3CPWZ

The structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Crystal Structure of the Oxazolidinone Antibiotic Linezolid Bound to the 50S Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cpwZ00
1M901 3CCQZ 1YJ91 1Q7Y1 1VQP1 1QVGY 1YITZ 1KD11 1Q861 3G711 1VQ4Z 3CCR1 1VQO1 1K9M2 3CCVZ 1QVFZ 1YJWZ 1S72Z 3G6E1 2OTL1 1YJ9Z 3G4S1 1VQ51 1Q821 1YJN1 1VQPZ 3CMA1 1K9M1 3CCJ1 1YIJ1 3G71Z 1KD12 3CCV1 3CCRZ 1S721 1VQ91 3G6EZ 1W2BZ 2OTLZ 1QVFY 3G4SZ 1VQ81 1VQ5Z 1KQSZ 1YJNZ 3CCU1 2OTJ1 1Q822 3CMAZ 3CCJZ 1YIJZ 1YHQ1 3OW2Z 3CC21 3CPWZ 3CCEZ 1VQ9Z 3CMEZ 1VQ71 1YI21 1VQ8Z 1JJ2Z 1W2BY 3CCUZ 1KQSY 3CC7Z 2OTJZ 3CCL1 1YHQZ 3CCM1 1M1K2 3CC41 3CCE1 3CC2Z 1VQNZ 3CME1 3OW2Y 2QEX1 1N8R1 3CPWY 1VQM1 1VQ7Z 1YI2Z 3I551 3CXCZ 1VQ61 1M1K1 1K732 1VQKZ 1VQL1 3CCLZ 3CCMZ 3CCS1 1VQN1 3CC4Z 2QEXZ 1VQMZ 1N8R2 3I56Z 1K731 2QA4Z 1KC81 3I55Z 1VQ6Z 1VQK1 3CXCY 1VQLZ 1Q811 1NJI1 3CCSZ 1K8A1 3CD61 3I561 2QA41 3CC71 3CCQ1 1JJ2Y 1QVGZ 1KC82 1M902 1YIT1 1Q7Y2 3CD6Z 1Q812 1NJI2 1VQ41 1K8A2 1Q862 1YJW1 1VQOZ
chains in the Genus database with same CATH superfamily
1M901 3F3PC 1PFTA 3I07A 3NDIA 4BBSI 4AYBA 3GTMI 1QVGY 1RLYA 1Q861 3JAMf 1I50I 1WW9A 2M48A 1VQ4Z 2JA6I 3S2DI 1K9M2 3CCVZ 4CL1A 4BY1I 2OTL1 1YJ9Z 2R7ZI 3D6WA 3U50C 2VPWA 1Y1VS 2IZ4A 5T67A 1KD12 5C44I 3GTGI 3CCRZ 2R92I 2NVTI 1VQ91 3S1RI 5D1OA 3G4SZ 1VQ5Z 4NOZA 3FKII 3VTNA 2OTJ1 2K5RA 1YIJZ 3TDHB 4QTTA 5AN9F 2F4MA 1RQFA 4XX2A 1YHQ1 3MONA 4BBRI 3CC21 3CCEZ 1SIWA 3VMHA 1ZB9A 2O4HA 3GCFA 2DE5A 2QRDB 4DK1A 2RPRA 2DE6A 3CCM1 1M1K2 1TWCI 5CM2M 4A3JI 3OW2Y 2QEX1 4NBHA 1VQ7Z 2QRCB 3HKZA 2WAQA 2H85A 3F3FC 4DGLA 4MD8A 1YUKA 2VPXA 4A3CI 4MD9A 1X0TA 2B63I 3CQZI 1N8R2 2QA4Z 3HOYI 1VQ6Z 2RBLA 1VQK1 1RO2A 3NFZA 3CXCY 1VQLZ 2KPIA 3JAMb 1Q811 1NP6A 5IT9b 3RZDI 4NBFA 2P3YA 3I561 3IR7A 3CC71 1AA6A 3I4MI 1QVGZ 2PMZA 1KC82 3J81f 2VPZA 4HH4A 3GTPI 3S1MI 1VQ41 2O53A 1WCMI 1VQOZ 2V8KA 3GTKI 3Q87A 1ZB8A 3EERA 1YJ91 2NVYI 3S14I 1FDIA 2P28A 1YITZ 2IZ3A 1KD11 1NUIA 4NBEA 3CCR1 2R6MA 1QYPA 2JA7I 1N2FA 4A3GI 3G4S1 1VQ51 1TWGI 1VQPZ 2RIQA 3KIFA 3FQMA 3IX0A 2AKLA 3S1NI 1YIJ1 4MRIA 3IF8A 3GTMS 3TE5B 4HGZA 3IFUA 5A2Qf 4E31A 1S721 2NVXI 1QVFY 1TWHI 2WB1A 2Q51A 3CMAZ 3CCJZ 3FQQA 3PO3S 1WJ2A 2LFUA 3OW2Z 5IT9f 1Q16A 2QREB 3EEDA 3CMEZ 2JIQA 1USPB 1VQ71 2JR6A 3T4NB 4A93I 1LQLA 2VUMI 3CCUZ 4A3FI 4A3EI 3D9XA 4RVDA 1VQNZ 4HGYA 1N8R1 4MH4A 3CPWY 2R93I 1YI2Z 4TNUA 3S16I 2JA5I 3J81b 3CXCZ 1VQ61 1K732 1VQL1 3CCLZ 1QF8A 3CC4Z 3HOVI 1RNIA 2PK7A 2VF1A 1WZNA 4RVFA 2V3VA 3D2LA 2V45A 1VQMZ 2EGTA 1KC81 1Y1VI 3NH5A 2QLVB 2Q4ZA 3CCSZ 2I3CA 1I3QI 3GTJI 4E30A 2GU2A 5FLMI 2DE7A 1M902 3HOXI 1YIT1 4E32A 3CD6Z 5A2Qb 1JWHC 4RVHA 1K8A2 1Q862 1TWFI 3MZLB 3MZKB 4A3MI 3CCQZ 1Q7Y1 1VQP1 2JNYA 4NFRA 1R9TI 1X3ZA 1YUAA 1QVFZ 2IV2X 3J7A4 5C4JI 4NH1C 1X3WA 3VB9A 4E2XA 4DQYB 3NDJA 3CMA1 1K9M1 3CCJ1 2KI7B 4A3II 3G71Z 4MONA 1USPA 3CCV1 3H3VJ 2JIRA 3S2HI 2V8JA 2JIMA 4NBDA 3G6EZ 4S1TA 2JUBA 1YJNZ 3CCU1 1Q822 1RO4A 4BXXI 1TFIA 3HOWI 3CPWZ 2K3RA 1YI21 4RS4A 1VQ8Z 2E2JI 1W2BY 2YU9I 2JA8I 3S15I 1KQSY 2W04A 5T64A 3CCL1 3CCE1 3CC41 2JIOA 3BG0B 1SFOI 1VQM1 1Z03A 2V8IA 2OOXB 1I6HI 2VPYA 1M1K1 1WIIA 2JIPA 1VQKZ 3CCS1 2E9HA 4BY7I 3ESWA 1DL6A 4RVGA 2PM9A 1Z02A 4MD7A 1QXFA 3GTLI 2RHBA 3KIHA 3I56Z 3I55Z 4E2ZA 4NB8A 4NBGA 3PO2I 3J80f 3VMGA 3S17I 3H0GI 4RV9A 1K8A1 1P9NA 2JMOA 3CD61 2JS4A 2Y0SA 3NH8A 2QA41 2GTIA 2E2II 4A3KI 3CCQ1 1RO0A 1K83I 3PO3I 2NVQI 1ML8A 3HOZI 1NJI2 5FLXf 2F4OA 3QWUA 1VLAA 4EWCA 4E2YA 2E2HI 3I4NI 4A3BI 2HF1A 4NBCA 3G711 1VQO1 2RT9A 1Z01A 1YJWZ 3S1QI 2LEXA 3G6E1 5C3EI 1S72Z 4A3LI 3M3YI 4Y52I 4E2WA 3LUSA 1Y8CA 1Q821 2QR1B 1YJN1 2LIYA 2M6NA 1ZH1A 3RZOI 3M4OI 3NH4A 1FDOA 3BG1B 1W2BZ 2OTLZ 1VQ81 4QTUA 1KQSZ 4X6AI 5T6BA 1VQ9Z 2OOYB 2QKDA 3K7AI 1JJ2Z 3J80b 2OTJZ 5D1OB 4NBBA 1YHQZ 2BJOA 3CC2Z 1KRLA 5LL6f 2AYDA 3CME1 1S7MA 3HOUI 5IP7I 5D1PA 4MXUA 4NBAA 3I551 2W03A 3P5JB 1L1OC 1Y1WI 3CCMZ 1VQN1 2J6AA 5FLXb 2HU9A 2QEXZ 2GTHA 4NB9A 1K731 3GTQI 5IP9I 3VMIA 2OZKA 1NJI1 3GTOI 4E33A 2G2KA 2NAPA 1TWAI 4A3DI 1JJ2Y 2ZAEB 2YADA 4Y7NI 1Q7Y2 2VUGA 5C4XI 1Q812 2E7ZA 3GKQA 1YJW1 3CC7Z
chains in the Genus database with same CATH topology
1M901 3F3PC 1PFTA 3I07A 3NDIA 4BBSI 4AYBA 3GTMI 1QVGY 1RLYA 1Q861 3JAMf 1I50I 1WW9A 2M48A 1VQ4Z 2JA6I 3S2DI 1K9M2 3CCVZ 4CL1A 4BY1I 2OTL1 1YJ9Z 2R7ZI 3D6WA 3U50C 1Y1VS 2IZ4A 5T67A 1KD12 5C44I 3GTGI 3CCRZ 2R92I 2NVTI 1VQ91 3S1RI 5D1OA 3G4SZ 1VQ5Z 4NOZA 3FKII 3VTNA 2OTJ1 2K5RA 1YIJZ 3TDHB 4QTTA 5AN9F 2F4MA 1RQFA 4XX2A 1YHQ1 3MONA 4BBRI 3CC21 3CCEZ 3VMHA 1ZB9A 2O4HA 3GCFA 2DE5A 2QRDB 4DK1A 2RPRA 2DE6A 3CCM1 1M1K2 1TWCI 5CM2M 4A3JI 3OW2Y 2QEX1 4NBHA 1VQ7Z 2QRCB 3HKZA 2WAQA 2H85A 3F3FC 4DGLA 4MD8A 1YUKA 4A3CI 4MD9A 1X0TA 2B63I 3CQZI 1N8R2 2QA4Z 3HOYI 1VQ6Z 2RBLA 1VQK1 1RO2A 3NFZA 3CXCY 1VQLZ 2KPIA 3JAMb 1Q811 1NP6A 5IT9b 3RZDI 4NBFA 2P3YA 3I561 3CC71 3I4MI 1QVGZ 2PMZA 1KC82 3J81f 4HH4A 3GTPI 3S1MI 1VQ41 2O53A 1WCMI 1VQOZ 2V8KA 3GTKI 3Q87A 1ZB8A 3EERA 1YJ91 2NVYI 3S14I 2P28A 1YITZ 2IZ3A 1KD11 1NUIA 4NBEA 3CCR1 2R6MA 1QYPA 2JA7I 1N2FA 4A3GI 3G4S1 1VQ51 1TWGI 1VQPZ 2RIQA 3KIFA 3FQMA 3IX0A 2AKLA 3S1NI 1YIJ1 4MRIA 3IF8A 3GTMS 3TE5B 4HGZA 3IFUA 5A2Qf 4E31A 1S721 2NVXI 1QVFY 1TWHI 2WB1A 2Q51A 3CMAZ 3CCJZ 3FQQA 3PO3S 2LFUA 3OW2Z 5IT9f 2QREB 3EEDA 3CMEZ 1USPB 1VQ71 2JR6A 3T4NB 4A93I 1LQLA 2VUMI 3CCUZ 4A3FI 4A3EI 3D9XA 4RVDA 1VQNZ 4HGYA 1N8R1 4MH4A 3CPWY 2R93I 1YI2Z 4TNUA 3S16I 2JA5I 3J81b 3CXCZ 1VQ61 1K732 1VQL1 3CCLZ 1QF8A 3CC4Z 3HOVI 1RNIA 2PK7A 2VF1A 4RVFA 1VQMZ 2EGTA 1KC81 1Y1VI 3NH5A 2QLVB 2Q4ZA 3CCSZ 2I3CA 1I3QI 3GTJI 4E30A 2GU2A 5FLMI 2DE7A 1M902 3HOXI 1YIT1 4E32A 3CD6Z 5A2Qb 1JWHC 4RVHA 1K8A2 1Q862 1TWFI 3MZLB 3MZKB 4A3MI 3CCQZ 1Q7Y1 1VQP1 2JNYA 4NFRA 1R9TI 1X3ZA 1YUAA 1QVFZ 3J7A4 5C4JI 4NH1C 1X3WA 3VB9A 4E2XA 4DQYB 3NDJA 3CMA1 1K9M1 3CCJ1 2KI7B 4A3II 3G71Z 4MONA 1USPA 3CCV1 3H3VJ 3S2HI 2V8JA 4NBDA 3G6EZ 4S1TA 2JUBA 1YJNZ 3CCU1 1Q822 1RO4A 4BXXI 1TFIA 3HOWI 3CPWZ 2K3RA 1YI21 4RS4A 1VQ8Z 2E2JI 1W2BY 2YU9I 2JA8I 3S15I 1KQSY 2W04A 5T64A 3CCL1 3CCE1 3CC41 3BG0B 1SFOI 1VQM1 1Z03A 2V8IA 2OOXB 1I6HI 1M1K1 1WIIA 1VQKZ 3CCS1 2E9HA 4BY7I 3ESWA 1DL6A 4RVGA 2PM9A 1Z02A 4MD7A 3GTLI 2RHBA 3KIHA 3I56Z 3I55Z 4E2ZA 4NB8A 4NBGA 3PO2I 3J80f 3VMGA 3S17I 3H0GI 4RV9A 1K8A1 1P9NA 2JMOA 3CD61 2JS4A 2Y0SA 3NH8A 2QA41 2GTIA 2E2II 4A3KI 3CCQ1 1RO0A 1K83I 3PO3I 2NVQI 1ML8A 3HOZI 1NJI2 5FLXf 2F4OA 3QWUA 1VLAA 4EWCA 4E2YA 2E2HI 3I4NI 4A3BI 2HF1A 4NBCA 3G711 1VQO1 2RT9A 1Z01A 1YJWZ 3S1QI 1S72Z 3G6E1 5C3EI 4A3LI 3M3YI 4Y52I 4E2WA 3LUSA 1Q821 2QR1B 1YJN1 2LIYA 2M6NA 1ZH1A 3RZOI 3M4OI 3NH4A 3BG1B 1W2BZ 2OTLZ 1VQ81 4QTUA 1KQSZ 4X6AI 5T6BA 1VQ9Z 2OOYB 2QKDA 3K7AI 1JJ2Z 3J80b 2OTJZ 5D1OB 4NBBA 1YHQZ 2BJOA 3CC2Z 1KRLA 5LL6f 3CME1 1S7MA 3HOUI 5IP7I 5D1PA 4MXUA 4NBAA 3I551 2W03A 3P5JB 1L1OC 1Y1WI 3CCMZ 1VQN1 2J6AA 5FLXb 2HU9A 2QEXZ 2GTHA 4NB9A 1K731 3GTQI 5IP9I 3VMIA 2OZKA 1NJI1 3GTOI 4E33A 2G2KA 1TWAI 4A3DI 1JJ2Y 2ZAEB 2YADA 4Y7NI 1Q7Y2 2VUGA 5C4XI 1Q812 3GKQA 1YJW1 3CC7Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M90 1;  3CCQ Z;  1YJ9 1;  1Q7Y 1;  1VQP 1;  1QVG Y;  1YIT Z;  1KD1 1;  1Q86 1;  3G71 1;  1VQ4 Z;  3CCR 1;  1VQO 1;  1K9M 2;  3CCV Z;  1QVF Z;  1YJW Z;  1S72 Z;  3G6E 1;  2OTL 1;  1YJ9 Z;  3G4S 1;  1VQ5 1;  1Q82 1;  1YJN 1;  1VQP Z;  3CMA 1;  1K9M 1;  3CCJ 1;  1YIJ 1;  3G71 Z;  1KD1 2;  3CCV 1;  3CCR Z;  1S72 1;  1VQ9 1;  3G6E Z;  1W2B Z;  2OTL Z;  1QVF Y;  3G4S Z;  1VQ8 1;  1VQ5 Z;  1KQS Z;  1YJN Z;  3CCU 1;  2OTJ 1;  1Q82 2;  3CMA Z;  3CCJ Z;  1YIJ Z;  1YHQ 1;  3OW2 Z;  3CC2 1;  3CPW Z;  3CCE Z;  1VQ9 Z;  3CME Z;  1VQ7 1;  1YI2 1;  1VQ8 Z;  1JJ2 Z;  1W2B Y;  3CCU Z;  1KQS Y;  3CC7 Z;  2OTJ Z;  3CCL 1;  1YHQ Z;  3CCM 1;  1M1K 2;  3CC4 1;  3CCE 1;  3CC2 Z;  1VQN Z;  3CME 1;  3OW2 Y;  2QEX 1;  1N8R 1;  3CPW Y;  1VQM 1;  1VQ7 Z;  1YI2 Z;  3I55 1;  3CXC Z;  1VQ6 1;  1M1K 1;  1K73 2;  1VQK Z;  1VQL 1;  3CCL Z;  3CCM Z;  3CCS 1;  1VQN 1;  3CC4 Z;  2QEX Z;  1VQM Z;  1N8R 2;  3I56 Z;  1K73 1;  2QA4 Z;  1KC8 1;  3I55 Z;  1VQ6 Z;  1VQK 1;  3CXC Y;  1VQL Z;  1Q81 1;  1NJI 1;  3CCS Z;  1K8A 1;  3CD6 1;  3I56 1;  2QA4 1;  3CC7 1;  3CCQ 1;  1JJ2 Y;  1QVG Z;  1KC8 2;  1M90 2;  1YIT 1;  1Q7Y 2;  3CD6 Z;  1Q81 2;  1NJI 2;  1VQ4 1;  1K8A 2;  1Q86 2;  1YJW 1;  1VQO Z; 
#chains in the Genus database with same CATH topology
 1M90 1;  3F3P C;  1PFT A;  3I07 A;  3NDI A;  4BBS I;  4AYB A;  3GTM I;  1QVG Y;  1RLY A;  1Q86 1;  3JAM f;  1I50 I;  1WW9 A;  2M48 A;  1VQ4 Z;  2JA6 I;  3S2D I;  1K9M 2;  3CCV Z;  4CL1 A;  4BY1 I;  2OTL 1;  1YJ9 Z;  2R7Z I;  3D6W A;  3U50 C;  2VPW A;  1Y1V S;  2IZ4 A;  5T67 A;  1KD1 2;  5C44 I;  3GTG I;  3CCR Z;  2R92 I;  2NVT I;  1VQ9 1;  3S1R I;  5D1O A;  3G4S Z;  1VQ5 Z;  4NOZ A;  3FKI I;  3VTN A;  2OTJ 1;  2K5R A;  1YIJ Z;  3TDH B;  4QTT A;  5AN9 F;  2F4M A;  1RQF A;  4XX2 A;  1YHQ 1;  3MON A;  4BBR I;  3CC2 1;  3CCE Z;  1SIW A;  3VMH A;  1ZB9 A;  2O4H A;  3GCF A;  2DE5 A;  2QRD B;  4DK1 A;  2RPR A;  2DE6 A;  3CCM 1;  1M1K 2;  1TWC I;  5CM2 M;  4A3J I;  3OW2 Y;  2QEX 1;  4NBH A;  1VQ7 Z;  2QRC B;  3HKZ A;  2WAQ A;  2H85 A;  3F3F C;  4DGL A;  4MD8 A;  1YUK A;  2VPX A;  4A3C I;  4MD9 A;  1X0T A;  2B63 I;  3CQZ I;  1N8R 2;  2QA4 Z;  3HOY I;  1VQ6 Z;  2RBL A;  1VQK 1;  1RO2 A;  3NFZ A;  3CXC Y;  1VQL Z;  2KPI A;  3JAM b;  1Q81 1;  1NP6 A;  5IT9 b;  3RZD I;  4NBF A;  2P3Y A;  3I56 1;  3IR7 A;  3CC7 1;  1AA6 A;  3I4M I;  1QVG Z;  2PMZ A;  1KC8 2;  3J81 f;  2VPZ A;  4HH4 A;  3GTP I;  3S1M I;  1VQ4 1;  2O53 A;  1WCM I;  1VQO Z;  2V8K A;  3GTK I;  3Q87 A;  1ZB8 A;  3EER A;  1YJ9 1;  2NVY I;  3S14 I;  1FDI A;  2P28 A;  1YIT Z;  2IZ3 A;  1KD1 1;  1NUI A;  4NBE A;  3CCR 1;  2R6M A;  1QYP A;  2JA7 I;  1N2F A;  4A3G I;  3G4S 1;  1VQ5 1;  1TWG I;  1VQP Z;  2RIQ A;  3KIF A;  3FQM A;  3IX0 A;  2AKL A;  3S1N I;  1YIJ 1;  4MRI A;  3IF8 A;  3GTM S;  3TE5 B;  4HGZ A;  3IFU A;  5A2Q f;  4E31 A;  1S72 1;  2NVX I;  1QVF Y;  1TWH I;  2WB1 A;  2Q51 A;  3CMA Z;  3CCJ Z;  3FQQ A;  3PO3 S;  1WJ2 A;  2LFU A;  3OW2 Z;  5IT9 f;  1Q16 A;  2QRE B;  3EED A;  3CME Z;  2JIQ A;  1USP B;  1VQ7 1;  2JR6 A;  3T4N B;  4A93 I;  1LQL A;  2VUM I;  3CCU Z;  4A3F I;  4A3E I;  3D9X A;  4RVD A;  1VQN Z;  4HGY A;  1N8R 1;  4MH4 A;  3CPW Y;  2R93 I;  1YI2 Z;  4TNU A;  3S16 I;  2JA5 I;  3J81 b;  3CXC Z;  1VQ6 1;  1K73 2;  1VQL 1;  3CCL Z;  1QF8 A;  3CC4 Z;  3HOV I;  1RNI A;  2PK7 A;  2VF1 A;  1WZN A;  4RVF A;  2V3V A;  3D2L A;  2V45 A;  1VQM Z;  2EGT A;  1KC8 1;  1Y1V I;  3NH5 A;  2QLV B;  2Q4Z A;  3CCS Z;  2I3C A;  1I3Q I;  3GTJ I;  4E30 A;  2GU2 A;  5FLM I;  2DE7 A;  1M90 2;  3HOX I;  1YIT 1;  4E32 A;  3CD6 Z;  5A2Q b;  1JWH C;  4RVH A;  1K8A 2;  1Q86 2;  1TWF I;  3MZL B;  3MZK B;  4A3M I;  3CCQ Z;  1Q7Y 1;  1VQP 1;  2JNY A;  4NFR A;  1R9T I;  1X3Z A;  1YUA A;  1QVF Z;  2IV2 X;  3J7A 4;  5C4J I;  4NH1 C;  1X3W A;  3VB9 A;  4E2X A;  4DQY B;  3NDJ A;  3CMA 1;  1K9M 1;  3CCJ 1;  2KI7 B;  4A3I I;  3G71 Z;  4MON A;  1USP A;  3CCV 1;  3H3V J;  2JIR A;  3S2H I;  2V8J A;  2JIM A;  4NBD A;  3G6E Z;  4S1T A;  2JUB A;  1YJN Z;  3CCU 1;  1Q82 2;  1RO4 A;  4BXX I;  1TFI A;  3HOW I;  3CPW Z;  2K3R A;  1YI2 1;  4RS4 A;  1VQ8 Z;  2E2J I;  1W2B Y;  2YU9 I;  2JA8 I;  3S15 I;  1KQS Y;  2W04 A;  5T64 A;  3CCL 1;  3CCE 1;  3CC4 1;  2JIO A;  3BG0 B;  1SFO I;  1VQM 1;  1Z03 A;  2V8I A;  2OOX B;  1I6H I;  2VPY A;  1M1K 1;  1WII A;  2JIP A;  1VQK Z;  3CCS 1;  2E9H A;  4BY7 I;  3ESW A;  1DL6 A;  4RVG A;  2PM9 A;  1Z02 A;  4MD7 A;  1QXF A;  3GTL I;  2RHB A;  3KIH A;  3I56 Z;  3I55 Z;  4E2Z A;  4NB8 A;  4NBG A;  3PO2 I;  3J80 f;  3VMG A;  3S17 I;  3H0G I;  4RV9 A;  1K8A 1;  1P9N A;  2JMO A;  3CD6 1;  2JS4 A;  2Y0S A;  3NH8 A;  2QA4 1;  2GTI A;  2E2I I;  4A3K I;  3CCQ 1;  1RO0 A;  1K83 I;  3PO3 I;  2NVQ I;  1ML8 A;  3HOZ I;  1NJI 2;  5FLX f;  2F4O A;  3QWU A;  1VLA A;  4EWC A;  4E2Y A;  2E2H I;  3I4N I;  4A3B I;  2HF1 A;  4NBC A;  3G71 1;  1VQO 1;  2RT9 A;  1Z01 A;  1YJW Z;  3S1Q I;  2LEX A;  3G6E 1;  5C3E I;  1S72 Z;  4A3L I;  3M3Y I;  4Y52 I;  4E2W A;  3LUS A;  1Y8C A;  1Q82 1;  2QR1 B;  1YJN 1;  2LIY A;  2M6N A;  1ZH1 A;  3RZO I;  3M4O I;  3NH4 A;  1FDO A;  3BG1 B;  1W2B Z;  2OTL Z;  1VQ8 1;  4QTU A;  1KQS Z;  4X6A I;  5T6B A;  1VQ9 Z;  2OOY B;  2QKD A;  3K7A I;  1JJ2 Z;  3J80 b;  2OTJ Z;  5D1O B;  4NBB A;  1YHQ Z;  2BJO A;  3CC2 Z;  1KRL A;  5LL6 f;  2AYD A;  3CME 1;  1S7M A;  3HOU I;  5IP7 I;  5D1P A;  4MXU A;  4NBA A;  3I55 1;  2W03 A;  3P5J B;  1L1O C;  1Y1W I;  3CCM Z;  1VQN 1;  2J6A A;  5FLX b;  2HU9 A;  2QEX Z;  2GTH A;  4NB9 A;  1K73 1;  3GTQ I;  5IP9 I;  3VMI A;  2OZK A;  1NJI 1;  3GTO I;  4E33 A;  2G2K A;  2NAP A;  1TWA I;  4A3D I;  1JJ2 Y;  2ZAE B;  2YAD A;  4Y7N I;  1Q7Y 2;  2VUG A;  5C4X I;  1Q81 2;  2E7Z A;  3GKQ A;  1YJW 1;  3CC7 Z; 
#chains in the Genus database with same CATH homology
 1M90 1;  3F3P C;  1PFT A;  3I07 A;  3NDI A;  4BBS I;  4AYB A;  3GTM I;  1QVG Y;  1RLY A;  1Q86 1;  3JAM f;  1I50 I;  1WW9 A;  2M48 A;  1VQ4 Z;  2JA6 I;  3S2D I;  1K9M 2;  3CCV Z;  4CL1 A;  4BY1 I;  2OTL 1;  1YJ9 Z;  2R7Z I;  3D6W A;  3U50 C;  1Y1V S;  2IZ4 A;  5T67 A;  1KD1 2;  5C44 I;  3GTG I;  3CCR Z;  2R92 I;  2NVT I;  1VQ9 1;  3S1R I;  5D1O A;  3G4S Z;  1VQ5 Z;  4NOZ A;  3FKI I;  3VTN A;  2OTJ 1;  2K5R A;  1YIJ Z;  3TDH B;  4QTT A;  5AN9 F;  2F4M A;  1RQF A;  4XX2 A;  1YHQ 1;  3MON A;  4BBR I;  3CC2 1;  3CCE Z;  3VMH A;  1ZB9 A;  2O4H A;  3GCF A;  2DE5 A;  2QRD B;  4DK1 A;  2RPR A;  2DE6 A;  3CCM 1;  1M1K 2;  1TWC I;  5CM2 M;  4A3J I;  3OW2 Y;  2QEX 1;  4NBH A;  1VQ7 Z;  2QRC B;  3HKZ A;  2WAQ A;  2H85 A;  3F3F C;  4DGL A;  4MD8 A;  1YUK A;  4A3C I;  4MD9 A;  1X0T A;  2B63 I;  3CQZ I;  1N8R 2;  2QA4 Z;  3HOY I;  1VQ6 Z;  2RBL A;  1VQK 1;  1RO2 A;  3NFZ A;  3CXC Y;  1VQL Z;  2KPI A;  3JAM b;  1Q81 1;  1NP6 A;  5IT9 b;  3RZD I;  4NBF A;  2P3Y A;  3I56 1;  3CC7 1;  3I4M I;  1QVG Z;  2PMZ A;  1KC8 2;  3J81 f;  4HH4 A;  3GTP I;  3S1M I;  1VQ4 1;  2O53 A;  1WCM I;  1VQO Z;  2V8K A;  3GTK I;  3Q87 A;  1ZB8 A;  3EER A;  1YJ9 1;  2NVY I;  3S14 I;  2P28 A;  1YIT Z;  2IZ3 A;  1KD1 1;  1NUI A;  4NBE A;  3CCR 1;  2R6M A;  1QYP A;  2JA7 I;  1N2F A;  4A3G I;  3G4S 1;  1VQ5 1;  1TWG I;  1VQP Z;  2RIQ A;  3KIF A;  3FQM A;  3IX0 A;  2AKL A;  3S1N I;  1YIJ 1;  4MRI A;  3IF8 A;  3GTM S;  3TE5 B;  4HGZ A;  3IFU A;  5A2Q f;  4E31 A;  1S72 1;  2NVX I;  1QVF Y;  1TWH I;  2WB1 A;  2Q51 A;  3CMA Z;  3CCJ Z;  3FQQ A;  3PO3 S;  2LFU A;  3OW2 Z;  5IT9 f;  2QRE B;  3EED A;  3CME Z;  1USP B;  1VQ7 1;  2JR6 A;  3T4N B;  4A93 I;  1LQL A;  2VUM I;  3CCU Z;  4A3F I;  4A3E I;  3D9X A;  4RVD A;  1VQN Z;  4HGY A;  1N8R 1;  4MH4 A;  3CPW Y;  2R93 I;  1YI2 Z;  4TNU A;  3S16 I;  2JA5 I;  3J81 b;  3CXC Z;  1VQ6 1;  1K73 2;  1VQL 1;  3CCL Z;  1QF8 A;  3CC4 Z;  3HOV I;  1RNI A;  2PK7 A;  2VF1 A;  4RVF A;  1VQM Z;  2EGT A;  1KC8 1;  1Y1V I;  3NH5 A;  2QLV B;  2Q4Z A;  3CCS Z;  2I3C A;  1I3Q I;  3GTJ I;  4E30 A;  2GU2 A;  5FLM I;  2DE7 A;  1M90 2;  3HOX I;  1YIT 1;  4E32 A;  3CD6 Z;  5A2Q b;  1JWH C;  4RVH A;  1K8A 2;  1Q86 2;  1TWF I;  3MZL B;  3MZK B;  4A3M I;  3CCQ Z;  1Q7Y 1;  1VQP 1;  2JNY A;  4NFR A;  1R9T I;  1X3Z A;  1YUA A;  1QVF Z;  3J7A 4;  5C4J I;  4NH1 C;  1X3W A;  3VB9 A;  4E2X A;  4DQY B;  3NDJ A;  3CMA 1;  1K9M 1;  3CCJ 1;  2KI7 B;  4A3I I;  3G71 Z;  4MON A;  1USP A;  3CCV 1;  3H3V J;  3S2H I;  2V8J A;  4NBD A;  3G6E Z;  4S1T A;  2JUB A;  1YJN Z;  3CCU 1;  1Q82 2;  1RO4 A;  4BXX I;  1TFI A;  3HOW I;  3CPW Z;  2K3R A;  1YI2 1;  4RS4 A;  1VQ8 Z;  2E2J I;  1W2B Y;  2YU9 I;  2JA8 I;  3S15 I;  1KQS Y;  2W04 A;  5T64 A;  3CCL 1;  3CCE 1;  3CC4 1;  3BG0 B;  1SFO I;  1VQM 1;  1Z03 A;  2V8I A;  2OOX B;  1I6H I;  1M1K 1;  1WII A;  1VQK Z;  3CCS 1;  2E9H A;  4BY7 I;  3ESW A;  1DL6 A;  4RVG A;  2PM9 A;  1Z02 A;  4MD7 A;  3GTL I;  2RHB A;  3KIH A;  3I56 Z;  3I55 Z;  4E2Z A;  4NB8 A;  4NBG A;  3PO2 I;  3J80 f;  3VMG A;  3S17 I;  3H0G I;  4RV9 A;  1K8A 1;  1P9N A;  2JMO A;  3CD6 1;  2JS4 A;  2Y0S A;  3NH8 A;  2QA4 1;  2GTI A;  2E2I I;  4A3K I;  3CCQ 1;  1RO0 A;  1K83 I;  3PO3 I;  2NVQ I;  1ML8 A;  3HOZ I;  1NJI 2;  5FLX f;  2F4O A;  3QWU A;  1VLA A;  4EWC A;  4E2Y A;  2E2H I;  3I4N I;  4A3B I;  2HF1 A;  4NBC A;  3G71 1;  1VQO 1;  2RT9 A;  1Z01 A;  1YJW Z;  3S1Q I;  1S72 Z;  3G6E 1;  5C3E I;  4A3L I;  3M3Y I;  4Y52 I;  4E2W A;  3LUS A;  1Q82 1;  2QR1 B;  1YJN 1;  2LIY A;  2M6N A;  1ZH1 A;  3RZO I;  3M4O I;  3NH4 A;  3BG1 B;  1W2B Z;  2OTL Z;  1VQ8 1;  4QTU A;  1KQS Z;  4X6A I;  5T6B A;  1VQ9 Z;  2OOY B;  2QKD A;  3K7A I;  1JJ2 Z;  3J80 b;  2OTJ Z;  5D1O B;  4NBB A;  1YHQ Z;  2BJO A;  3CC2 Z;  1KRL A;  5LL6 f;  3CME 1;  1S7M A;  3HOU I;  5IP7 I;  5D1P A;  4MXU A;  4NBA A;  3I55 1;  2W03 A;  3P5J B;  1L1O C;  1Y1W I;  3CCM Z;  1VQN 1;  2J6A A;  5FLX b;  2HU9 A;  2QEX Z;  2GTH A;  4NB9 A;  1K73 1;  3GTQ I;  5IP9 I;  3VMI A;  2OZK A;  1NJI 1;  3GTO I;  4E33 A;  2G2K A;  1TWA I;  4A3D I;  1JJ2 Y;  2ZAE B;  2YAD A;  4Y7N I;  1Q7Y 2;  2VUG A;  5C4X I;  1Q81 2;  3GKQ A;  1YJW 1;  3CC7 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...