1QVGZ

Structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1qvgZ00
1N8R1 1QVGZ 1VQ9Z 3CC41 1KC82 1VQ61 1YITZ 3CCL1 1Q862 3G71Z 3CCR1 3CCMZ 1VQ81 3CC2Z 1VQO1 1VQ41 1YJWZ 1VQKZ 1KD11 1YI21 3CCU1 1VQNZ 1VQPZ 1Q861 3CC71 3CCVZ 3CCEZ 1YHQ1 2QA41 3CCSZ 3CMEZ 1VQ5Z 1M901 2OTJ1 3G4SZ 2QEXZ 1KD12 3I551 3CCJZ 3G6E1 1YJ9Z 1K8A2 3CC4Z 3CCLZ 1Q7Y1 1K9M2 1M902 3CCRZ 3CD61 3OW2Y 1VQOZ 1Q811 3CCQ1 1VQ4Z 1NJI1 1W2BY 1KQSZ 1K8A1 1S721 1YI2Z 3CCUZ 1VQ91 1VQ7Z 1Q7Y2 3CMA1 3OW2Z 3CC7Z 1K9M1 2QA4Z 1VQMZ 1YHQZ 3G711 1Q812 1W2BZ 3CCM1 1NJI2 2OTJZ 2OTLZ 3I55Z 3G6EZ 1VQL1 1KQSY 1QVFY 1VQ6Z 3CPWY 1Q821 1M1K1 1VQ8Z 1YJN1 3CCV1 3CCS1 1VQ51 3CD6Z 3I561 1YIJ1 1QVFZ 3CPWZ 1S72Z 1YIT1 1K732 1Q822 1M1K2 3CMAZ 1JJ2Y 3CC21 1YJW1 1VQK1 1N8R2 1JJ2Z 1VQLZ 3CXCY 1VQN1 1VQP1 1K731 1KC81 1VQ71 1QVGY 3CCE1 3CME1 1YJNZ 1VQM1 3CCQZ 3G4S1 2QEX1 3I56Z 3CCJ1 3CXCZ 1YJ91 1YIJZ 2OTL1
chains in the Genus database with same CATH superfamily
1RO4A 1QVGZ 1VQ9Z 3S14I 1YITZ 3CCL1 5LL6f 3G71Z 1FDOA 3Q87A 1VQ81 3H3VJ 3TE5B 3U50C 1Y1VS 1KD11 3RZOI 5FLMI 2J6AA 1KRLA 1VQPZ 4E2XA 1Q861 2NVQI 2QA41 3CMEZ 1VQ5Z 4S1TA 3I551 1YJ9Z 3HOUI 3S1QI 1PFTA 4RVHA 3CCLZ 1DL6A 1I3QI 2JIPA 2IZ4A 4NBGA 4NBBA 1K9M2 3CD61 4CL1A 3CCQ1 4MD9A 3J7A4 3GCFA 4A3KI 1W2BY 1KQSZ 5FLXb 1K8A1 1VQ7Z 1Q7Y2 4A3MI 1Z01A 2QA4Z 3CCM1 1ML8A 2IZ3A 1WJ2A 2Y0SA 1LQLA 2Q51A 2E2JI 4XX2A 3I55Z 1I50I 4DK1A 2OOXB 3I4MI 1QVFY 1VQ6Z 2AYDA 4A3DI 3TDHB 1X0TA 5D1PA 2NVYI 2E2II 1RQFA 3CCV1 1TWFI 1NP6A 2F4MA 3CD6Z 3HOYI 2YU9I 2PM9A 2V8IA 5C44I 1TWCI 3MZKB 1Q822 2NVXI 1JJ2Y 3NH5A 3CQZI 3J81b 3S17I 4MD7A 3MZLB 2O53A 3PO3I 3IR7A 1N8R2 1VQN1 3VMIA 1ZH1A 4MD8A 4E32A 3D6WA 2QEX1 4HH4A 1TWAI 3LUSA 5FLXf 1Y8CA 3VMHA 2VPWA 4NFRA 1KC82 4E2WA 3ESWA 2JMOA 3S1RI 4A3II 3RZDI 3HOVI 5T67A 4A3BI 3S2DI 3FQMA 1I6HI 3GTMI 1USPA 4NBFA 2NAPA 3NH8A 3EERA 1TFIA 3S16I 1VQNZ 3CC71 3CCSZ 5D1OB 2VUMI 3M3YI 3GTOI 2DE5A 2RBLA 2QEXZ 2OZKA 2M6NA 4BBRI 2JIQA 1QF8A 4BBSI 1VLAA 4A3LI 3HOXI 1YUAA 2RPRA 2K5RA 1Q7Y1 3F3PC 2IV2X 3J81f 1M902 2P28A 2R92I 4RS4A 2JUBA 3NDJA 2R7ZI 2WB1A 5C4XI 4QTTA 1QYPA 4A3GI 3OW2Z 3CC7Z 1SFOI 2Q4ZA 1VQMZ 2RIQA 4NOZA 4E2YA 3GTPI 1NJI2 3GTKI 3VB9A 3IF8A 2OTLZ 2V45A 4MRIA 2PK7A 3HOWI 3IX0A 5T64A 2OTL1 3H0GI 1Q821 2QREB 2LIYA 1VQ8Z 2QLVB 4RV9A 1YUKA 2GTIA 4MXUA 5IP7I 2VPYA 2JS4A 2AKLA 3CPWZ 2I3CA 3NDIA 3CC21 2QR1B 2PMZA 4MONA 1VQK1 5IP9I 4NBHA 4HGYA 3CXCY 1X3WA 1Z03A 1K731 1KC81 2BJOA 1QVGY 2LFUA 3CCQZ 2O4HA 4RVDA 4Y7NI 2RT9A 1RO0A 3CC41 4DQYB 2HU9A 1Q862 3CCMZ 3CC2Z 1VQO1 2WAQA 1VQKZ 4A93I 3EEDA 2JA7I 2V8JA 1YI21 2KPIA 4NBDA 2R6MA 4E33A 2B63I 2DE7A 1AA6A 3CCVZ 3D2LA 2QKDA 1M901 3GTLI 3J80f 3GKQA 2JIOA 2R93I 1K8A2 1ZB8A 4Y52I 2DE6A 3CC4Z 4NB9A 2E7ZA 1N2FA 1Y1VI 2VPXA 3PO2I 3P5JB 1VQOZ 2P3YA 1NJI1 5AN9F 3JAMb 2NVTI 3MONA 1TWHI 1YI2Z 1VQ91 2GU2A 3CMA1 4BY7I 4X6AI 3KIFA 1K9M1 3NFZA 3GTQI 2JIMA 2JA6I 3G711 1Q812 1W2BZ 4NBCA 2W04A 3FKII 3FQQA 5IT9b 2V3VA 1JWHC 2ZAEB 1YJN1 3PO3S 1VQ51 1QVFZ 2QRCB 3VTNA 5A2Qf 3M4OI 4DGLA 2E9HA 3I07A 1M1K2 3CMAZ 3HOZI 2QRDB 3VMGA 1WCMI 1Z02A 1YJW1 1S7MA 2K3RA 4A3JI 1JJ2Z 2JNYA 5CM2M 4NBAA 1VQ71 1WW9A 3CCE1 3GTMS 1K83I 3K7AI 4NH1C 1YJNZ 1NUIA 1R9TI 3G4S1 3JAMf 3CCJ1 2LEXA 3J80b 1SIWA 3BG0B 1ZB9A 1N8R1 2E2HI 4BXXI 4AYBA 5C4JI 2EGTA 2HF1A 1P9NA 1VQ61 3HKZA 2JR6A 4HGZA 1USPB 3QWUA 4RVFA 3CCR1 2V8KA 2GTHA 1VQ41 1RNIA 1YJWZ 1QXFA 2VPZA 4BY1I 5IT9f 3CCU1 2OOYB 4NB8A 4E31A 3CCEZ 1YHQ1 2H85A 4E2ZA 2OTJ1 2W03A 3G4SZ 1KD12 3CCJZ 3G6E1 5D1OA 3IFUA 1RO2A 1X3ZA 1RLYA 4A3EI 2JIRA 2G2KA 3D9XA 3CCRZ 4NBEA 3OW2Y 1TWGI 1Q811 1VQ4Z 5C3EI 4QTUA 1Y1WI 3F3FC 5A2Qb 3GTGI 1WIIA 5T6BA 4MH4A 1S721 3I4NI 3CCUZ 3KIHA 4TNUA 1Q16A 1L1OC 3T4NB 1YHQZ 2JA8I 2M48A 3GTJI 2OTJZ 4E30A 3G6EZ 1VQL1 2F4OA 1KQSY 3CPWY 1M1K1 3NH4A 2RHBA 3CCS1 3BG1B 3S1MI 3I561 1YIJ1 2JA5I 1YIT1 1S72Z 1K732 2KI7B 2VUGA 2YADA 4A3FI 4A3CI 3S15I 1WZNA 1VQLZ 1VQP1 3S1NI 3CME1 4EWCA 4RVGA 1VQM1 1FDIA 3I56Z 3S2HI 3CXCZ 1YJ91 1YIJZ 2VF1A
chains in the Genus database with same CATH topology
1RO4A 1QVGZ 1VQ9Z 3S14I 1YITZ 3CCL1 5LL6f 3G71Z 3Q87A 1VQ81 3H3VJ 3TE5B 3U50C 1Y1VS 1KD11 3RZOI 5FLMI 2J6AA 1KRLA 1VQPZ 4E2XA 1Q861 2NVQI 2QA41 3CMEZ 1VQ5Z 4S1TA 3I551 1YJ9Z 3HOUI 3S1QI 1PFTA 4RVHA 3CCLZ 1DL6A 1I3QI 4NBBA 2IZ4A 4NBGA 1K9M2 3CD61 4CL1A 3CCQ1 4MD9A 3J7A4 3GCFA 4A3KI 1W2BY 1KQSZ 5FLXb 1K8A1 1VQ7Z 1Q7Y2 4A3MI 1Z01A 2QA4Z 3CCM1 1ML8A 2IZ3A 2Y0SA 1LQLA 2Q51A 2E2JI 4XX2A 3I55Z 1I50I 4DK1A 2OOXB 3I4MI 1QVFY 1VQ6Z 4A3DI 3TDHB 1X0TA 5D1PA 2NVYI 2E2II 1RQFA 3CCV1 1TWFI 1NP6A 2F4MA 3CD6Z 3HOYI 2YU9I 2PM9A 2V8IA 5C44I 1TWCI 3MZKB 1Q822 2NVXI 1JJ2Y 3NH5A 3CQZI 3J81b 3S17I 4MD7A 3MZLB 2O53A 3PO3I 1N8R2 1VQN1 3VMIA 1ZH1A 4MD8A 4E32A 3D6WA 2QEX1 4HH4A 1TWAI 3LUSA 5FLXf 3VMHA 4NFRA 1KC82 4E2WA 3ESWA 2JMOA 3S1RI 4A3II 3RZDI 3HOVI 5T67A 4A3BI 3S2DI 3FQMA 1I6HI 3GTMI 1USPA 4NBFA 3NH8A 3EERA 1TFIA 3S16I 1VQNZ 3CC71 3CCSZ 5D1OB 2VUMI 3M3YI 3GTOI 2DE5A 2RBLA 2QEXZ 2OZKA 2M6NA 4BBRI 1QF8A 4BBSI 1VLAA 4A3LI 3HOXI 1YUAA 2RPRA 2K5RA 1Q7Y1 3F3PC 3J81f 1M902 2P28A 2R92I 4RS4A 2JUBA 3NDJA 2R7ZI 2WB1A 5C4XI 4QTTA 1QYPA 4A3GI 3OW2Z 3CC7Z 1SFOI 2Q4ZA 1VQMZ 2RIQA 4NOZA 4E2YA 3GTPI 1NJI2 3GTKI 3VB9A 3IF8A 2OTLZ 4MRIA 2PK7A 3HOWI 3IX0A 5T64A 2OTL1 3H0GI 1Q821 2QREB 2LIYA 1VQ8Z 2QLVB 4RV9A 1YUKA 2GTIA 4MXUA 5IP7I 2JS4A 2AKLA 3CPWZ 2I3CA 3NDIA 3CC21 2QR1B 2PMZA 4MONA 1VQK1 5IP9I 4NBHA 4HGYA 3CXCY 1X3WA 1Z03A 1K731 1KC81 2BJOA 1QVGY 2LFUA 3CCQZ 2O4HA 4RVDA 4Y7NI 2RT9A 1RO0A 3CC41 4DQYB 2HU9A 1Q862 3CCMZ 3CC2Z 1VQO1 2WAQA 1VQKZ 4A93I 3EEDA 2JA7I 2V8JA 1YI21 2KPIA 4NBDA 2R6MA 4E33A 2B63I 2DE7A 3CCVZ 2QKDA 1M901 3GTLI 3J80f 3GKQA 2R93I 1K8A2 1ZB8A 4Y52I 2DE6A 3CC4Z 4NB9A 1N2FA 1Y1VI 3PO2I 3P5JB 1VQOZ 2P3YA 1NJI1 5AN9F 3JAMb 2NVTI 3MONA 1TWHI 1YI2Z 1VQ91 2GU2A 3CMA1 4BY7I 4X6AI 3KIFA 1K9M1 3NFZA 3GTQI 2JA6I 3G711 1Q812 1W2BZ 4NBCA 2W04A 3FKII 3FQQA 5IT9b 1JWHC 2ZAEB 1YJN1 3PO3S 1VQ51 1QVFZ 2QRCB 3VTNA 5A2Qf 3M4OI 4DGLA 2E9HA 3I07A 1M1K2 3CMAZ 3HOZI 2QRDB 3VMGA 1WCMI 1Z02A 1YJW1 1S7MA 2K3RA 4A3JI 1JJ2Z 2JNYA 5CM2M 4NBAA 1VQ71 1WW9A 3CCE1 3GTMS 1K83I 3K7AI 4NH1C 1YJNZ 1NUIA 1R9TI 3G4S1 3JAMf 3CCJ1 3J80b 3BG0B 1ZB9A 1N8R1 2E2HI 4BXXI 4AYBA 5C4JI 2EGTA 2HF1A 1P9NA 1VQ61 3HKZA 2JR6A 4HGZA 1USPB 3QWUA 4RVFA 3CCR1 2V8KA 2GTHA 1VQ41 1RNIA 1YJWZ 4BY1I 5IT9f 3CCU1 2OOYB 4NB8A 4E31A 3CCEZ 1YHQ1 2H85A 4E2ZA 2OTJ1 2W03A 3G4SZ 1KD12 3CCJZ 3G6E1 5D1OA 3IFUA 1RO2A 1X3ZA 1RLYA 4A3EI 2G2KA 3D9XA 3CCRZ 4NBEA 3OW2Y 1TWGI 1Q811 1VQ4Z 5C3EI 4QTUA 1Y1WI 3F3FC 5A2Qb 3GTGI 1WIIA 5T6BA 4MH4A 1S721 3I4NI 3CCUZ 3KIHA 4TNUA 1L1OC 3T4NB 1YHQZ 2JA8I 2M48A 3GTJI 2OTJZ 4E30A 3G6EZ 1VQL1 2F4OA 1KQSY 3CPWY 1M1K1 3NH4A 2RHBA 3CCS1 3BG1B 3S1MI 3I561 1YIJ1 2JA5I 1YIT1 1S72Z 1K732 2KI7B 2VUGA 2YADA 4A3FI 4A3CI 3S15I 1VQLZ 1VQP1 3S1NI 3CME1 4EWCA 4RVGA 1VQM1 3I56Z 3S2HI 3CXCZ 1YJ91 1YIJZ 2VF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N8R 1;  1QVG Z;  1VQ9 Z;  3CC4 1;  1KC8 2;  1VQ6 1;  1YIT Z;  3CCL 1;  1Q86 2;  3G71 Z;  3CCR 1;  3CCM Z;  1VQ8 1;  3CC2 Z;  1VQO 1;  1VQ4 1;  1YJW Z;  1VQK Z;  1KD1 1;  1YI2 1;  3CCU 1;  1VQN Z;  1VQP Z;  1Q86 1;  3CC7 1;  3CCV Z;  3CCE Z;  1YHQ 1;  2QA4 1;  3CCS Z;  3CME Z;  1VQ5 Z;  1M90 1;  2OTJ 1;  3G4S Z;  2QEX Z;  1KD1 2;  3I55 1;  3CCJ Z;  3G6E 1;  1YJ9 Z;  1K8A 2;  3CC4 Z;  3CCL Z;  1Q7Y 1;  1K9M 2;  1M90 2;  3CCR Z;  3CD6 1;  3OW2 Y;  1VQO Z;  1Q81 1;  3CCQ 1;  1VQ4 Z;  1NJI 1;  1W2B Y;  1KQS Z;  1K8A 1;  1S72 1;  1YI2 Z;  3CCU Z;  1VQ9 1;  1VQ7 Z;  1Q7Y 2;  3CMA 1;  3OW2 Z;  3CC7 Z;  1K9M 1;  2QA4 Z;  1VQM Z;  1YHQ Z;  3G71 1;  1Q81 2;  1W2B Z;  3CCM 1;  1NJI 2;  2OTJ Z;  2OTL Z;  3I55 Z;  3G6E Z;  1VQL 1;  1KQS Y;  1QVF Y;  1VQ6 Z;  3CPW Y;  1Q82 1;  1M1K 1;  1VQ8 Z;  1YJN 1;  3CCV 1;  3CCS 1;  1VQ5 1;  3CD6 Z;  3I56 1;  1YIJ 1;  1QVF Z;  3CPW Z;  1S72 Z;  1YIT 1;  1K73 2;  1Q82 2;  1M1K 2;  3CMA Z;  1JJ2 Y;  3CC2 1;  1YJW 1;  1VQK 1;  1N8R 2;  1JJ2 Z;  1VQL Z;  3CXC Y;  1VQN 1;  1VQP 1;  1K73 1;  1KC8 1;  1VQ7 1;  1QVG Y;  3CCE 1;  3CME 1;  1YJN Z;  1VQM 1;  3CCQ Z;  3G4S 1;  2QEX 1;  3I56 Z;  3CCJ 1;  3CXC Z;  1YJ9 1;  1YIJ Z;  2OTL 1; 
#chains in the Genus database with same CATH topology
 1RO4 A;  1QVG Z;  1VQ9 Z;  3S14 I;  1YIT Z;  3CCL 1;  5LL6 f;  3G71 Z;  1FDO A;  3Q87 A;  1VQ8 1;  3H3V J;  3TE5 B;  3U50 C;  1Y1V S;  1KD1 1;  3RZO I;  5FLM I;  2J6A A;  1KRL A;  1VQP Z;  4E2X A;  1Q86 1;  2NVQ I;  2QA4 1;  3CME Z;  1VQ5 Z;  4S1T A;  3I55 1;  1YJ9 Z;  3HOU I;  3S1Q I;  1PFT A;  4RVH A;  3CCL Z;  1DL6 A;  1I3Q I;  2JIP A;  2IZ4 A;  4NBG A;  4NBB A;  1K9M 2;  3CD6 1;  4CL1 A;  3CCQ 1;  4MD9 A;  3J7A 4;  3GCF A;  4A3K I;  1W2B Y;  1KQS Z;  5FLX b;  1K8A 1;  1VQ7 Z;  1Q7Y 2;  4A3M I;  1Z01 A;  2QA4 Z;  3CCM 1;  1ML8 A;  2IZ3 A;  1WJ2 A;  2Y0S A;  1LQL A;  2Q51 A;  2E2J I;  4XX2 A;  3I55 Z;  1I50 I;  4DK1 A;  2OOX B;  3I4M I;  1QVF Y;  1VQ6 Z;  2AYD A;  4A3D I;  3TDH B;  1X0T A;  5D1P A;  2NVY I;  2E2I I;  1RQF A;  3CCV 1;  1TWF I;  1NP6 A;  2F4M A;  3CD6 Z;  3HOY I;  2YU9 I;  2PM9 A;  2V8I A;  5C44 I;  1TWC I;  3MZK B;  1Q82 2;  2NVX I;  1JJ2 Y;  3NH5 A;  3CQZ I;  3J81 b;  3S17 I;  4MD7 A;  3MZL B;  2O53 A;  3PO3 I;  3IR7 A;  1N8R 2;  1VQN 1;  3VMI A;  1ZH1 A;  4MD8 A;  4E32 A;  3D6W A;  2QEX 1;  4HH4 A;  1TWA I;  3LUS A;  5FLX f;  1Y8C A;  3VMH A;  2VPW A;  4NFR A;  1KC8 2;  4E2W A;  3ESW A;  2JMO A;  3S1R I;  4A3I I;  3RZD I;  3HOV I;  5T67 A;  4A3B I;  3S2D I;  3FQM A;  1I6H I;  3GTM I;  1USP A;  4NBF A;  2NAP A;  3NH8 A;  3EER A;  1TFI A;  3S16 I;  1VQN Z;  3CC7 1;  3CCS Z;  5D1O B;  2VUM I;  3M3Y I;  3GTO I;  2DE5 A;  2RBL A;  2QEX Z;  2OZK A;  2M6N A;  4BBR I;  2JIQ A;  1QF8 A;  4BBS I;  1VLA A;  4A3L I;  3HOX I;  1YUA A;  2RPR A;  2K5R A;  1Q7Y 1;  3F3P C;  2IV2 X;  3J81 f;  1M90 2;  2P28 A;  2R92 I;  4RS4 A;  2JUB A;  3NDJ A;  2R7Z I;  2WB1 A;  5C4X I;  4QTT A;  1QYP A;  4A3G I;  3OW2 Z;  3CC7 Z;  1SFO I;  2Q4Z A;  1VQM Z;  2RIQ A;  4NOZ A;  4E2Y A;  3GTP I;  1NJI 2;  3GTK I;  3VB9 A;  3IF8 A;  2OTL Z;  2V45 A;  4MRI A;  2PK7 A;  3HOW I;  3IX0 A;  5T64 A;  2OTL 1;  3H0G I;  1Q82 1;  2QRE B;  2LIY A;  1VQ8 Z;  2QLV B;  4RV9 A;  1YUK A;  2GTI A;  4MXU A;  5IP7 I;  2VPY A;  2JS4 A;  2AKL A;  3CPW Z;  2I3C A;  3NDI A;  3CC2 1;  2QR1 B;  2PMZ A;  4MON A;  1VQK 1;  5IP9 I;  4NBH A;  4HGY A;  3CXC Y;  1X3W A;  1Z03 A;  1K73 1;  1KC8 1;  2BJO A;  1QVG Y;  2LFU A;  3CCQ Z;  2O4H A;  4RVD A;  4Y7N I;  2RT9 A;  1RO0 A;  3CC4 1;  4DQY B;  2HU9 A;  1Q86 2;  3CCM Z;  3CC2 Z;  1VQO 1;  2WAQ A;  1VQK Z;  4A93 I;  3EED A;  2JA7 I;  2V8J A;  1YI2 1;  2KPI A;  4NBD A;  2R6M A;  4E33 A;  2B63 I;  2DE7 A;  1AA6 A;  3CCV Z;  3D2L A;  2QKD A;  1M90 1;  3GTL I;  3J80 f;  3GKQ A;  2JIO A;  2R93 I;  1K8A 2;  1ZB8 A;  4Y52 I;  2DE6 A;  3CC4 Z;  4NB9 A;  2E7Z A;  1N2F A;  1Y1V I;  2VPX A;  3PO2 I;  3P5J B;  1VQO Z;  2P3Y A;  1NJI 1;  5AN9 F;  3JAM b;  2NVT I;  3MON A;  1TWH I;  1YI2 Z;  1VQ9 1;  2GU2 A;  3CMA 1;  4BY7 I;  4X6A I;  3KIF A;  1K9M 1;  3NFZ A;  3GTQ I;  2JIM A;  2JA6 I;  3G71 1;  1Q81 2;  1W2B Z;  4NBC A;  2W04 A;  3FKI I;  3FQQ A;  5IT9 b;  2V3V A;  1JWH C;  2ZAE B;  1YJN 1;  3PO3 S;  1VQ5 1;  1QVF Z;  2QRC B;  3VTN A;  5A2Q f;  3M4O I;  4DGL A;  2E9H A;  3I07 A;  1M1K 2;  3CMA Z;  3HOZ I;  2QRD B;  3VMG A;  1WCM I;  1Z02 A;  1YJW 1;  1S7M A;  2K3R A;  4A3J I;  1JJ2 Z;  2JNY A;  5CM2 M;  4NBA A;  1VQ7 1;  1WW9 A;  3CCE 1;  3GTM S;  1K83 I;  3K7A I;  4NH1 C;  1YJN Z;  1NUI A;  1R9T I;  3G4S 1;  3JAM f;  3CCJ 1;  2LEX A;  3J80 b;  1SIW A;  3BG0 B;  1ZB9 A;  1N8R 1;  2E2H I;  4BXX I;  4AYB A;  5C4J I;  2EGT A;  2HF1 A;  1P9N A;  1VQ6 1;  3HKZ A;  2JR6 A;  4HGZ A;  1USP B;  3QWU A;  4RVF A;  3CCR 1;  2V8K A;  2GTH A;  1VQ4 1;  1RNI A;  1YJW Z;  1QXF A;  2VPZ A;  4BY1 I;  5IT9 f;  3CCU 1;  2OOY B;  4NB8 A;  4E31 A;  3CCE Z;  1YHQ 1;  2H85 A;  4E2Z A;  2OTJ 1;  2W03 A;  3G4S Z;  1KD1 2;  3CCJ Z;  3G6E 1;  5D1O A;  3IFU A;  1RO2 A;  1X3Z A;  1RLY A;  4A3E I;  2JIR A;  2G2K A;  3D9X A;  3CCR Z;  4NBE A;  3OW2 Y;  1TWG I;  1Q81 1;  1VQ4 Z;  5C3E I;  4QTU A;  1Y1W I;  3F3F C;  5A2Q b;  3GTG I;  1WII A;  5T6B A;  4MH4 A;  1S72 1;  3I4N I;  3CCU Z;  3KIH A;  4TNU A;  1Q16 A;  1L1O C;  3T4N B;  1YHQ Z;  2JA8 I;  2M48 A;  3GTJ I;  2OTJ Z;  4E30 A;  3G6E Z;  1VQL 1;  2F4O A;  1KQS Y;  3CPW Y;  1M1K 1;  3NH4 A;  2RHB A;  3CCS 1;  3BG1 B;  3S1M I;  3I56 1;  1YIJ 1;  2JA5 I;  1YIT 1;  1S72 Z;  1K73 2;  2KI7 B;  2VUG A;  2YAD A;  4A3F I;  4A3C I;  3S15 I;  1WZN A;  1VQL Z;  1VQP 1;  3S1N I;  3CME 1;  4EWC A;  4RVG A;  1VQM 1;  1FDI A;  3I56 Z;  3S2H I;  3CXC Z;  1YJ9 1;  1YIJ Z;  2VF1 A; 
#chains in the Genus database with same CATH homology
 1RO4 A;  1QVG Z;  1VQ9 Z;  3S14 I;  1YIT Z;  3CCL 1;  5LL6 f;  3G71 Z;  3Q87 A;  1VQ8 1;  3H3V J;  3TE5 B;  3U50 C;  1Y1V S;  1KD1 1;  3RZO I;  5FLM I;  2J6A A;  1KRL A;  1VQP Z;  4E2X A;  1Q86 1;  2NVQ I;  2QA4 1;  3CME Z;  1VQ5 Z;  4S1T A;  3I55 1;  1YJ9 Z;  3HOU I;  3S1Q I;  1PFT A;  4RVH A;  3CCL Z;  1DL6 A;  1I3Q I;  4NBB A;  2IZ4 A;  4NBG A;  1K9M 2;  3CD6 1;  4CL1 A;  3CCQ 1;  4MD9 A;  3J7A 4;  3GCF A;  4A3K I;  1W2B Y;  1KQS Z;  5FLX b;  1K8A 1;  1VQ7 Z;  1Q7Y 2;  4A3M I;  1Z01 A;  2QA4 Z;  3CCM 1;  1ML8 A;  2IZ3 A;  2Y0S A;  1LQL A;  2Q51 A;  2E2J I;  4XX2 A;  3I55 Z;  1I50 I;  4DK1 A;  2OOX B;  3I4M I;  1QVF Y;  1VQ6 Z;  4A3D I;  3TDH B;  1X0T A;  5D1P A;  2NVY I;  2E2I I;  1RQF A;  3CCV 1;  1TWF I;  1NP6 A;  2F4M A;  3CD6 Z;  3HOY I;  2YU9 I;  2PM9 A;  2V8I A;  5C44 I;  1TWC I;  3MZK B;  1Q82 2;  2NVX I;  1JJ2 Y;  3NH5 A;  3CQZ I;  3J81 b;  3S17 I;  4MD7 A;  3MZL B;  2O53 A;  3PO3 I;  1N8R 2;  1VQN 1;  3VMI A;  1ZH1 A;  4MD8 A;  4E32 A;  3D6W A;  2QEX 1;  4HH4 A;  1TWA I;  3LUS A;  5FLX f;  3VMH A;  4NFR A;  1KC8 2;  4E2W A;  3ESW A;  2JMO A;  3S1R I;  4A3I I;  3RZD I;  3HOV I;  5T67 A;  4A3B I;  3S2D I;  3FQM A;  1I6H I;  3GTM I;  1USP A;  4NBF A;  3NH8 A;  3EER A;  1TFI A;  3S16 I;  1VQN Z;  3CC7 1;  3CCS Z;  5D1O B;  2VUM I;  3M3Y I;  3GTO I;  2DE5 A;  2RBL A;  2QEX Z;  2OZK A;  2M6N A;  4BBR I;  1QF8 A;  4BBS I;  1VLA A;  4A3L I;  3HOX I;  1YUA A;  2RPR A;  2K5R A;  1Q7Y 1;  3F3P C;  3J81 f;  1M90 2;  2P28 A;  2R92 I;  4RS4 A;  2JUB A;  3NDJ A;  2R7Z I;  2WB1 A;  5C4X I;  4QTT A;  1QYP A;  4A3G I;  3OW2 Z;  3CC7 Z;  1SFO I;  2Q4Z A;  1VQM Z;  2RIQ A;  4NOZ A;  4E2Y A;  3GTP I;  1NJI 2;  3GTK I;  3VB9 A;  3IF8 A;  2OTL Z;  4MRI A;  2PK7 A;  3HOW I;  3IX0 A;  5T64 A;  2OTL 1;  3H0G I;  1Q82 1;  2QRE B;  2LIY A;  1VQ8 Z;  2QLV B;  4RV9 A;  1YUK A;  2GTI A;  4MXU A;  5IP7 I;  2JS4 A;  2AKL A;  3CPW Z;  2I3C A;  3NDI A;  3CC2 1;  2QR1 B;  2PMZ A;  4MON A;  1VQK 1;  5IP9 I;  4NBH A;  4HGY A;  3CXC Y;  1X3W A;  1Z03 A;  1K73 1;  1KC8 1;  2BJO A;  1QVG Y;  2LFU A;  3CCQ Z;  2O4H A;  4RVD A;  4Y7N I;  2RT9 A;  1RO0 A;  3CC4 1;  4DQY B;  2HU9 A;  1Q86 2;  3CCM Z;  3CC2 Z;  1VQO 1;  2WAQ A;  1VQK Z;  4A93 I;  3EED A;  2JA7 I;  2V8J A;  1YI2 1;  2KPI A;  4NBD A;  2R6M A;  4E33 A;  2B63 I;  2DE7 A;  3CCV Z;  2QKD A;  1M90 1;  3GTL I;  3J80 f;  3GKQ A;  2R93 I;  1K8A 2;  1ZB8 A;  4Y52 I;  2DE6 A;  3CC4 Z;  4NB9 A;  1N2F A;  1Y1V I;  3PO2 I;  3P5J B;  1VQO Z;  2P3Y A;  1NJI 1;  5AN9 F;  3JAM b;  2NVT I;  3MON A;  1TWH I;  1YI2 Z;  1VQ9 1;  2GU2 A;  3CMA 1;  4BY7 I;  4X6A I;  3KIF A;  1K9M 1;  3NFZ A;  3GTQ I;  2JA6 I;  3G71 1;  1Q81 2;  1W2B Z;  4NBC A;  2W04 A;  3FKI I;  3FQQ A;  5IT9 b;  1JWH C;  2ZAE B;  1YJN 1;  3PO3 S;  1VQ5 1;  1QVF Z;  2QRC B;  3VTN A;  5A2Q f;  3M4O I;  4DGL A;  2E9H A;  3I07 A;  1M1K 2;  3CMA Z;  3HOZ I;  2QRD B;  3VMG A;  1WCM I;  1Z02 A;  1YJW 1;  1S7M A;  2K3R A;  4A3J I;  1JJ2 Z;  2JNY A;  5CM2 M;  4NBA A;  1VQ7 1;  1WW9 A;  3CCE 1;  3GTM S;  1K83 I;  3K7A I;  4NH1 C;  1YJN Z;  1NUI A;  1R9T I;  3G4S 1;  3JAM f;  3CCJ 1;  3J80 b;  3BG0 B;  1ZB9 A;  1N8R 1;  2E2H I;  4BXX I;  4AYB A;  5C4J I;  2EGT A;  2HF1 A;  1P9N A;  1VQ6 1;  3HKZ A;  2JR6 A;  4HGZ A;  1USP B;  3QWU A;  4RVF A;  3CCR 1;  2V8K A;  2GTH A;  1VQ4 1;  1RNI A;  1YJW Z;  4BY1 I;  5IT9 f;  3CCU 1;  2OOY B;  4NB8 A;  4E31 A;  3CCE Z;  1YHQ 1;  2H85 A;  4E2Z A;  2OTJ 1;  2W03 A;  3G4S Z;  1KD1 2;  3CCJ Z;  3G6E 1;  5D1O A;  3IFU A;  1RO2 A;  1X3Z A;  1RLY A;  4A3E I;  2G2K A;  3D9X A;  3CCR Z;  4NBE A;  3OW2 Y;  1TWG I;  1Q81 1;  1VQ4 Z;  5C3E I;  4QTU A;  1Y1W I;  3F3F C;  5A2Q b;  3GTG I;  1WII A;  5T6B A;  4MH4 A;  1S72 1;  3I4N I;  3CCU Z;  3KIH A;  4TNU A;  1L1O C;  3T4N B;  1YHQ Z;  2JA8 I;  2M48 A;  3GTJ I;  2OTJ Z;  4E30 A;  3G6E Z;  1VQL 1;  2F4O A;  1KQS Y;  3CPW Y;  1M1K 1;  3NH4 A;  2RHB A;  3CCS 1;  3BG1 B;  3S1M I;  3I56 1;  1YIJ 1;  2JA5 I;  1YIT 1;  1S72 Z;  1K73 2;  2KI7 B;  2VUG A;  2YAD A;  4A3F I;  4A3C I;  3S15 I;  1VQL Z;  1VQP 1;  3S1N I;  3CME 1;  4EWC A;  4RVG A;  1VQM 1;  3I56 Z;  3S2H I;  3CXC Z;  1YJ9 1;  1YIJ Z;  2VF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...