1QVGZ

Structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1qvgZ00
3I56Z 3CCS1 1YITZ 3CC2Z 1K8A1 3CC4Z 3CCSZ 1Q811 1JJ2Z 1VQ8Z 1M901 3CCUZ 1Q812 3CCRZ 1YJN1 2OTJZ 1KQSZ 1QVFY 1KD11 2OTJ1 1VQNZ 3CC71 1YIJ1 3CXCZ 1NJI1 1QVGY 3CCJ1 2OTLZ 1M902 3CC21 1VQOZ 1YHQ1 1QVGZ 1N8R1 1YJ9Z 1KQSY 2QEX1 2QA4Z 1S721 1VQ9Z 3CXCY 1YIJZ 3CC7Z 1VQK1 1M1K1 1KC81 1YJNZ 3CME1 1VQ91 3OW2Y 1Q7Y2 1K9M1 1Q822 1N8R2 3CPWY 1VQL1 1Q7Y1 1K9M2 1VQM1 1K731 1YIT1 3OW2Z 3CCM1 3G711 1VQ61 3CMAZ 3CCQZ 3CMEZ 1W2BY 1YJW1 1NJI2 3CCL1 3I55Z 1VQP1 3CCV1 3I551 1VQPZ 1Q862 3CPWZ 1S72Z 3CCE1 2QA41 3CD61 1VQ6Z 3CCU1 1Q861 3G71Z 1VQ7Z 1YI21 1VQ81 1YHQZ 1VQ4Z 1VQO1 3CC41 1VQMZ 1W2BZ 1VQ41 1VQLZ 3I561 1VQ51 1M1K2 1YI2Z 1K8A2 3CCJZ 1VQ71 2OTL1 3G4S1 3G6EZ 3CD6Z 3CCEZ 1VQN1 3CCVZ 1VQKZ 1Q821 3CCLZ 1YJWZ 3CCR1 3CCQ1 1K732 3CMA1 3G4SZ 3G6E1 1QVFZ 1JJ2Y 2QEXZ 1KC82 1KD12 1VQ5Z 3CCMZ 1YJ91
chains in the Genus database with same CATH superfamily
3I56Z 2JS4A 3CC4Z 3KIFA 3CCSZ 4DK1A 1M901 1Y1VS 2F4OA 4A3EI 2RHBA 2OTJZ 1QVFY 4E30A 2JA6I 3CC71 1Z03A 5T6BA 1YIJ1 3I4MI 4AYBA 3VTNA 1X3WA 5LL6f 4NBGA 2JIRA 3GTOI 2J6AA 3CC21 1YHQ1 1QVGZ 4A3JI 2PM9A 2WAQA 4NBEA 3F3PC 3JAMb 3M3YI 1YIJZ 4DGLA 3HOWI 5T64A 2VUGA 2Y0SA 1YJNZ 1Y8CA 3OW2Y 1Q822 2QKDA 3IFUA 3CPWY 1VQL1 2HU9A 4A3LI 4A3CI 1I6HI 3G711 1VQ61 1NUIA 2GTHA 1YJW1 3CCL1 1VQP1 3PO3I 5IT9b 2JA8I 3PO3S 3I551 3CPWZ 3NH5A 1S7MA 4E31A 3GTMI 3CD61 1VQ6Z 2OOYB 3CCU1 4E2WA 3G71Z 2JIPA 3MONA 4A3DI 2R93I 3HOUI 5T67A 1YHQZ 3NDIA 3J80b 2K3RA 2JIQA 2VPYA 1VQ41 3IR7A 2R7ZI 2OTL1 4E2YA 3I07A 5CM2M 2JMOA 3Q87A 4RS4A 2NAPA 3S1NI 2NVQI 1VQN1 4E33A 1VQKZ 4A3MI 4NBBA 3S16I 2IZ3A 3G4SZ 2QEXZ 4E2ZA 3MZLB 2BJOA 4DQYB 1YITZ 3CC2Z 3S1RI 2I3CA 1NP6A 4RVDA 4A3KI 1QF8A 4CL1A 1JJ2Z 1VQ8Z 3PO2I 4A3FI 3T4NB 1RO2A 4Y52I 2W03A 2WB1A 2OTJ1 3GTKI 3GTLI 5FLXf 2OOXB 5A2Qf 4NBHA 1I3QI 1QVGY 2Q51A 4MONA 3S14I 4XX2A 1L1OC 3BG0B 1DL6A 5D1PA 3D2LA 4Y7NI 3GTMS 1YJ9Z 3F3FC 5IT9f 4RVFA 4BXXI 3VMHA 3CXCY 4MD8A 2P28A 3P5JB 1VQK1 1YUKA 1RLYA 1K83I 3IX0A 3KIHA 3CME1 3FQMA 5FLXb 3S17I 2F4MA 2VPZA 1K9M1 4RV9A 1Q16A 3RZDI 1RQFA 1N8R2 2V45A 1Q7Y1 1VQM1 2QR1B 5C44I 1Z02A 1K731 1YIT1 3HOYI 2M6NA 2ZAEB 3S2DI 4X6AI 2DE7A 2JR6A 1VLAA 3CCQZ 3CMEZ 1FDOA 1TWGI 5D1OB 1JWHC 3VB9A 2RT9A 1NJI2 3S1MI 1TFIA 3M4OI 2V8JA 3CQZI 3FKII 1RNIA 2QRDB 3GKQA 3CCE1 2QA41 4BY7I 1VQ7Z 5FLMI 3S2HI 1USPA 5C3EI 3CC41 1TWFI 1VQ51 1M1K2 1VQ71 1K8A2 3CCJZ 1ZH1A 3G6EZ 3EERA 3J7A4 4QTTA 3VMGA 3CD6Z 3CCEZ 5C4JI 4HH4A 3J81b 2M48A 1Z01A 1TWAI 2E2HI 1Q821 4A3II 2IZ4A 2QREB 2GU2A 2R92I 3CMA1 1JJ2Y 5IP7I 2YU9I 3VMIA 1VQ5Z 1WIIA 3CCS1 2V8IA 1K8A1 1LQLA 1Y1WI 1ZB8A 2P3YA 2QRCB 4NBDA 2KI7B 3QWUA 2PMZA 3CCUZ 4QTUA 2E2JI 1Q812 4MD7A 1KQSZ 5C4XI 2LEXA 2VUMI 1KD11 2NVYI 1NJI1 4RVHA 2LFUA 4BBRI 4A3BI 2OTLZ 1M902 1RO4A 1TWHI 3D6WA 1KQSY 2QEX1 1S721 1VQ9Z 2GTIA 2AYDA 3TE5B 1SIWA 1M1K1 1KC81 1VQ91 2OZKA 5A2Qb 3H3VJ 2O4HA 1Q7Y2 1WCMI 3GTJI 1K9M2 2W04A 1AA6A 1Y1VI 2QLVB 2V8KA 4BBSI 3HOXI 3I55Z 2RBLA 1VQPZ 2O53A 3S1QI 3NFZA 4MH4A 2H85A 3H0GI 1Q861 2VF1A 1VQ81 2G2KA 1VQO1 1VQLZ 4NBCA 3GTGI 1WJ2A 1YUAA 3ESWA 1ML8A 2IV2X 1TWCI 4HGZA 1N2FA 3HKZA 5D1OA 4A3GI 3CCVZ 3I4NI 2VPWA 1YJWZ 1WZNA 3CCR1 3GTPI 3MZKB 1K732 3NH8A 3G6E1 1KC82 4MXUA 1YJ91 5AN9F 1Q811 5IP9I 4TNUA 1SFOI 2E2II 3CCRZ 1YJN1 4BY1I 1PFTA 3EEDA 3J81f 4NOZA 4NBAA 1VQNZ 3CXCZ 1X3ZA 1ZB9A 3CCJ1 1WW9A 1X0TA 2JA7I 2JUBA 1RO0A 1VQOZ 3J80f 1N8R1 3IF8A 2HF1A 2YADA 2PK7A 3S15I 2JNYA 2R6MA 3HOZI 3D9XA 2QA4Z 3NDJA 4MRIA 2JIMA 4NFRA 3HOVI 1I50I 4HGYA 2RPRA 3CC7Z 2VPXA 3LUSA 1QXFA 1KRLA 2DE6A 4NH1C 3K7AI 1R9TI 3GCFA 3OW2Z 2NVXI 3CCM1 1FDIA 2E7ZA 3NH4A 2JIOA 4A93I 3CMAZ 4S1TA 4RVGA 1W2BY 2KPIA 3CCV1 2DE5A 1Q862 4E2XA 2K5RA 1S72Z 1YI21 4MD9A 1QYPA 4NB8A 1VQ4Z 1VQMZ 1W2BZ 3JAMf 3I561 3GTQI 1YI2Z 3G4S1 3FQQA 3RZOI 2EGTA 2LIYA 2Q4ZA 4NBFA 1USPB 4EWCA 3CCLZ 3TDHB 4E32A 3CCQ1 3BG1B 1P9NA 2NVTI 2E9HA 2B63I 2JA5I 1QVFZ 1KD12 3U50C 4NB9A 2AKLA 3CCMZ 2RIQA 2V3VA
chains in the Genus database with same CATH topology
3I56Z 2JS4A 3CC4Z 3KIFA 3CCSZ 4DK1A 1M901 1Y1VS 2F4OA 4A3EI 2RHBA 2OTJZ 1QVFY 4E30A 2JA6I 3CC71 1Z03A 5T6BA 1YIJ1 3I4MI 4AYBA 3VTNA 1X3WA 5LL6f 4NBGA 3GTOI 2J6AA 3CC21 1YHQ1 1QVGZ 4A3JI 2PM9A 2WAQA 4NBEA 3F3PC 3JAMb 3M3YI 1YIJZ 4DGLA 3HOWI 5T64A 2VUGA 2Y0SA 1YJNZ 3OW2Y 1Q822 2QKDA 3IFUA 3CPWY 1VQL1 2HU9A 4A3LI 4A3CI 1I6HI 3G711 1VQ61 1NUIA 2GTHA 1YJW1 3CCL1 1VQP1 3PO3I 5IT9b 2JA8I 3PO3S 3I551 3CPWZ 3NH5A 1S7MA 4E31A 3GTMI 3CD61 1VQ6Z 2OOYB 3CCU1 4E2WA 3G71Z 3MONA 4A3DI 2R93I 3HOUI 5T67A 1YHQZ 3NDIA 3J80b 2K3RA 1VQ41 2R7ZI 2OTL1 4E2YA 3I07A 5CM2M 2JMOA 3Q87A 4RS4A 3S1NI 2NVQI 1VQN1 4E33A 1VQKZ 4A3MI 4NBBA 3S16I 2IZ3A 3G4SZ 2QEXZ 4E2ZA 3MZLB 2BJOA 4DQYB 1YITZ 3CC2Z 3S1RI 2I3CA 1NP6A 4RVDA 4A3KI 1QF8A 4CL1A 1JJ2Z 1VQ8Z 3PO2I 4A3FI 3T4NB 1RO2A 4Y52I 2W03A 2WB1A 2OTJ1 3GTKI 3GTLI 5FLXf 2OOXB 5A2Qf 4NBHA 1I3QI 1QVGY 2Q51A 4MONA 3S14I 4XX2A 1L1OC 3BG0B 1DL6A 5D1PA 4Y7NI 3GTMS 1YJ9Z 3F3FC 5IT9f 4RVFA 4BXXI 3VMHA 4MD8A 3CXCY 2P28A 3P5JB 1VQK1 1YUKA 1RLYA 1K83I 3IX0A 3KIHA 3CME1 3FQMA 5FLXb 3S17I 2F4MA 1K9M1 4RV9A 3RZDI 1RQFA 1N8R2 1Q7Y1 1VQM1 2QR1B 5C44I 1Z02A 1K731 1YIT1 3HOYI 2M6NA 2ZAEB 3S2DI 4X6AI 2DE7A 2JR6A 1VLAA 3CCQZ 3CMEZ 1TWGI 5D1OB 1JWHC 3VB9A 2RT9A 1NJI2 3S1MI 1TFIA 3M4OI 2V8JA 3CQZI 3FKII 1RNIA 2QRDB 3GKQA 3CCE1 2QA41 4BY7I 1VQ7Z 5FLMI 3S2HI 1USPA 5C3EI 3CC41 1TWFI 1VQ51 1M1K2 1VQ71 1K8A2 3CCJZ 1ZH1A 3G6EZ 3EERA 3J7A4 4QTTA 3VMGA 3CD6Z 3CCEZ 5C4JI 4HH4A 3J81b 2M48A 1Z01A 1TWAI 2E2HI 1Q821 4A3II 2IZ4A 2QREB 2GU2A 2R92I 3CMA1 1JJ2Y 5IP7I 2YU9I 3VMIA 1VQ5Z 1WIIA 3CCS1 2V8IA 1K8A1 1LQLA 1Y1WI 1ZB8A 2P3YA 2QRCB 4NBDA 2KI7B 3QWUA 2PMZA 3CCUZ 4QTUA 2E2JI 1Q812 4MD7A 1KQSZ 5C4XI 2VUMI 1KD11 2NVYI 1NJI1 4RVHA 2LFUA 4BBRI 4A3BI 2OTLZ 1M902 1RO4A 1TWHI 3D6WA 1KQSY 2QEX1 1S721 1VQ9Z 2GTIA 3TE5B 1M1K1 1KC81 1VQ91 2OZKA 5A2Qb 3H3VJ 2O4HA 1Q7Y2 1WCMI 3GTJI 1K9M2 2W04A 1Y1VI 2QLVB 2V8KA 4BBSI 3HOXI 3I55Z 2RBLA 1VQPZ 2O53A 3S1QI 3NFZA 4MH4A 2H85A 3H0GI 1Q861 2VF1A 1VQ81 2G2KA 1VQO1 1VQLZ 4NBCA 3GTGI 1YUAA 3ESWA 1ML8A 1TWCI 4HGZA 1N2FA 3HKZA 5D1OA 4A3GI 3CCVZ 3I4NI 1YJWZ 3CCR1 3GTPI 3MZKB 1K732 3NH8A 3G6E1 1KC82 4MXUA 1YJ91 5AN9F 1Q811 5IP9I 4TNUA 1SFOI 2E2II 3CCRZ 1YJN1 4BY1I 1PFTA 3EEDA 3J81f 4NOZA 4NBAA 1VQNZ 3CXCZ 1X3ZA 1ZB9A 3CCJ1 1WW9A 1X0TA 2JA7I 2JUBA 1RO0A 1VQOZ 3J80f 1N8R1 3IF8A 2HF1A 2YADA 2PK7A 3S15I 2JNYA 2R6MA 3HOZI 3D9XA 2QA4Z 3NDJA 4MRIA 4NFRA 3HOVI 1I50I 4HGYA 2RPRA 3CC7Z 3LUSA 1KRLA 2DE6A 4NH1C 3K7AI 1R9TI 3GCFA 3OW2Z 2NVXI 3CCM1 3NH4A 4A93I 3CMAZ 4S1TA 4RVGA 1W2BY 2KPIA 3CCV1 2DE5A 1Q862 4E2XA 2K5RA 1S72Z 1YI21 4MD9A 1QYPA 4NB8A 1VQ4Z 1VQMZ 1W2BZ 3JAMf 3I561 3GTQI 1YI2Z 3G4S1 3FQQA 3RZOI 2EGTA 2LIYA 2Q4ZA 4NBFA 1USPB 4EWCA 3CCLZ 3TDHB 4E32A 3CCQ1 3BG1B 1P9NA 2NVTI 2E9HA 2B63I 2JA5I 1QVFZ 1KD12 3U50C 4NB9A 2AKLA 3CCMZ 2RIQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I56 Z;  3CCS 1;  1YIT Z;  3CC2 Z;  1K8A 1;  3CC4 Z;  3CCS Z;  1Q81 1;  1JJ2 Z;  1VQ8 Z;  1M90 1;  3CCU Z;  1Q81 2;  3CCR Z;  1YJN 1;  2OTJ Z;  1KQS Z;  1QVF Y;  1KD1 1;  2OTJ 1;  1VQN Z;  3CC7 1;  1YIJ 1;  3CXC Z;  1NJI 1;  1QVG Y;  3CCJ 1;  2OTL Z;  1M90 2;  3CC2 1;  1VQO Z;  1YHQ 1;  1QVG Z;  1N8R 1;  1YJ9 Z;  1KQS Y;  2QEX 1;  2QA4 Z;  1S72 1;  1VQ9 Z;  3CXC Y;  1YIJ Z;  3CC7 Z;  1VQK 1;  1M1K 1;  1KC8 1;  1YJN Z;  3CME 1;  1VQ9 1;  3OW2 Y;  1Q7Y 2;  1K9M 1;  1Q82 2;  1N8R 2;  3CPW Y;  1VQL 1;  1Q7Y 1;  1K9M 2;  1VQM 1;  1K73 1;  1YIT 1;  3OW2 Z;  3CCM 1;  3G71 1;  1VQ6 1;  3CMA Z;  3CCQ Z;  3CME Z;  1W2B Y;  1YJW 1;  1NJI 2;  3CCL 1;  3I55 Z;  1VQP 1;  3CCV 1;  3I55 1;  1VQP Z;  1Q86 2;  3CPW Z;  1S72 Z;  3CCE 1;  2QA4 1;  3CD6 1;  1VQ6 Z;  3CCU 1;  1Q86 1;  3G71 Z;  1VQ7 Z;  1YI2 1;  1VQ8 1;  1YHQ Z;  1VQ4 Z;  1VQO 1;  3CC4 1;  1VQM Z;  1W2B Z;  1VQ4 1;  1VQL Z;  3I56 1;  1VQ5 1;  1M1K 2;  1YI2 Z;  1K8A 2;  3CCJ Z;  1VQ7 1;  2OTL 1;  3G4S 1;  3G6E Z;  3CD6 Z;  3CCE Z;  1VQN 1;  3CCV Z;  1VQK Z;  1Q82 1;  3CCL Z;  1YJW Z;  3CCR 1;  3CCQ 1;  1K73 2;  3CMA 1;  3G4S Z;  3G6E 1;  1QVF Z;  1JJ2 Y;  2QEX Z;  1KC8 2;  1KD1 2;  1VQ5 Z;  3CCM Z;  1YJ9 1; 
#chains in the Genus database with same CATH topology
 3I56 Z;  2JS4 A;  3CC4 Z;  3KIF A;  3CCS Z;  4DK1 A;  1M90 1;  1Y1V S;  2F4O A;  4A3E I;  2RHB A;  2OTJ Z;  1QVF Y;  4E30 A;  2JA6 I;  3CC7 1;  1Z03 A;  5T6B A;  1YIJ 1;  3I4M I;  4AYB A;  3VTN A;  1X3W A;  5LL6 f;  4NBG A;  2JIR A;  3GTO I;  2J6A A;  3CC2 1;  1YHQ 1;  1QVG Z;  4A3J I;  2PM9 A;  2WAQ A;  4NBE A;  3F3P C;  3JAM b;  3M3Y I;  1YIJ Z;  4DGL A;  3HOW I;  5T64 A;  2VUG A;  2Y0S A;  1YJN Z;  1Y8C A;  3OW2 Y;  1Q82 2;  2QKD A;  3IFU A;  3CPW Y;  1VQL 1;  2HU9 A;  4A3L I;  4A3C I;  1I6H I;  3G71 1;  1VQ6 1;  1NUI A;  2GTH A;  1YJW 1;  3CCL 1;  1VQP 1;  3PO3 I;  5IT9 b;  2JA8 I;  3PO3 S;  3I55 1;  3CPW Z;  3NH5 A;  1S7M A;  4E31 A;  3GTM I;  3CD6 1;  1VQ6 Z;  2OOY B;  3CCU 1;  4E2W A;  3G71 Z;  2JIP A;  3MON A;  4A3D I;  2R93 I;  3HOU I;  5T67 A;  1YHQ Z;  3NDI A;  3J80 b;  2K3R A;  2JIQ A;  2VPY A;  1VQ4 1;  3IR7 A;  2R7Z I;  2OTL 1;  4E2Y A;  3I07 A;  5CM2 M;  2JMO A;  3Q87 A;  4RS4 A;  2NAP A;  3S1N I;  2NVQ I;  1VQN 1;  4E33 A;  1VQK Z;  4A3M I;  4NBB A;  3S16 I;  2IZ3 A;  3G4S Z;  2QEX Z;  4E2Z A;  3MZL B;  2BJO A;  4DQY B;  1YIT Z;  3CC2 Z;  3S1R I;  2I3C A;  1NP6 A;  4RVD A;  4A3K I;  1QF8 A;  4CL1 A;  1JJ2 Z;  1VQ8 Z;  3PO2 I;  4A3F I;  3T4N B;  1RO2 A;  4Y52 I;  2W03 A;  2WB1 A;  2OTJ 1;  3GTK I;  3GTL I;  5FLX f;  2OOX B;  5A2Q f;  4NBH A;  1I3Q I;  1QVG Y;  2Q51 A;  4MON A;  3S14 I;  4XX2 A;  1L1O C;  3BG0 B;  1DL6 A;  5D1P A;  3D2L A;  4Y7N I;  3GTM S;  1YJ9 Z;  3F3F C;  5IT9 f;  4RVF A;  4BXX I;  3VMH A;  3CXC Y;  4MD8 A;  2P28 A;  3P5J B;  1VQK 1;  1YUK A;  1RLY A;  1K83 I;  3IX0 A;  3KIH A;  3CME 1;  3FQM A;  5FLX b;  3S17 I;  2F4M A;  2VPZ A;  1K9M 1;  4RV9 A;  1Q16 A;  3RZD I;  1RQF A;  1N8R 2;  2V45 A;  1Q7Y 1;  1VQM 1;  2QR1 B;  5C44 I;  1Z02 A;  1K73 1;  1YIT 1;  3HOY I;  2M6N A;  2ZAE B;  3S2D I;  4X6A I;  2DE7 A;  2JR6 A;  1VLA A;  3CCQ Z;  3CME Z;  1FDO A;  1TWG I;  5D1O B;  1JWH C;  3VB9 A;  2RT9 A;  1NJI 2;  3S1M I;  1TFI A;  3M4O I;  2V8J A;  3CQZ I;  3FKI I;  1RNI A;  2QRD B;  3GKQ A;  3CCE 1;  2QA4 1;  4BY7 I;  1VQ7 Z;  5FLM I;  3S2H I;  1USP A;  5C3E I;  3CC4 1;  1TWF I;  1VQ5 1;  1M1K 2;  1VQ7 1;  1K8A 2;  3CCJ Z;  1ZH1 A;  3G6E Z;  3EER A;  3J7A 4;  4QTT A;  3VMG A;  3CD6 Z;  3CCE Z;  5C4J I;  4HH4 A;  3J81 b;  2M48 A;  1Z01 A;  1TWA I;  2E2H I;  1Q82 1;  4A3I I;  2IZ4 A;  2QRE B;  2GU2 A;  2R92 I;  3CMA 1;  1JJ2 Y;  5IP7 I;  2YU9 I;  3VMI A;  1VQ5 Z;  1WII A;  3CCS 1;  2V8I A;  1K8A 1;  1LQL A;  1Y1W I;  1ZB8 A;  2P3Y A;  2QRC B;  4NBD A;  2KI7 B;  3QWU A;  2PMZ A;  3CCU Z;  4QTU A;  2E2J I;  1Q81 2;  4MD7 A;  1KQS Z;  5C4X I;  2LEX A;  2VUM I;  1KD1 1;  2NVY I;  1NJI 1;  4RVH A;  2LFU A;  4BBR I;  4A3B I;  2OTL Z;  1M90 2;  1RO4 A;  1TWH I;  3D6W A;  1KQS Y;  2QEX 1;  1S72 1;  1VQ9 Z;  2GTI A;  2AYD A;  3TE5 B;  1SIW A;  1M1K 1;  1KC8 1;  1VQ9 1;  2OZK A;  5A2Q b;  3H3V J;  2O4H A;  1Q7Y 2;  1WCM I;  3GTJ I;  1K9M 2;  2W04 A;  1AA6 A;  1Y1V I;  2QLV B;  2V8K A;  4BBS I;  3HOX I;  3I55 Z;  2RBL A;  1VQP Z;  2O53 A;  3S1Q I;  3NFZ A;  4MH4 A;  2H85 A;  3H0G I;  1Q86 1;  2VF1 A;  1VQ8 1;  2G2K A;  1VQO 1;  1VQL Z;  4NBC A;  3GTG I;  1WJ2 A;  1YUA A;  3ESW A;  1ML8 A;  2IV2 X;  1TWC I;  4HGZ A;  1N2F A;  3HKZ A;  5D1O A;  4A3G I;  3CCV Z;  3I4N I;  2VPW A;  1YJW Z;  1WZN A;  3CCR 1;  3GTP I;  3MZK B;  1K73 2;  3NH8 A;  3G6E 1;  1KC8 2;  4MXU A;  1YJ9 1;  5AN9 F;  1Q81 1;  5IP9 I;  4TNU A;  1SFO I;  2E2I I;  3CCR Z;  1YJN 1;  4BY1 I;  1PFT A;  3EED A;  3J81 f;  4NOZ A;  4NBA A;  1VQN Z;  3CXC Z;  1X3Z A;  1ZB9 A;  3CCJ 1;  1WW9 A;  1X0T A;  2JA7 I;  2JUB A;  1RO0 A;  1VQO Z;  3J80 f;  1N8R 1;  3IF8 A;  2HF1 A;  2YAD A;  2PK7 A;  3S15 I;  2JNY A;  2R6M A;  3HOZ I;  3D9X A;  2QA4 Z;  3NDJ A;  4MRI A;  2JIM A;  4NFR A;  3HOV I;  1I50 I;  4HGY A;  2RPR A;  3CC7 Z;  2VPX A;  3LUS A;  1QXF A;  1KRL A;  2DE6 A;  4NH1 C;  3K7A I;  1R9T I;  3GCF A;  3OW2 Z;  2NVX I;  3CCM 1;  1FDI A;  2E7Z A;  3NH4 A;  2JIO A;  4A93 I;  3CMA Z;  4S1T A;  4RVG A;  1W2B Y;  2KPI A;  3CCV 1;  2DE5 A;  1Q86 2;  4E2X A;  2K5R A;  1S72 Z;  1YI2 1;  4MD9 A;  1QYP A;  4NB8 A;  1VQ4 Z;  1VQM Z;  1W2B Z;  3JAM f;  3I56 1;  3GTQ I;  1YI2 Z;  3G4S 1;  3FQQ A;  3RZO I;  2EGT A;  2LIY A;  2Q4Z A;  4NBF A;  1USP B;  4EWC A;  3CCL Z;  3TDH B;  4E32 A;  3CCQ 1;  3BG1 B;  1P9N A;  2NVT I;  2E9H A;  2B63 I;  2JA5 I;  1QVF Z;  1KD1 2;  3U50 C;  4NB9 A;  2AKL A;  3CCM Z;  2RIQ A;  2V3V A; 
#chains in the Genus database with same CATH homology
 3I56 Z;  2JS4 A;  3CC4 Z;  3KIF A;  3CCS Z;  4DK1 A;  1M90 1;  1Y1V S;  2F4O A;  4A3E I;  2RHB A;  2OTJ Z;  1QVF Y;  4E30 A;  2JA6 I;  3CC7 1;  1Z03 A;  5T6B A;  1YIJ 1;  3I4M I;  4AYB A;  3VTN A;  1X3W A;  5LL6 f;  4NBG A;  3GTO I;  2J6A A;  3CC2 1;  1YHQ 1;  1QVG Z;  4A3J I;  2PM9 A;  2WAQ A;  4NBE A;  3F3P C;  3JAM b;  3M3Y I;  1YIJ Z;  4DGL A;  3HOW I;  5T64 A;  2VUG A;  2Y0S A;  1YJN Z;  3OW2 Y;  1Q82 2;  2QKD A;  3IFU A;  3CPW Y;  1VQL 1;  2HU9 A;  4A3L I;  4A3C I;  1I6H I;  3G71 1;  1VQ6 1;  1NUI A;  2GTH A;  1YJW 1;  3CCL 1;  1VQP 1;  3PO3 I;  5IT9 b;  2JA8 I;  3PO3 S;  3I55 1;  3CPW Z;  3NH5 A;  1S7M A;  4E31 A;  3GTM I;  3CD6 1;  1VQ6 Z;  2OOY B;  3CCU 1;  4E2W A;  3G71 Z;  3MON A;  4A3D I;  2R93 I;  3HOU I;  5T67 A;  1YHQ Z;  3NDI A;  3J80 b;  2K3R A;  1VQ4 1;  2R7Z I;  2OTL 1;  4E2Y A;  3I07 A;  5CM2 M;  2JMO A;  3Q87 A;  4RS4 A;  3S1N I;  2NVQ I;  1VQN 1;  4E33 A;  1VQK Z;  4A3M I;  4NBB A;  3S16 I;  2IZ3 A;  3G4S Z;  2QEX Z;  4E2Z A;  3MZL B;  2BJO A;  4DQY B;  1YIT Z;  3CC2 Z;  3S1R I;  2I3C A;  1NP6 A;  4RVD A;  4A3K I;  1QF8 A;  4CL1 A;  1JJ2 Z;  1VQ8 Z;  3PO2 I;  4A3F I;  3T4N B;  1RO2 A;  4Y52 I;  2W03 A;  2WB1 A;  2OTJ 1;  3GTK I;  3GTL I;  5FLX f;  2OOX B;  5A2Q f;  4NBH A;  1I3Q I;  1QVG Y;  2Q51 A;  4MON A;  3S14 I;  4XX2 A;  1L1O C;  3BG0 B;  1DL6 A;  5D1P A;  4Y7N I;  3GTM S;  1YJ9 Z;  3F3F C;  5IT9 f;  4RVF A;  4BXX I;  3VMH A;  4MD8 A;  3CXC Y;  2P28 A;  3P5J B;  1VQK 1;  1YUK A;  1RLY A;  1K83 I;  3IX0 A;  3KIH A;  3CME 1;  3FQM A;  5FLX b;  3S17 I;  2F4M A;  1K9M 1;  4RV9 A;  3RZD I;  1RQF A;  1N8R 2;  1Q7Y 1;  1VQM 1;  2QR1 B;  5C44 I;  1Z02 A;  1K73 1;  1YIT 1;  3HOY I;  2M6N A;  2ZAE B;  3S2D I;  4X6A I;  2DE7 A;  2JR6 A;  1VLA A;  3CCQ Z;  3CME Z;  1TWG I;  5D1O B;  1JWH C;  3VB9 A;  2RT9 A;  1NJI 2;  3S1M I;  1TFI A;  3M4O I;  2V8J A;  3CQZ I;  3FKI I;  1RNI A;  2QRD B;  3GKQ A;  3CCE 1;  2QA4 1;  4BY7 I;  1VQ7 Z;  5FLM I;  3S2H I;  1USP A;  5C3E I;  3CC4 1;  1TWF I;  1VQ5 1;  1M1K 2;  1VQ7 1;  1K8A 2;  3CCJ Z;  1ZH1 A;  3G6E Z;  3EER A;  3J7A 4;  4QTT A;  3VMG A;  3CD6 Z;  3CCE Z;  5C4J I;  4HH4 A;  3J81 b;  2M48 A;  1Z01 A;  1TWA I;  2E2H I;  1Q82 1;  4A3I I;  2IZ4 A;  2QRE B;  2GU2 A;  2R92 I;  3CMA 1;  1JJ2 Y;  5IP7 I;  2YU9 I;  3VMI A;  1VQ5 Z;  1WII A;  3CCS 1;  2V8I A;  1K8A 1;  1LQL A;  1Y1W I;  1ZB8 A;  2P3Y A;  2QRC B;  4NBD A;  2KI7 B;  3QWU A;  2PMZ A;  3CCU Z;  4QTU A;  2E2J I;  1Q81 2;  4MD7 A;  1KQS Z;  5C4X I;  2VUM I;  1KD1 1;  2NVY I;  1NJI 1;  4RVH A;  2LFU A;  4BBR I;  4A3B I;  2OTL Z;  1M90 2;  1RO4 A;  1TWH I;  3D6W A;  1KQS Y;  2QEX 1;  1S72 1;  1VQ9 Z;  2GTI A;  3TE5 B;  1M1K 1;  1KC8 1;  1VQ9 1;  2OZK A;  5A2Q b;  3H3V J;  2O4H A;  1Q7Y 2;  1WCM I;  3GTJ I;  1K9M 2;  2W04 A;  1Y1V I;  2QLV B;  2V8K A;  4BBS I;  3HOX I;  3I55 Z;  2RBL A;  1VQP Z;  2O53 A;  3S1Q I;  3NFZ A;  4MH4 A;  2H85 A;  3H0G I;  1Q86 1;  2VF1 A;  1VQ8 1;  2G2K A;  1VQO 1;  1VQL Z;  4NBC A;  3GTG I;  1YUA A;  3ESW A;  1ML8 A;  1TWC I;  4HGZ A;  1N2F A;  3HKZ A;  5D1O A;  4A3G I;  3CCV Z;  3I4N I;  1YJW Z;  3CCR 1;  3GTP I;  3MZK B;  1K73 2;  3NH8 A;  3G6E 1;  1KC8 2;  4MXU A;  1YJ9 1;  5AN9 F;  1Q81 1;  5IP9 I;  4TNU A;  1SFO I;  2E2I I;  3CCR Z;  1YJN 1;  4BY1 I;  1PFT A;  3EED A;  3J81 f;  4NOZ A;  4NBA A;  1VQN Z;  3CXC Z;  1X3Z A;  1ZB9 A;  3CCJ 1;  1WW9 A;  1X0T A;  2JA7 I;  2JUB A;  1RO0 A;  1VQO Z;  3J80 f;  1N8R 1;  3IF8 A;  2HF1 A;  2YAD A;  2PK7 A;  3S15 I;  2JNY A;  2R6M A;  3HOZ I;  3D9X A;  2QA4 Z;  3NDJ A;  4MRI A;  4NFR A;  3HOV I;  1I50 I;  4HGY A;  2RPR A;  3CC7 Z;  3LUS A;  1KRL A;  2DE6 A;  4NH1 C;  3K7A I;  1R9T I;  3GCF A;  3OW2 Z;  2NVX I;  3CCM 1;  3NH4 A;  4A93 I;  3CMA Z;  4S1T A;  4RVG A;  1W2B Y;  2KPI A;  3CCV 1;  2DE5 A;  1Q86 2;  4E2X A;  2K5R A;  1S72 Z;  1YI2 1;  4MD9 A;  1QYP A;  4NB8 A;  1VQ4 Z;  1VQM Z;  1W2B Z;  3JAM f;  3I56 1;  3GTQ I;  1YI2 Z;  3G4S 1;  3FQQ A;  3RZO I;  2EGT A;  2LIY A;  2Q4Z A;  4NBF A;  1USP B;  4EWC A;  3CCL Z;  3TDH B;  4E32 A;  3CCQ 1;  3BG1 B;  1P9N A;  2NVT I;  2E9H A;  2B63 I;  2JA5 I;  1QVF Z;  1KD1 2;  3U50 C;  4NB9 A;  2AKL A;  3CCM Z;  2RIQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...