8A 1VQN1 1USPA 3IFUA 3T4NB 2OZKA 3CPWZ 5D1OA 2NVXI 3H3VJ 2NVQI 1X0TA 5CM2M 5FLXf 1X3ZA 5D1PA 4MRIA 2PK7A 3S2DI 1YJN1 1Q7Y1 1RNIA 3CCQZ 2QREB 3JAMf 1PFTA 3LUSA 1VQK1 3PO3I 1RQFA 2JUBA 1S72Z 2QRCB 5A2Qf 2G2KA 4RV9A 1ZH1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WCM I;  3ESW A;  3VB9 A;  4A3K I;  4NB8 A;  3S1N I;  5IP9 I;  4A93 I;  2VUM I;  4NOZ A;  2AKL A;  2KPI A;  1I3Q I;  3GTM I;  3EER A;  1USP B;  3PO3 S;  2R7Z I;  4X6A I;  3GCF A;  3VMI A;  1TWG I;  1TWF I;  3I07 A;  3GTP I;  3M3Y I;  4A3E I;  3S15 I;  3HOY I;  4BY7 I;  4BBS I;  3RZO I;  4A3G I;  1TWH I;  3VMG A;  2DE5 A;  2E2I I;  1N2F A;  1NUI A;  3S2H I;  2F4O A;  3K7A I;  2NVY I;  5C3E I;  3GTM S;  1LQL A;  1TWA I;  3GTK I;  5C4X I;  1R9T I;  4NBC A;  4MH4 A;  4BBR I;  4XX2 A;  5FLM I;  3HOV I;  4A3I I;  1Y1V I;  2BJO A;  2DE7 A;  3D6W A;  1DL6 A;  3GKQ A;  5IP7 I;  2RBL A;  1RO4 A;  2JR6 A;  3I4N I;  2JA7 I;  1TFI A;  3VMH A;  3HOX I;  4QTT A;  4A3F I;  2R93 I;  4A3D I;  4A3J I;  3H0G I;  2K5R A;  1I6H I;  3CQZ I;  4NBB A;  2E2J I;  3RZD I;  1ML8 A;  4NB9 A;  3FKI I;  1Y1V S;  2YU9 I;  1RLY A;  3S1Q I;  3S16 I;  3GTO I;  1ZB9 A;  1Y1W I;  2J6A A;  4Y52 I;  2JNY A;  2B63 I;  1L1O C;  3Q87 A;  2NVT I;  2E2H I;  4NBE A;  3S17 I;  3HOU I;  1ZB8 A;  4A3L I;  2JA6 I;  1USP A;  3I4M I;  4BXX I;  3U50 C;  1I50 I;  2HF1 A;  1K83 I;  3S1R I;  2R92 I;  4NBH A;  1X3W A;  2P3Y A;  2NVX I;  1YUA A;  2JA5 I;  4NBA A;  3PO2 I;  3H3V J;  3GTL I;  2NVQ I;  3GTQ I;  5CM2 M;  5C4J I;  4A3B I;  4NBG A;  3GTJ I;  1X3Z A;  3S14 I;  2JS4 A;  4BY1 I;  2F4M A;  1QYP A;  5C44 I;  2PK7 A;  3S2D I;  3HOZ I;  4QTU A;  4A3M I;  4Y7N I;  2DE6 A;  1WW9 A;  3GTG I;  4A3C I;  1PFT A;  3LUS A;  3PO3 I;  1TWC I;  1VLA A;  4NBD A;  2JA8 I;  3M4O I;  1SFO I;  4NBF A;  3HOW I;  3S1M I; 
#chains in the Genus database with same CATH topology
 2QEX Z;  1S7M A;  5IP9 I;  3CCM 1;  2KPI A;  1M90 2;  1K9M 2;  2E7Z A;  1USP B;  1VQ9 Z;  2JIR A;  1KC8 1;  1TWF I;  3GTP I;  2QR1 B;  2VPY A;  2Q51 A;  3CCV Z;  3HOY I;  2OOX B;  3CC2 1;  1YJW 1;  2OTL 1;  3CCL Z;  5D1O B;  5FLX b;  1YIT Z;  1M1K 1;  1YHQ 1;  3K7A I;  2OTJ Z;  1YJ9 1;  2NVY I;  3GTM S;  2QA4 Z;  1R9T I;  4BBR I;  1N8R 2;  4E2W A;  3CCJ 1;  3CC4 Z;  2BJO A;  2DE7 A;  2K3R A;  3D6W A;  3GKQ A;  2RBL A;  2JMO A;  2JIQ A;  4RS4 A;  2JA7 I;  3I56 1;  1FDI A;  3VMH A;  2VF1 A;  2R93 I;  2H85 A;  3H0G I;  1AA6 A;  1I6H I;  1VQN Z;  2E2J I;  1WZN A;  2LIY A;  2IZ4 A;  4HGY A;  4NB9 A;  1Q81 1;  3CC7 1;  2YU9 I;  3G71 Z;  1L1O C;  3BG1 B;  2E2H I;  3G4S Z;  2GTI A;  3HOU I;  2E9H A;  3IF8 A;  1Q82 2;  2JA6 I;  3VTN A;  4BXX I;  1YJN Z;  2RHB A;  1VQK Z;  2R92 I;  2VUG A;  2RT9 A;  4E33 A;  4DK1 A;  3MZL B;  1QVG Y;  1NJI 2;  2Q4Z A;  4NBA A;  1VQ6 Z;  4DGL A;  4A3B I;  3GTJ I;  1YI2 Z;  5T67 A;  4BY1 I;  1QYP A;  1Z02 A;  3HOZ I;  2QKD A;  4E2Y A;  4A3M I;  2DE6 A;  3GTG I;  4A3C I;  3IX0 A;  3J81 f;  5AN9 F;  1W2B Y;  1TWC I;  1SIW A;  2QRD B;  1VQP 1;  1VQL 1;  1VQ8 1;  2JA8 I;  2QLV B;  1SFO I;  4HGZ A;  3S1M I;  1VQ5 1;  2WAQ A;  1W2B Z;  3BG0 B;  1M90 1;  4NOZ A;  4MD9 A;  1VQ7 Z;  3GCF A;  3VMI A;  3J80 b;  1YIJ Z;  3M3Y I;  3RZO I;  1TWH I;  1VQO 1;  2W03 A;  2DE5 A;  3CD6 1;  3J7A 4;  1N2F A;  3I56 Z;  1NUI A;  1VQ4 Z;  3G6E Z;  1QF8 A;  1LQL A;  4NH1 C;  2ZAE B;  3CCE 1;  4NBC A;  4MH4 A;  3CMA Z;  4XX2 A;  3J81 b;  3CC7 Z;  1Q86 1;  2LFU A;  1DL6 A;  4MD7 A;  1Z01 A;  4QTT A;  3NH4 A;  3CME 1;  2K5R A;  4NBB A;  1K73 1;  1Y1V S;  2P28 A;  3MON A;  3GTO I;  1VQM 1;  2J6A A;  2B63 I;  2IZ3 A;  4RVG A;  4NBE A;  2PMZ A;  1KRL A;  3NH5 A;  3MZK B;  3I4M I;  1K8A 1;  1I50 I;  2HF1 A;  3NH8 A;  1K83 I;  3S1R I;  3I55 1;  3CCR 1;  3IR7 A;  4NBH A;  1KD1 2;  1YUA A;  2JA5 I;  1RO2 A;  3PO2 I;  2Y0S A;  3GTL I;  2R6M A;  3GTQ I;  2V8I A;  5C4J I;  1FDO A;  1P9N A;  2JS4 A;  1S72 1;  4QTU A;  1KC8 2;  2IV2 X;  3NFZ A;  4Y7N I;  2GU2 A;  3QWU A;  4NFR A;  1VLA A;  2QEX 1;  4NBD A;  3M4O I;  3CCS 1;  4RVF A;  1JJ2 Y;  3J80 f;  3VB9 A;  4A3K I;  3S1N I;  2M48 A;  3CXC Y;  4A93 I;  4E31 A;  3CCV 1;  1JJ2 Z;  1I3Q I;  3GTM I;  3CCE Z;  1NP6 A;  3PO3 S;  2EGT A;  3CCM Z;  1TWG I;  3FQQ A;  3CXC Z;  3HKZ A;  3S15 I;  2OTJ 1;  3VMG A;  4E2X A;  3P5J B;  2QA4 1;  3CCU 1;  3S2H I;  3CC2 Z;  1YJW Z;  2OTL Z;  1JWH C;  3CME Z;  1TWA I;  3GTK I;  1Q81 2;  1YHQ Z;  2WB1 A;  5FLM I;  1YJ9 Z;  1K9M 1;  4A3I I;  3EED A;  2W04 A;  4E32 A;  5T6B A;  2RIQ A;  5IP7 I;  1YUK A;  1RO4 A;  2JR6 A;  4MON A;  3TDH B;  3I4N I;  3CCJ Z;  3NDI A;  5LL6 f;  3HOX I;  4HH4 A;  3D9X A;  2O4H A;  3RZD I;  3G71 1;  1ML8 A;  3FKI I;  3I55 Z;  1N8R 1;  1RLY A;  3CCR Z;  1QXF A;  3S16 I;  3G4S 1;  2RPR A;  1ZB9 A;  1Y1W I;  2KI7 B;  4Y52 I;  2JNY A;  3Q87 A;  3F3P C;  2NVT I;  4RVH A;  3S17 I;  2GTH A;  2V8J A;  5IT9 f;  4A3L I;  2PM9 A;  4S1T A;  3U50 C;  1Q16 A;  4E2Z A;  1WJ2 A;  1VQ6 1;  1KD1 1;  1WII A;  1X3W A;  4EWC A;  1YI2 1;  2P3Y A;  3CCS Z;  2LEX A;  1QVF Y;  4NBG A;  4MXU A;  3S14 I;  5T64 A;  2V3V A;  2F4M A;  1KQS Y;  5C44 I;  3F3F C;  3KIH A;  3TE5 B;  1QVF Z;  1Q82 1;  1WW9 A;  1Q7Y 2;  1KQS Z;  1RO0 A;  3OW2 Y;  1Y8C A;  3HOW I;  4NBF A;  1VQ7 1;  1NJI 1;  1WCM I;  3ESW A;  3CCU Z;  2O53 A;  1VQP Z;  1VQL Z;  1VQ8 Z;  5IT9 b;  4NB8 A;  3JAM b;  3OW2 Z;  2VUM I;  1YIJ 1;  2AKL A;  4AYB A;  1VQ5 Z;  3KIF A;  3FQM A;  3EER A;  5A2Q b;  2V8K A;  3CCQ 1;  2AYD A;  1Q86 2;  2R7Z I;  4X6A I;  4CL1 A;  3I07 A;  4A3E I;  4BY7 I;  4BBS I;  1VQ4 1;  4A3G I;  2JIO A;  3G6E 1;  1Z03 A;  2E2I I;  3CMA 1;  2OOY B;  2F4O A;  2V45 A;  1M1K 2;  1K73 2;  1VQO Z;  5C3E I;  5C4X I;  3CD6 Z;  2VPX A;  2M6N A;  1VQ9 1;  3HOV I;  1Y1V I;  2YAD A;  2HU9 A;  3CCL 1;  2I3C A;  4E30 A;  1TFI A;  1YIT 1;  4A3F I;  4A3D I;  4A3J I;  1K8A 2;  4MD8 A;  4RVD A;  3CQZ I;  3NDJ A;  4DQY B;  2VPZ A;  3CC4 1;  3S1Q I;  4TNU A;  1QVG Z;  3CPW Y;  2VPW A;  1VQM Z;  1ZB8 A;  1VQN 1;  1USP A;  3IFU A;  3T4N B;  2OZK A;  2JIM A;  3CPW Z;  5D1O A;  2NVX I;  3H3V J;  2NVQ I;  1X0T A;  5CM2 M;  5FLX f;  1X3Z A;  5D1P A;  4MRI A;  2PK7 A;  3S2D I;  3D2L A;  1YJN 1;  1Q7Y 1;  1RNI A;  3CCQ Z;  2QRE B;  3JAM f;  1PFT A;  3LUS A;  1VQK 1;  3PO3 I;  1RQF A;  2JUB A;  1S72 Z;  2JIP A;  2QRC B;  2NAP A;  5A2Q f;  2G2K A;  4RV9 A;  1ZH1 A; 
#chains in the Genus database with same CATH homology
 2QEX Z;  1S7M A;  5IP9 I;  3CCM 1;  2KPI A;  1M90 2;  1K9M 2;  1USP B;  1VQ9 Z;  1KC8 1;  1TWF I;  3GTP I;  2QR1 B;  3CCV Z;  2Q51 A;  3HOY I;  2OOX B;  3CC2 1;  1YJW 1;  2OTL 1;  3CCL Z;  5D1O B;  5FLX b;  1YIT Z;  1M1K 1;  1YHQ 1;  3K7A I;  2OTJ Z;  1YJ9 1;  2NVY I;  3GTM S;  2QA4 Z;  1R9T I;  4BBR I;  1N8R 2;  4E2W A;  3CCJ 1;  3CC4 Z;  2BJO A;  2DE7 A;  2K3R A;  3D6W A;  3GKQ A;  2RBL A;  2JMO A;  4RS4 A;  2JA7 I;  3I56 1;  3VMH A;  2VF1 A;  2R93 I;  2H85 A;  3H0G I;  1I6H I;  1VQN Z;  2E2J I;  2LIY A;  2IZ4 A;  4HGY A;  4NB9 A;  1Q81 1;  3CC7 1;  2YU9 I;  3G71 Z;  1L1O C;  3BG1 B;  2E2H I;  3G4S Z;  2GTI A;  3HOU I;  2E9H A;  3IF8 A;  1Q82 2;  2JA6 I;  3VTN A;  4BXX I;  1YJN Z;  2RHB A;  1VQK Z;  2R92 I;  2VUG A;  2RT9 A;  4E33 A;  4DK1 A;  3MZL B;  1QVG Y;  1NJI 2;  2Q4Z A;  4NBA A;  1VQ6 Z;  4DGL A;  4A3B I;  3GTJ I;  1YI2 Z;  5T67 A;  4BY1 I;  1QYP A;  1Z02 A;  3HOZ I;  2QKD A;  4E2Y A;  4A3M I;  2DE6 A;  3GTG I;  4A3C I;  3IX0 A;  3J81 f;  5AN9 F;  1W2B Y;  1TWC I;  2QRD B;  1VQP 1;  1VQL 1;  1VQ8 1;  2JA8 I;  2QLV B;  1SFO I;  4HGZ A;  3S1M I;  1VQ5 1;  2WAQ A;  1W2B Z;  3BG0 B;  1M90 1;  4NOZ A;  4MD9 A;  1VQ7 Z;  3GCF A;  3VMI A;  3J80 b;  1YIJ Z;  3M3Y I;  3RZO I;  1TWH I;  1VQO 1;  2W03 A;  2DE5 A;  3CD6 1;  3J7A 4;  1N2F A;  3I56 Z;  1NUI A;  1VQ4 Z;  3G6E Z;  1QF8 A;  1LQL A;  4NH1 C;  2ZAE B;  3CCE 1;  4NBC A;  4MH4 A;  3CMA Z;  4XX2 A;  3J81 b;  3CC7 Z;  1Q86 1;  2LFU A;  1DL6 A;  4MD7 A;  1Z01 A;  4QTT A;  3NH4 A;  3CME 1;  2K5R A;  4NBB A;  1K73 1;  1Y1V S;  2P28 A;  3MON A;  3GTO I;  1VQM 1;  2J6A A;  2B63 I;  2IZ3 A;  4RVG A;  4NBE A;  2PMZ A;  1KRL A;  3NH5 A;  3MZK B;  3I4M I;  1K8A 1;  1I50 I;  2HF1 A;  3NH8 A;  1K83 I;  3S1R I;  3I55 1;  3CCR 1;  4NBH A;  1KD1 2;  1YUA A;  2JA5 I;  1RO2 A;  3PO2 I;  2Y0S A;  3GTL I;  2R6M A;  3GTQ I;  2V8I A;  5C4J I;  1P9N A;  2JS4 A;  1S72 1;  4QTU A;  1KC8 2;  3NFZ A;  4Y7N I;  2GU2 A;  3QWU A;  4NFR A;  1VLA A;  2QEX 1;  4NBD A;  3M4O I;  3CCS 1;  4RVF A;  1JJ2 Y;  3J80 f;  3VB9 A;  4A3K I;  3S1N I;  2M48 A;  3CXC Y;  4A93 I;  4E31 A;  3CCV 1;  1JJ2 Z;  1I3Q I;  3GTM I;  3CCE Z;  1NP6 A;  3PO3 S;  2EGT A;  3CCM Z;  1TWG I;  3FQQ A;  3CXC Z;  3HKZ A;  3S15 I;  2OTJ 1;  3VMG A;  4E2X A;  3P5J B;  2QA4 1;  3CCU 1;  3S2H I;  3CC2 Z;  1YJW Z;  2OTL Z;  1JWH C;  3CME Z;  1TWA I;  3GTK I;  1Q81 2;  1YHQ Z;  2WB1 A;  5FLM I;  1YJ9 Z;  1K9M 1;  4A3I I;  3EED A;  2W04 A;  4E32 A;  5T6B A;  2RIQ A;  5IP7 I;  1YUK A;  1RO4 A;  2JR6 A;  4MON A;  3TDH B;  3I4N I;  3CCJ Z;  3NDI A;  5LL6 f;  3HOX I;  4HH4 A;  3D9X A;  2O4H A;  3RZD I;  3G71 1;  1ML8 A;  3FKI I;  3I55 Z;  1N8R 1;  1RLY A;  3CCR Z;  3S16 I;  3G4S 1;  2RPR A;  1ZB9 A;  1Y1W I;  2KI7 B;  4Y52 I;  2JNY A;  3Q87 A;  3F3P C;  2NVT I;  4RVH A;  3S17 I;  2GTH A;  2V8J A;  5IT9 f;  4A3L I;  2PM9 A;  4S1T A;  3U50 C;  4E2Z A;  1VQ6 1;  1KD1 1;  1WII A;  1X3W A;  4EWC A;  1YI2 1;  2P3Y A;  3CCS Z;  1QVF Y;  4NBG A;  4MXU A;  3S14 I;  5T64 A;  1KQS Y;  2F4M A;  5C44 I;  3F3F C;  3KIH A;  3TE5 B;  1QVF Z;  1Q82 1;  1WW9 A;  1Q7Y 2;  1KQS Z;  1RO0 A;  3OW2 Y;  3HOW I;  4NBF A;  1VQ7 1;  1NJI 1;  1WCM I;  3ESW A;  3CCU Z;  2O53 A;  1VQP Z;  1VQL Z;  1VQ8 Z;  5IT9 b;  4NB8 A;  3JAM b;  3OW2 Z;  2VUM I;  1YIJ 1;  2AKL A;  4AYB A;  1VQ5 Z;  3KIF A;  3FQM A;  3EER A;  5A2Q b;  2V8K A;  3CCQ 1;  2R7Z I;  1Q86 2;  4X6A I;  4CL1 A;  3I07 A;  4A3E I;  4BY7 I;  4BBS I;  1VQ4 1;  4A3G I;  3G6E 1;  1Z03 A;  2E2I I;  3CMA 1;  2OOY B;  2F4O A;  1M1K 2;  1K73 2;  1VQO Z;  5C3E I;  5C4X I;  3CD6 Z;  2M6N A;  1VQ9 1;  3HOV I;  1Y1V I;  2YAD A;  2HU9 A;  3CCL 1;  2I3C A;  4E30 A;  1TFI A;  1YIT 1;  4A3F I;  4A3D I;  4A3J I;  1K8A 2;  4MD8 A;  4RVD A;  3CQZ I;  3NDJ A;  4DQY B;  3CC4 1;  3S1Q I;  4TNU A;  1QVG Z;  3CPW Y;  1VQM Z;  1ZB8 A;  1VQN 1;  1USP A;  3IFU A;  3T4N B;  2OZK A;  3CPW Z;  5D1O A;  2NVX I;  3H3V J;  2NVQ I;  1X0T A;  5CM2 M;  5FLX f;  1X3Z A;  5D1P A;  4MRI A;  2PK7 A;  3S2D I;  1YJN 1;  1Q7Y 1;  1RNI A;  3CCQ Z;  2QRE B;  3JAM f;  1PFT A;  3LUS A;  1VQK 1;  3PO3 I;  1RQF A;  2JUB A;  1S72 Z;  2QRC B;  5A2Q f;  2G2K A;  4RV9 A;  1ZH1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...