3CPWZ

The structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
publication title Crystal Structure of the Oxazolidinone Antibiotic Linezolid Bound to the 50S Ribosomal Subunit
pubmed doi rcsb
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cpwZ00
1JJ2Z 3I551 3OW2Z 1VQLZ 3CCL1 3CMEZ 1K732 3CCVZ 1YIJ1 3I56Z 1K731 1K8A2 1VQOZ 1QVFY 3CMA1 3CCR1 2QA41 1YJW1 3OW2Y 3CCEZ 3CCQZ 3CC71 1W2BZ 1M1K1 1KC82 3CD6Z 1VQP1 3G6EZ 1YJN1 1QVFZ 1VQ4Z 1VQ51 1KC81 1VQ61 1N8R2 1VQ8Z 1S72Z 1VQ7Z 1N8R1 1YIT1 1VQNZ 3CC4Z 1W2BY 3G711 1VQMZ 1YJ9Z 3CCUZ 2QEX1 3CCSZ 1VQ91 3CCJZ 1M1K2 1VQKZ 3CME1 1Q7Y2 3CCV1 3CMAZ 2QA4Z 1Q7Y1 1VQO1 2OTJZ 3CPWZ 1QVGY 1YI2Z 3CCMZ 1K9M1 3G4SZ 1VQPZ 3CCE1 2OTLZ 3CCQ1 3CC2Z 1YHQZ 3CD61 3G6E1 3I55Z 3CCLZ 1VQ41 1QVGZ 1Q862 3CPWY 1YIJZ 1NJI2 1VQ81 1VQL1 1VQ71 1Q861 2QEXZ 1NJI1 1VQN1 3CC41 3I561 3CCRZ 1YJWZ 1VQM1 1K9M2 1YJ91 3CCU1 1KQSY 3CCS1 3CC7Z 3CCJ1 1VQK1 1YJNZ 1Q822 1VQ5Z 1VQ6Z 3CXCY 1K8A1 1KD12 1JJ2Y 1Q821 1KQSZ 1Q812 2OTJ1 1YITZ 1KD11 1YI21 3CCM1 1S721 1M902 3G4S1 3G71Z 2OTL1 1Q811 3CC21 1YHQ1 1M901 3CXCZ 1VQ9Z
chains in the Genus database with same CATH superfamily
1NP6A 4NB8A 4E2ZA 3I551 3OW2Z 3U50C 2RHBA 4QTTA 4NBCA 1K731 1VQOZ 4RV9A 2QRCB 1RQFA 2QA41 1YJW1 1Y1WI 3GTMS 2RPRA 4HH4A 1RO0A 4A3MI 2WAQA 3FKII 1JWHC 4RVDA 1M1K1 3VB9A 3CD6Z 3G6EZ 3J80f 1I50I 1TWFI 1YJN1 3GTLI 1VQ51 1KC81 4MH4A 1N8R2 1VQ8Z 1VQ7Z 5IT9b 3KIFA 2H85A 5FLXf 4MRIA 1YIT1 1VQNZ 1SFOI 1W2BY 1ZB8A 4E2XA 3MZKB 2JA7I 1RLYA 3CCSZ 3I4NI 2IZ4A 3S2HI 1QF8A 2JA8I 5T6BA 1SIWA 1LQLA 3PO2I 1VLAA 4S1TA 4E2YA 2QA4Z 4A3CI 1Y1VS 2V3VA 2JS4A 2DE7A 2OTJZ 2V8IA 1NUIA 2DE6A 3CCMZ 4E33A 1WJ2A 3CCQ1 3CC2Z 5D1OA 2AYDA 2PK7A 4MXUA 2M48A 5FLMI 1Q862 1NJI2 1TWGI 3D9XA 1VQL1 4A3DI 1Z01A 3TDHB 2E7ZA 4DQYB 2VPXA 5C4JI 3VTNA 1VQM1 2JNYA 3CC7Z 2NVQI 3H0GI 3IX0A 3CXCY 3J80b 3TE5B 3GTMI 1S721 3G71Z 2OTL1 1Q811 5FLXb 1VQ9Z 2WB1A 1JJ2Z 1VQLZ 3MZLB 2K3RA 3CCVZ 1YIJ1 3ESWA 3NDIA 3IF8A 4QTUA 4XX2A 2B63I 4TNUA 2AKLA 2VUGA 3FQQA 2E2HI 2JIMA 2JUBA 1VQP1 3S1QI 2KPIA 2QRDB 1QYPA 1QVFZ 4BBRI 1VQ61 3GTJI 1Y1VI 1S72Z 4NBAA 1DL6A 1S7MA 4A3GI 3CC4Z 1Z02A 3S16I 1WW9A 1YJ9Z 3CCUZ 2OOXB 1WCMI 2VPZA 2EGTA 2W04A 1VQKZ 3CME1 4X6AI 1Q7Y2 3J7A4 3J81f 3EEDA 2QR1B 4DGLA 3KIHA 3FQMA 5AN9F 5A2Qf 1M901 3G4SZ 1VQPZ 3CCE1 2V8JA 2NVTI 1YUAA 1RO2A 1YHQZ 2LIYA 2JIPA 1AA6A 3VMHA 3I55Z 5LL6f 1VQ41 1K83I 2OOYB 5T67A 2LFUA 3CPWY 1QXFA 1X3WA 4MD9A 5C3EI 2BJOA 2LEXA 3M3YI 3I561 2GTHA 1YJWZ 1TWAI 1K9M2 1I6HI 3PO3S 3CCJ1 3Q87A 1R9TI 2JA6I 1YJNZ 1Q822 1ZB9A 4CL1A 1VQ5Z 4RVGA 4NBGA 1KD12 1JJ2Y 4HGYA 1WIIA 4Y52I 3GTQI 1USPA 1YITZ 3HOXI 1YI21 4NH1C 4RVHA 1M902 3IR7A 3GTPI 3RZDI 3D6WA 3CCL1 3S1NI 4A3LI 1K732 2J6AA 3S1MI 2QLVB 2K5RA 3I56Z 3J81b 2O4HA 1QVFY 5IP9I 3CMA1 3CCR1 2O53A 4HGZA 1ZH1A 3OW2Y 2VUMI 3CCQZ 1X0TA 2RBLA 2HU9A 5A2Qb 1W2BZ 1KC82 3NH4A 3MONA 3I07A 4BY1I 1I3QI 1N8R1 4A3FI 3M4OI 2PMZA 1L1OC 4NBBA 1VQMZ 2IZ3A 2QEX1 2R92I 4AYBA 3RZOI 2JA5I 2W03A 2V45A 3IFUA 4BBSI 4BXXI 3CMAZ 1VQO1 2I3CA 3GTGI 3GTKI 1K9M1 1X3ZA 1FDOA 3T4NB 2OTLZ 3PO3I 1Q16A 3JAMf 4RS4A 3HKZA 3S17I 3CD61 2JIRA 4NB9A 2IV2X 3G6E1 2Y0SA 1QVGZ 1YIJZ 1VQ81 2R7ZI 1TWCI 2R93I 1VQ71 1Q861 2QEXZ 1NJI1 4NFRA 3NH8A 1VQN1 1PFTA 2YADA 4E30A 3CCS1 4A3BI 2P3YA 3S15I 5C4XI 2P28A 3NDJA 2GU2A 3EERA 2E2JI 2V8KA 4NBEA 1VQ6Z 5T64A 2M6NA 1KQSZ 3QWUA 2JIOA 1Q812 4RVFA 2OTJ1 4E2WA 2VPYA 3CCM1 2YU9I 3CC21 3VMIA 3GCFA 2NAPA 4E32A 2JMOA 2DE5A 4E31A 3HOUI 4MD7A 1P9NA 3CMEZ 2Q51A 5D1OB 3LUSA 4A3II 1K8A2 1USPB 1Z03A 2F4OA 1RO4A 3CCEZ 3CC71 3S14I 3I4MI 3VMGA 4MD8A 3JAMb 2KI7B 1VQ4Z 2QKDA 3GTOI 5C44I 3S1RI 1FDIA 3BG0B 4BY7I 4NOZA 2E9HA 3G711 2R6MA 2OZKA 1TWHI 4NBDA 1VQ91 3CCJZ 3K7AI 3D2LA 4EWCA 1RNIA 1M1K2 5IP7I 2NVXI 2VPWA 3CCV1 1TFIA 2NVYI 4A93I 2QREB 2G2KA 1ML8A 1Q7Y1 4A3JI 1YUKA 3F3FC 3CPWZ 3HOZI 1QVGY 1YI2Z 3NFZA 3HOYI 2F4MA 2JIQA 3CQZI 3HOWI 3GKQA 5D1PA 3CCLZ 3HOVI 4MONA 4A3EI 1Y8CA 5IT9f 4Y7NI 3H3VJ 2JR6A 3S2DI 5CM2M 3CC41 3CCRZ 2GTIA 2HF1A 3NH5A 2ZAEB 3F3PC 3BG1B 1YJ91 3CCU1 1KQSY 4DK1A 1VQK1 2RIQA 1KRLA 1WZNA 1N2FA 1K8A1 2Q4ZA 1Q821 4NBHA 2E2II 4NBFA 2RT9A 2VF1A 1KD11 3P5JB 3G4S1 1YHQ1 4A3KI 2PM9A 3CXCZ
chains in the Genus database with same CATH topology
1NP6A 4NB8A 4E2ZA 3I551 3OW2Z 3U50C 2RHBA 4QTTA 4NBCA 1K731 1VQOZ 4RV9A 2QRCB 1RQFA 2QA41 1YJW1 1Y1WI 3GTMS 2RPRA 4HH4A 1RO0A 4A3MI 2WAQA 3FKII 1JWHC 4RVDA 1M1K1 3VB9A 3CD6Z 3G6EZ 3J80f 1I50I 1TWFI 1YJN1 3GTLI 1VQ51 1KC81 4MH4A 1N8R2 1VQ8Z 1VQ7Z 5IT9b 3KIFA 2H85A 5FLXf 4MRIA 1YIT1 1VQNZ 1SFOI 1W2BY 1ZB8A 4E2XA 3MZKB 2JA7I 1RLYA 3CCSZ 3I4NI 2IZ4A 3S2HI 1QF8A 2JA8I 5T6BA 1LQLA 3PO2I 1VLAA 4S1TA 4E2YA 2QA4Z 4A3CI 1Y1VS 2JS4A 2DE7A 2OTJZ 2V8IA 1NUIA 2DE6A 3CCMZ 4E33A 3CCQ1 3CC2Z 5D1OA 2PK7A 4MXUA 2M48A 5FLMI 1Q862 1NJI2 1TWGI 3D9XA 1VQL1 4A3DI 1Z01A 3TDHB 4DQYB 5C4JI 3VTNA 1VQM1 2JNYA 3CC7Z 2NVQI 3H0GI 3IX0A 3CXCY 3J80b 3TE5B 3GTMI 1S721 3G71Z 2OTL1 1Q811 5FLXb 1VQ9Z 2WB1A 1JJ2Z 1VQLZ 3MZLB 2K3RA 3CCVZ 1YIJ1 3ESWA 3NDIA 3IF8A 4QTUA 4XX2A 2B63I 4TNUA 2AKLA 2VUGA 3FQQA 2E2HI 3S1QI 2JUBA 1VQP1 2KPIA 2QRDB 1QYPA 1QVFZ 4BBRI 1VQ61 3GTJI 1Y1VI 1S72Z 4NBAA 1DL6A 1S7MA 4A3GI 3CC4Z 1Z02A 3S16I 1WW9A 1YJ9Z 3CCUZ 2OOXB 1WCMI 2W04A 2EGTA 1VQKZ 3CME1 4X6AI 1Q7Y2 3J7A4 3J81f 3EEDA 2QR1B 4DGLA 3KIHA 3FQMA 5AN9F 5A2Qf 1M901 3G4SZ 1VQPZ 3CCE1 2V8JA 2NVTI 1YUAA 1RO2A 1YHQZ 2LIYA 3VMHA 3I55Z 5LL6f 1VQ41 1K83I 2OOYB 5T67A 2LFUA 3CPWY 1X3WA 4MD9A 5C3EI 2BJOA 3M3YI 3I561 2GTHA 1YJWZ 1TWAI 1K9M2 1I6HI 3PO3S 3CCJ1 3Q87A 1R9TI 2JA6I 1YJNZ 1Q822 1ZB9A 4CL1A 1VQ5Z 4RVGA 4NBGA 1KD12 1JJ2Y 4HGYA 1WIIA 4Y52I 3GTQI 1USPA 1YITZ 3HOXI 1YI21 4NH1C 4RVHA 1M902 3GTPI 3RZDI 3D6WA 3CCL1 3S1NI 4A3LI 1K732 2J6AA 3S1MI 2QLVB 2K5RA 3I56Z 3J81b 2O4HA 1QVFY 5IP9I 3CMA1 3CCR1 2O53A 4HGZA 3OW2Y 1ZH1A 2VUMI 3CCQZ 1X0TA 2RBLA 2HU9A 5A2Qb 1W2BZ 1KC82 3NH4A 3MONA 3I07A 4BY1I 1I3QI 1N8R1 4A3FI 3M4OI 2PMZA 1L1OC 4NBBA 1VQMZ 2IZ3A 2QEX1 2R92I 4AYBA 3RZOI 2JA5I 2W03A 3IFUA 4BBSI 4BXXI 3CMAZ 1VQO1 2I3CA 3GTGI 3GTKI 1K9M1 1X3ZA 3T4NB 2OTLZ 3PO3I 3JAMf 4RS4A 3HKZA 3S17I 3CD61 4NB9A 3G6E1 2Y0SA 1QVGZ 1YIJZ 1VQ81 2R7ZI 1TWCI 2R93I 1VQ71 1Q861 2QEXZ 1NJI1 4NFRA 3NH8A 1VQN1 1PFTA 2YADA 4E30A 3CCS1 4A3BI 2P3YA 3S15I 5C4XI 2P28A 3NDJA 2GU2A 3EERA 2E2JI 2V8KA 4NBEA 1VQ6Z 5T64A 2M6NA 1KQSZ 3QWUA 1Q812 4RVFA 2OTJ1 4E2WA 3CCM1 2YU9I 3CC21 3VMIA 3GCFA 4E32A 2JMOA 2DE5A 4E31A 3HOUI 4MD7A 1P9NA 3CMEZ 2Q51A 5D1OB 3LUSA 4A3II 1K8A2 1USPB 1Z03A 2F4OA 1RO4A 3CCEZ 3CC71 3S14I 3I4MI 3VMGA 4MD8A 3JAMb 2KI7B 1VQ4Z 2QKDA 3GTOI 5C44I 3S1RI 3BG0B 4BY7I 4NOZA 2E9HA 3G711 2R6MA 2OZKA 1TWHI 4NBDA 1VQ91 3CCJZ 3K7AI 4EWCA 1RNIA 1M1K2 5IP7I 2NVXI 3CCV1 1TFIA 2NVYI 4A93I 2QREB 2G2KA 1ML8A 1Q7Y1 4A3JI 1YUKA 3F3FC 3CPWZ 3HOZI 1QVGY 1YI2Z 3NFZA 3HOYI 2F4MA 3CQZI 3HOWI 3GKQA 5D1PA 3CCLZ 3HOVI 4MONA 4A3EI 5IT9f 4Y7NI 3H3VJ 2JR6A 3S2DI 5CM2M 3CC41 2GTIA 3CCRZ 2HF1A 3NH5A 2ZAEB 3F3PC 3BG1B 1YJ91 3CCU1 1KQSY 4DK1A 1VQK1 2RIQA 1KRLA 1N2FA 1K8A1 2Q4ZA 1Q821 4NBHA 2E2II 4NBFA 2RT9A 2VF1A 1KD11 3P5JB 3G4S1 1YHQ1 4A3KI 2PM9A 3CXCZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JJ2 Z;  3I55 1;  3OW2 Z;  1VQL Z;  3CCL 1;  3CME Z;  1K73 2;  3CCV Z;  1YIJ 1;  3I56 Z;  1K73 1;  1K8A 2;  1VQO Z;  1QVF Y;  3CMA 1;  3CCR 1;  2QA4 1;  1YJW 1;  3OW2 Y;  3CCE Z;  3CCQ Z;  3CC7 1;  1W2B Z;  1M1K 1;  1KC8 2;  3CD6 Z;  1VQP 1;  3G6E Z;  1YJN 1;  1QVF Z;  1VQ4 Z;  1VQ5 1;  1KC8 1;  1VQ6 1;  1N8R 2;  1VQ8 Z;  1S72 Z;  1VQ7 Z;  1N8R 1;  1YIT 1;  1VQN Z;  3CC4 Z;  1W2B Y;  3G71 1;  1VQM Z;  1YJ9 Z;  3CCU Z;  2QEX 1;  3CCS Z;  1VQ9 1;  3CCJ Z;  1M1K 2;  1VQK Z;  3CME 1;  1Q7Y 2;  3CCV 1;  3CMA Z;  2QA4 Z;  1Q7Y 1;  1VQO 1;  2OTJ Z;  3CPW Z;  1QVG Y;  1YI2 Z;  3CCM Z;  1K9M 1;  3G4S Z;  1VQP Z;  3CCE 1;  2OTL Z;  3CCQ 1;  3CC2 Z;  1YHQ Z;  3CD6 1;  3G6E 1;  3I55 Z;  3CCL Z;  1VQ4 1;  1QVG Z;  1Q86 2;  3CPW Y;  1YIJ Z;  1NJI 2;  1VQ8 1;  1VQL 1;  1VQ7 1;  1Q86 1;  2QEX Z;  1NJI 1;  1VQN 1;  3CC4 1;  3I56 1;  3CCR Z;  1YJW Z;  1VQM 1;  1K9M 2;  1YJ9 1;  3CCU 1;  1KQS Y;  3CCS 1;  3CC7 Z;  3CCJ 1;  1VQK 1;  1YJN Z;  1Q82 2;  1VQ5 Z;  1VQ6 Z;  3CXC Y;  1K8A 1;  1KD1 2;  1JJ2 Y;  1Q82 1;  1KQS Z;  1Q81 2;  2OTJ 1;  1YIT Z;  1KD1 1;  1YI2 1;  3CCM 1;  1S72 1;  1M90 2;  3G4S 1;  3G71 Z;  2OTL 1;  1Q81 1;  3CC2 1;  1YHQ 1;  1M90 1;  3CXC Z;  1VQ9 Z; 
#chains in the Genus database with same CATH topology
 1NP6 A;  4NB8 A;  4E2Z A;  3I55 1;  3OW2 Z;  3U50 C;  2RHB A;  4QTT A;  4NBC A;  1K73 1;  1VQO Z;  4RV9 A;  2QRC B;  1RQF A;  2QA4 1;  1YJW 1;  1Y1W I;  3GTM S;  2RPR A;  4HH4 A;  1RO0 A;  4A3M I;  2WAQ A;  3FKI I;  1JWH C;  4RVD A;  1M1K 1;  3VB9 A;  3CD6 Z;  3G6E Z;  3J80 f;  1I50 I;  1TWF I;  1YJN 1;  3GTL I;  1VQ5 1;  1KC8 1;  4MH4 A;  1N8R 2;  1VQ8 Z;  1VQ7 Z;  5IT9 b;  3KIF A;  2H85 A;  5FLX f;  4MRI A;  1YIT 1;  1VQN Z;  1SFO I;  1W2B Y;  1ZB8 A;  4E2X A;  3MZK B;  2JA7 I;  1RLY A;  3CCS Z;  3I4N I;  2IZ4 A;  3S2H I;  1QF8 A;  2JA8 I;  5T6B A;  1SIW A;  1LQL A;  3PO2 I;  1VLA A;  4S1T A;  4E2Y A;  2QA4 Z;  4A3C I;  1Y1V S;  2V3V A;  2JS4 A;  2DE7 A;  2OTJ Z;  2V8I A;  1NUI A;  2DE6 A;  3CCM Z;  4E33 A;  1WJ2 A;  3CCQ 1;  3CC2 Z;  5D1O A;  2AYD A;  2PK7 A;  4MXU A;  2M48 A;  5FLM I;  1Q86 2;  1NJI 2;  1TWG I;  3D9X A;  1VQL 1;  4A3D I;  1Z01 A;  3TDH B;  2E7Z A;  4DQY B;  2VPX A;  5C4J I;  3VTN A;  1VQM 1;  2JNY A;  3CC7 Z;  2NVQ I;  3H0G I;  3IX0 A;  3CXC Y;  3J80 b;  3TE5 B;  3GTM I;  1S72 1;  3G71 Z;  2OTL 1;  1Q81 1;  5FLX b;  1VQ9 Z;  2WB1 A;  1JJ2 Z;  1VQL Z;  3MZL B;  2K3R A;  3CCV Z;  1YIJ 1;  3ESW A;  3NDI A;  3IF8 A;  4QTU A;  4XX2 A;  2B63 I;  4TNU A;  2AKL A;  2VUG A;  3FQQ A;  2E2H I;  2JIM A;  2JUB A;  1VQP 1;  3S1Q I;  2KPI A;  2QRD B;  1QYP A;  1QVF Z;  4BBR I;  1VQ6 1;  3GTJ I;  1Y1V I;  1S72 Z;  4NBA A;  1DL6 A;  1S7M A;  4A3G I;  3CC4 Z;  1Z02 A;  3S16 I;  1WW9 A;  1YJ9 Z;  3CCU Z;  2OOX B;  1WCM I;  2VPZ A;  2EGT A;  2W04 A;  1VQK Z;  3CME 1;  4X6A I;  1Q7Y 2;  3J7A 4;  3J81 f;  3EED A;  2QR1 B;  4DGL A;  3KIH A;  3FQM A;  5AN9 F;  5A2Q f;  1M90 1;  3G4S Z;  1VQP Z;  3CCE 1;  2V8J A;  2NVT I;  1YUA A;  1RO2 A;  1YHQ Z;  2LIY A;  2JIP A;  1AA6 A;  3VMH A;  3I55 Z;  5LL6 f;  1VQ4 1;  1K83 I;  2OOY B;  5T67 A;  2LFU A;  3CPW Y;  1QXF A;  1X3W A;  4MD9 A;  5C3E I;  2BJO A;  2LEX A;  3M3Y I;  3I56 1;  2GTH A;  1YJW Z;  1TWA I;  1K9M 2;  1I6H I;  3PO3 S;  3CCJ 1;  3Q87 A;  1R9T I;  2JA6 I;  1YJN Z;  1Q82 2;  1ZB9 A;  4CL1 A;  1VQ5 Z;  4RVG A;  4NBG A;  1KD1 2;  1JJ2 Y;  4HGY A;  1WII A;  4Y52 I;  3GTQ I;  1USP A;  1YIT Z;  3HOX I;  1YI2 1;  4NH1 C;  4RVH A;  1M90 2;  3IR7 A;  3GTP I;  3RZD I;  3D6W A;  3CCL 1;  3S1N I;  4A3L I;  1K73 2;  2J6A A;  3S1M I;  2QLV B;  2K5R A;  3I56 Z;  3J81 b;  2O4H A;  1QVF Y;  5IP9 I;  3CMA 1;  3CCR 1;  2O53 A;  4HGZ A;  1ZH1 A;  3OW2 Y;  2VUM I;  3CCQ Z;  1X0T A;  2RBL A;  2HU9 A;  5A2Q b;  1W2B Z;  1KC8 2;  3NH4 A;  3MON A;  3I07 A;  4BY1 I;  1I3Q I;  1N8R 1;  4A3F I;  3M4O I;  2PMZ A;  1L1O C;  4NBB A;  1VQM Z;  2IZ3 A;  2QEX 1;  2R92 I;  4AYB A;  3RZO I;  2JA5 I;  2W03 A;  2V45 A;  3IFU A;  4BBS I;  4BXX I;  3CMA Z;  1VQO 1;  2I3C A;  3GTG I;  3GTK I;  1K9M 1;  1X3Z A;  1FDO A;  3T4N B;  2OTL Z;  3PO3 I;  1Q16 A;  3JAM f;  4RS4 A;  3HKZ A;  3S17 I;  3CD6 1;  2JIR A;  4NB9 A;  2IV2 X;  3G6E 1;  2Y0S A;  1QVG Z;  1YIJ Z;  1VQ8 1;  2R7Z I;  1TWC I;  2R93 I;  1VQ7 1;  1Q86 1;  2QEX Z;  1NJI 1;  4NFR A;  3NH8 A;  1VQN 1;  1PFT A;  2YAD A;  4E30 A;  3CCS 1;  4A3B I;  2P3Y A;  3S15 I;  5C4X I;  2P28 A;  3NDJ A;  2GU2 A;  3EER A;  2E2J I;  2V8K A;  4NBE A;  1VQ6 Z;  5T64 A;  2M6N A;  1KQS Z;  3QWU A;  2JIO A;  1Q81 2;  4RVF A;  2OTJ 1;  4E2W A;  2VPY A;  3CCM 1;  2YU9 I;  3CC2 1;  3VMI A;  3GCF A;  2NAP A;  4E32 A;  2JMO A;  2DE5 A;  4E31 A;  3HOU I;  4MD7 A;  1P9N A;  3CME Z;  2Q51 A;  5D1O B;  3LUS A;  4A3I I;  1K8A 2;  1USP B;  1Z03 A;  2F4O A;  1RO4 A;  3CCE Z;  3CC7 1;  3S14 I;  3I4M I;  3VMG A;  4MD8 A;  3JAM b;  2KI7 B;  1VQ4 Z;  2QKD A;  3GTO I;  5C44 I;  3S1R I;  1FDI A;  3BG0 B;  4BY7 I;  4NOZ A;  2E9H A;  3G71 1;  2R6M A;  2OZK A;  1TWH I;  4NBD A;  1VQ9 1;  3CCJ Z;  3K7A I;  3D2L A;  4EWC A;  1RNI A;  1M1K 2;  5IP7 I;  2NVX I;  2VPW A;  3CCV 1;  1TFI A;  2NVY I;  4A93 I;  2QRE B;  2G2K A;  1ML8 A;  1Q7Y 1;  4A3J I;  1YUK A;  3F3F C;  3CPW Z;  3HOZ I;  1QVG Y;  1YI2 Z;  3NFZ A;  3HOY I;  2F4M A;  2JIQ A;  3CQZ I;  3HOW I;  3GKQ A;  5D1P A;  3CCL Z;  3HOV I;  4MON A;  4A3E I;  1Y8C A;  5IT9 f;  4Y7N I;  3H3V J;  2JR6 A;  3S2D I;  5CM2 M;  3CC4 1;  3CCR Z;  2GTI A;  2HF1 A;  3NH5 A;  2ZAE B;  3F3P C;  3BG1 B;  1YJ9 1;  3CCU 1;  1KQS Y;  4DK1 A;  1VQK 1;  2RIQ A;  1KRL A;  1WZN A;  1N2F A;  1K8A 1;  2Q4Z A;  1Q82 1;  4NBH A;  2E2I I;  4NBF A;  2RT9 A;  2VF1 A;  1KD1 1;  3P5J B;  3G4S 1;  1YHQ 1;  4A3K I;  2PM9 A;  3CXC Z; 
#chains in the Genus database with same CATH homology
 1NP6 A;  4NB8 A;  4E2Z A;  3I55 1;  3OW2 Z;  3U50 C;  2RHB A;  4QTT A;  4NBC A;  1K73 1;  1VQO Z;  4RV9 A;  2QRC B;  1RQF A;  2QA4 1;  1YJW 1;  1Y1W I;  3GTM S;  2RPR A;  4HH4 A;  1RO0 A;  4A3M I;  2WAQ A;  3FKI I;  1JWH C;  4RVD A;  1M1K 1;  3VB9 A;  3CD6 Z;  3G6E Z;  3J80 f;  1I50 I;  1TWF I;  1YJN 1;  3GTL I;  1VQ5 1;  1KC8 1;  4MH4 A;  1N8R 2;  1VQ8 Z;  1VQ7 Z;  5IT9 b;  3KIF A;  2H85 A;  5FLX f;  4MRI A;  1YIT 1;  1VQN Z;  1SFO I;  1W2B Y;  1ZB8 A;  4E2X A;  3MZK B;  2JA7 I;  1RLY A;  3CCS Z;  3I4N I;  2IZ4 A;  3S2H I;  1QF8 A;  2JA8 I;  5T6B A;  1LQL A;  3PO2 I;  1VLA A;  4S1T A;  4E2Y A;  2QA4 Z;  4A3C I;  1Y1V S;  2JS4 A;  2DE7 A;  2OTJ Z;  2V8I A;  1NUI A;  2DE6 A;  3CCM Z;  4E33 A;  3CCQ 1;  3CC2 Z;  5D1O A;  2PK7 A;  4MXU A;  2M48 A;  5FLM I;  1Q86 2;  1NJI 2;  1TWG I;  3D9X A;  1VQL 1;  4A3D I;  1Z01 A;  3TDH B;  4DQY B;  5C4J I;  3VTN A;  1VQM 1;  2JNY A;  3CC7 Z;  2NVQ I;  3H0G I;  3IX0 A;  3CXC Y;  3J80 b;  3TE5 B;  3GTM I;  1S72 1;  3G71 Z;  2OTL 1;  1Q81 1;  5FLX b;  1VQ9 Z;  2WB1 A;  1JJ2 Z;  1VQL Z;  3MZL B;  2K3R A;  3CCV Z;  1YIJ 1;  3ESW A;  3NDI A;  3IF8 A;  4QTU A;  4XX2 A;  2B63 I;  4TNU A;  2AKL A;  2VUG A;  3FQQ A;  2E2H I;  3S1Q I;  2JUB A;  1VQP 1;  2KPI A;  2QRD B;  1QYP A;  1QVF Z;  4BBR I;  1VQ6 1;  3GTJ I;  1Y1V I;  1S72 Z;  4NBA A;  1DL6 A;  1S7M A;  4A3G I;  3CC4 Z;  1Z02 A;  3S16 I;  1WW9 A;  1YJ9 Z;  3CCU Z;  2OOX B;  1WCM I;  2W04 A;  2EGT A;  1VQK Z;  3CME 1;  4X6A I;  1Q7Y 2;  3J7A 4;  3J81 f;  3EED A;  2QR1 B;  4DGL A;  3KIH A;  3FQM A;  5AN9 F;  5A2Q f;  1M90 1;  3G4S Z;  1VQP Z;  3CCE 1;  2V8J A;  2NVT I;  1YUA A;  1RO2 A;  1YHQ Z;  2LIY A;  3VMH A;  3I55 Z;  5LL6 f;  1VQ4 1;  1K83 I;  2OOY B;  5T67 A;  2LFU A;  3CPW Y;  1X3W A;  4MD9 A;  5C3E I;  2BJO A;  3M3Y I;  3I56 1;  2GTH A;  1YJW Z;  1TWA I;  1K9M 2;  1I6H I;  3PO3 S;  3CCJ 1;  3Q87 A;  1R9T I;  2JA6 I;  1YJN Z;  1Q82 2;  1ZB9 A;  4CL1 A;  1VQ5 Z;  4RVG A;  4NBG A;  1KD1 2;  1JJ2 Y;  4HGY A;  1WII A;  4Y52 I;  3GTQ I;  1USP A;  1YIT Z;  3HOX I;  1YI2 1;  4NH1 C;  4RVH A;  1M90 2;  3GTP I;  3RZD I;  3D6W A;  3CCL 1;  3S1N I;  4A3L I;  1K73 2;  2J6A A;  3S1M I;  2QLV B;  2K5R A;  3I56 Z;  3J81 b;  2O4H A;  1QVF Y;  5IP9 I;  3CMA 1;  3CCR 1;  2O53 A;  4HGZ A;  3OW2 Y;  1ZH1 A;  2VUM I;  3CCQ Z;  1X0T A;  2RBL A;  2HU9 A;  5A2Q b;  1W2B Z;  1KC8 2;  3NH4 A;  3MON A;  3I07 A;  4BY1 I;  1I3Q I;  1N8R 1;  4A3F I;  3M4O I;  2PMZ A;  1L1O C;  4NBB A;  1VQM Z;  2IZ3 A;  2QEX 1;  2R92 I;  4AYB A;  3RZO I;  2JA5 I;  2W03 A;  3IFU A;  4BBS I;  4BXX I;  3CMA Z;  1VQO 1;  2I3C A;  3GTG I;  3GTK I;  1K9M 1;  1X3Z A;  3T4N B;  2OTL Z;  3PO3 I;  3JAM f;  4RS4 A;  3HKZ A;  3S17 I;  3CD6 1;  4NB9 A;  3G6E 1;  2Y0S A;  1QVG Z;  1YIJ Z;  1VQ8 1;  2R7Z I;  1TWC I;  2R93 I;  1VQ7 1;  1Q86 1;  2QEX Z;  1NJI 1;  4NFR A;  3NH8 A;  1VQN 1;  1PFT A;  2YAD A;  4E30 A;  3CCS 1;  4A3B I;  2P3Y A;  3S15 I;  5C4X I;  2P28 A;  3NDJ A;  2GU2 A;  3EER A;  2E2J I;  2V8K A;  4NBE A;  1VQ6 Z;  5T64 A;  2M6N A;  1KQS Z;  3QWU A;  1Q81 2;  4RVF A;  2OTJ 1;  4E2W A;  3CCM 1;  2YU9 I;  3CC2 1;  3VMI A;  3GCF A;  4E32 A;  2JMO A;  2DE5 A;  4E31 A;  3HOU I;  4MD7 A;  1P9N A;  3CME Z;  2Q51 A;  5D1O B;  3LUS A;  4A3I I;  1K8A 2;  1USP B;  1Z03 A;  2F4O A;  1RO4 A;  3CCE Z;  3CC7 1;  3S14 I;  3I4M I;  3VMG A;  4MD8 A;  3JAM b;  2KI7 B;  1VQ4 Z;  2QKD A;  3GTO I;  5C44 I;  3S1R I;  3BG0 B;  4BY7 I;  4NOZ A;  2E9H A;  3G71 1;  2R6M A;  2OZK A;  1TWH I;  4NBD A;  1VQ9 1;  3CCJ Z;  3K7A I;  4EWC A;  1RNI A;  1M1K 2;  5IP7 I;  2NVX I;  3CCV 1;  1TFI A;  2NVY I;  4A93 I;  2QRE B;  2G2K A;  1ML8 A;  1Q7Y 1;  4A3J I;  1YUK A;  3F3F C;  3CPW Z;  3HOZ I;  1QVG Y;  1YI2 Z;  3NFZ A;  3HOY I;  2F4M A;  3CQZ I;  3HOW I;  3GKQ A;  5D1P A;  3CCL Z;  3HOV I;  4MON A;  4A3E I;  5IT9 f;  4Y7N I;  3H3V J;  2JR6 A;  3S2D I;  5CM2 M;  3CC4 1;  2GTI A;  3CCR Z;  2HF1 A;  3NH5 A;  2ZAE B;  3F3P C;  3BG1 B;  1YJ9 1;  3CCU 1;  1KQS Y;  4DK1 A;  1VQK 1;  2RIQ A;  1KRL A;  1N2F A;  1K8A 1;  2Q4Z A;  1Q82 1;  4NBH A;  2E2I I;  4NBF A;  2RT9 A;  2VF1 A;  1KD1 1;  3P5J B;  3G4S 1;  1YHQ 1;  4A3K I;  2PM9 A;  3CXC Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...