1QVGZ

Structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
b'TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1qvgZ00
3CPWZ 3CCQ1 1VQN1 3CCQZ 1VQNZ 3CCL1 3CCLZ 1YIJ1 1YIJZ 1QVFY 1VQ81 1M1K2 1W2BY 3CXCY 1YJW1 1KD11 1YJWZ 1VQP1 1VQPZ 3I561 3I56Z 1VQ6Z 3CCU1 3CCUZ 1KQSY 1M902 1KC82 1QVGZ 1M901 3CCJ1 1VQ51 1VQ5Z 3CC71 3CC7Z 1Q7Y2 3CCE1 3CCEZ 1Q7Y1 3CME1 2OTL1 2OTLZ 3CMEZ 3G4S1 3CCVZ 3G4SZ 3CC41 1YHQ1 1YHQZ 3CC4Z 1VQMZ 1N8R2 1M1K1 1NJI2 3G6EZ 1K8A2 1VQKZ 1VQ61 1VQO1 1NJI1 1VQOZ 1Q862 1K8A1 2QEX1 2QEXZ 1KC81 3OW2Y 1Q822 3CCS1 2QA4Z 3CCSZ 1K732 1QVFZ 3G71Z 1YJ91 1K731 1YJ9Z 3CPWY 1VQ4Z 1VQ71 3CCV1 1VQ7Z 1Q812 1KQSZ 1VQM1 1K9M2 1S721 1S72Z 1YJNZ 3G6E1 1VQK1 3CMA1 3CMAZ 1N8R1 1JJ2Z 2OTJ1 1QVGY 3CD61 2OTJZ 1YIT1 3CD6Z 1YITZ 1Q861 2QA41 3CCM1 1VQL1 3CCMZ 3I551 1VQLZ 3I55Z 3G711 1Q821 1KD12 1W2BZ 3CXCZ 1VQ8Z 1VQ41 1YI21 1YI2Z 1VQ91 1VQ9Z 3CC21 3CC2Z 1YJN1 1Q811 3CCR1 3CCRZ 1K9M1 3OW2Z 3CCJZ 1JJ2Y
chains in the Genus database with same CATH superfamily
4A3EI 3CCQ1 3CCQZ 3GTPI 3S16I 3IF8A 5C4XI 4EWCA 5CM2M 3HOZI 2WAQA 4DGLA 3I561 3GTQI 3I56Z 1ZH1A 1ZB8A 3CCU1 3P5JB 3CCUZ 1M902 1KC82 2P3YA 3J80b 2YU9I 2F4OA 1M901 5T64A 3GTMI 4BY1I 5D1PA 3CC71 3CC7Z 1WZNA 4HGZA 2F4MA 1Q7Y2 2PK7A 4Y7NI 3M4OI 1Q7Y1 3CCVZ 3CC41 1YHQ1 1YHQZ 3CC4Z 2JIPA 2V8IA 1M1K1 2QKDA 1VQ61 5IP7I 1Y8CA 2QEX1 2QEXZ 1USPA 4MD8A 3VMIA 1QYPA 3S1RI 1YJ91 2M6NA 2IV2X 1YJ9Z 2NVXI 3F3FC 5T6BA 1Z03A 4QTTA 1Q812 5C44I 4NBHA 1S721 3S14I 1S72Z 3S1MI 3HOXI 2ZAEB 1N8R1 1TWGI 1JJ2Z 2PMZA 3I07A 2OTJ1 2OTJZ 2EGTA 4RVGA 1DL6A 4NBCA 3VB9A 4NB9A 3J81f 3I551 3I55Z 1AA6A 3G711 1Q821 4XX2A 2NAPA 2O53A 2RHBA 2W04A 1VQ8Z 5FLMI 2V8JA 3GTMS 4E2WA 2KPIA 1TWCI 2M48A 3F3PC 4MXUA 1K9M1 3IFUA 3CCJZ 4A3BI 5C3EI 2HU9A 2JIMA 1N2FA 1VQN1 2VUMI 1VQNZ 3NDJA 3CQZI 5D1OB 4E2YA 1VLAA 3MZKB 2QREB 4QTUA 3CXCY 2R7ZI 2G2KA 2VPZA 1KD11 2AKLA 2E7ZA 3VMGA 1KQSY 1RNIA 2BJOA 4E2ZA 2VPWA 4MRIA 1USPB 4RS4A 2GTIA 1VQ51 1VQ5Z 1FDOA 1Y1VI 3J7A4 1Z01A 1TWAI 2V8KA 2O4HA 4NBBA 4NBEA 4NFRA 4Y52I 4MONA 2OTL1 2OTLZ 3IX0A 4X6AI 1WJ2A 1QXFA 1NJI2 4E30A 2JUBA 2Q51A 2GTHA 1RQFA 3RZDI 1VQO1 5A2Qf 1NJI1 1VQOZ 1Q862 4NB8A 1YUAA 4HGYA 3I4MI 3NH4A 1KC81 3OW2Y 1Z02A 3EERA 2QA4Z 1K732 2PM9A 1K731 2NVTI 3CPWY 5D1OA 3GKQA 3MZLB 1VQ4Z 3CCV1 1Y1WI 2R6MA 1KQSZ 1R9TI 3EEDA 3GTJI 2E2II 1YJNZ 3CMA1 3CMAZ 5AN9F 1QVGY 3CD61 3CD6Z 3PO3I 4A3II 1FDIA 3FQQA 1NP6A 5LL6f 1WIIA 1RO0A 4TNUA 2KI7B 3NH8A 1PFTA 4A93I 3S1QI 2OOYB 2VF1A 2RPRA 1Q811 3CCR1 3CCRZ 1RLYA 4NBDA 3OW2Z 2LEXA 2Q4ZA 2JA6I 1I3QI 3VMHA 1WW9A 1TWFI 2Y0SA 4DQYB 4MH4A 3CPWZ 1YIJ1 1YIJZ 3K7AI 1QVFY 1VQ81 1W2BY 2JIRA 1VQP1 1VQPZ 2RIQA 2P28A 1QVGZ 1RO2A 4NBFA 3T4NB 3CCJ1 4A3MI 4A3JI 2R92I 3CME1 3HOUI 3CMEZ 1S7MA 4RVFA 5IT9f 3PO3S 1VQMZ 2DE7A 4E2XA 3G6EZ 1K8A2 1VQKZ 4BBSI 1K8A1 1JWHC 2V3VA 1QF8A 1Q16A 2QLVB 3HOYI 4E33A 2JA5I 1QVFZ 2IZ3A 4E32A 2RBLA 3H0GI 4RV9A 2JMOA 2V45A 3IR7A 1P9NA 4E31A 2RT9A 1X3WA 4NBAA 3BG0B 4A3KI 2J6AA 4BY7I 1L1OC 2QRDB 3JAMf 2JA7I 2JS4A 3KIHA 3GTLI 1Q861 4DK1A 4NH1C 4NOZA 2QA41 2E9HA 1ML8A 3S17I 1VQL1 1VQLZ 3HKZA 1K83I 3CXCZ 1TFIA 1VQ41 3GCFA 1YI21 1YI2Z 2H85A 3I4NI 2QRCB 3FKII 3ESWA 3CC21 3J81b 3CC2Z 1YJN1 4A3GI 3QWUA 1NUIA 3D9XA 1JJ2Y 5T67A 1SFOI 1I6HI 3U50C 3BG1B 5FLXf 3CCL1 3CCLZ 3NH5A 2LIYA 3TE5B 3NFZA 2YADA 1M1K2 2B63I 3TDHB 1YJW1 3FQMA 1YJWZ 2E2JI 3HOWI 1VQ6Z 3GTGI 2K3RA 1Y1VS 2LFUA 4S1TA 2NVYI 1X3ZA 4A3FI 2JIQA 4BXXI 5IT9b 3H3VJ 4RVHA 4NBGA 2IZ4A 4A3LI 1I50I 2DE5A 3CCE1 2VUGA 2JIOA 3CCEZ 3MONA 3J80f 2WB1A 3G4S1 4MD9A 3G4SZ 4CL1A 2R93I 3GTOI 1N8R2 1RO4A 2OZKA 1LQLA 3M3YI 1KRLA 3RZOI 2OOXB 3D6WA 4HH4A 2JR6A 1TWHI 1Q822 3CCS1 4A3DI 3CCSZ 3NDIA 4RVDA 2QR1B 3G71Z 3VTNA 1WCMI 3S15I 4MD7A 5A2Qb 3JAMb 1VQ71 1VQ7Z 4AYBA 2JA8I 3LUSA 4A3CI 5C4JI 1VQM1 1K9M2 3G6E1 1VQK1 3Q87A 3GTKI 1YIT1 1YITZ 3KIFA 3S1NI 3CCM1 5IP9I 2GU2A 3CCMZ 3HOVI 3D2LA 1W2BZ 1KD12 2K5RA 1X0TA 2HF1A 2AYDA 1VQ91 1VQ9Z 2I3CA 2VPYA 2VPXA 2JNYA 1YUKA 5FLXb 2W03A 1ZB9A 4BBRI 2NVQI 2E2HI 1SIWA 3PO2I 3S2HI 3S2DI 2DE6A
chains in the Genus database with same CATH topology
4A3EI 3CCQ1 3CCQZ 3GTPI 3S16I 3IF8A 5C4XI 4EWCA 5CM2M 3HOZI 2WAQA 4DGLA 3I561 3GTQI 3I56Z 1ZH1A 1ZB8A 3CCU1 3P5JB 3CCUZ 1M902 1KC82 2P3YA 3J80b 2YU9I 2F4OA 1M901 5T64A 3GTMI 4BY1I 5D1PA 3CC71 3CC7Z 4HGZA 2F4MA 1Q7Y2 2PK7A 4Y7NI 3M4OI 1Q7Y1 3CCVZ 3CC41 1YHQ1 1YHQZ 3CC4Z 2V8IA 1M1K1 2QKDA 1VQ61 5IP7I 2QEX1 2QEXZ 1USPA 4MD8A 3VMIA 1QYPA 3S1RI 1YJ91 2M6NA 1YJ9Z 2NVXI 3F3FC 5T6BA 1Z03A 4QTTA 1Q812 5C44I 4NBHA 1S721 3S14I 1S72Z 3S1MI 3HOXI 2ZAEB 1N8R1 1TWGI 1JJ2Z 2PMZA 3I07A 2OTJ1 2OTJZ 2EGTA 4RVGA 1DL6A 4NBCA 3VB9A 4NB9A 3J81f 3I551 3I55Z 3G711 1Q821 4XX2A 2O53A 2RHBA 2W04A 1VQ8Z 5FLMI 2V8JA 3GTMS 4E2WA 2KPIA 1TWCI 2M48A 3F3PC 4MXUA 1K9M1 3IFUA 3CCJZ 4A3BI 5C3EI 2HU9A 1N2FA 1VQN1 2VUMI 1VQNZ 3NDJA 3CQZI 5D1OB 4E2YA 1VLAA 3MZKB 2QREB 4QTUA 3CXCY 2R7ZI 2G2KA 1KD11 2AKLA 3VMGA 1KQSY 1RNIA 2BJOA 4E2ZA 4MRIA 1USPB 4RS4A 2GTIA 1VQ51 1VQ5Z 1Y1VI 3J7A4 1Z01A 1TWAI 2V8KA 2O4HA 4NBBA 4NBEA 4NFRA 4Y52I 4MONA 2OTL1 2OTLZ 3IX0A 4X6AI 1NJI2 4E30A 2JUBA 2Q51A 2GTHA 1RQFA 3RZDI 1VQO1 5A2Qf 1NJI1 1VQOZ 1Q862 4NB8A 1YUAA 4HGYA 3I4MI 3NH4A 1KC81 3OW2Y 1Z02A 3EERA 2QA4Z 1K732 2PM9A 1K731 2NVTI 3CPWY 5D1OA 3GKQA 3MZLB 1VQ4Z 3CCV1 1Y1WI 2R6MA 1KQSZ 1R9TI 3EEDA 3GTJI 2E2II 1YJNZ 3CMA1 3CMAZ 5AN9F 1QVGY 3CD61 3CD6Z 3PO3I 4A3II 3FQQA 1NP6A 5LL6f 1WIIA 1RO0A 4TNUA 2KI7B 3NH8A 1PFTA 4A93I 3S1QI 2OOYB 2VF1A 2RPRA 1Q811 3CCR1 3CCRZ 1RLYA 4NBDA 3OW2Z 2Q4ZA 2JA6I 1I3QI 3VMHA 1WW9A 1TWFI 2Y0SA 4DQYB 4MH4A 3CPWZ 1YIJ1 1YIJZ 3K7AI 1QVFY 1VQ81 1W2BY 1VQP1 1VQPZ 2RIQA 2P28A 1QVGZ 1RO2A 4NBFA 3T4NB 3CCJ1 4A3MI 4A3JI 2R92I 3CME1 3HOUI 3CMEZ 1S7MA 4RVFA 5IT9f 3PO3S 1VQMZ 2DE7A 4E2XA 3G6EZ 1K8A2 1VQKZ 4BBSI 1K8A1 1JWHC 1QF8A 2QLVB 3HOYI 4E33A 2JA5I 1QVFZ 2IZ3A 4E32A 2RBLA 3H0GI 4RV9A 2JMOA 1P9NA 4E31A 2RT9A 1X3WA 4NBAA 3BG0B 4A3KI 2J6AA 4BY7I 1L1OC 2QRDB 3JAMf 2JA7I 2JS4A 3KIHA 3GTLI 1Q861 4DK1A 4NH1C 4NOZA 2QA41 2E9HA 1ML8A 3S17I 1VQL1 1VQLZ 3HKZA 1K83I 3CXCZ 1TFIA 1VQ41 3GCFA 1YI21 1YI2Z 2H85A 3I4NI 2QRCB 3FKII 3ESWA 3CC21 3J81b 3CC2Z 1YJN1 4A3GI 3QWUA 1NUIA 3D9XA 1JJ2Y 5T67A 1SFOI 1I6HI 3U50C 3BG1B 5FLXf 3CCL1 3CCLZ 3NH5A 2LIYA 3TE5B 3NFZA 2YADA 1M1K2 2B63I 3TDHB 1YJW1 3FQMA 1YJWZ 2E2JI 3HOWI 1VQ6Z 3GTGI 2K3RA 1Y1VS 2LFUA 4S1TA 2NVYI 1X3ZA 4A3FI 4BXXI 5IT9b 3H3VJ 4RVHA 4NBGA 2IZ4A 4A3LI 1I50I 2DE5A 3CCE1 2VUGA 3CCEZ 3MONA 3J80f 2WB1A 3G4S1 4MD9A 3G4SZ 4CL1A 2R93I 3GTOI 1N8R2 1RO4A 2OZKA 1LQLA 3M3YI 1KRLA 3RZOI 2OOXB 3D6WA 4HH4A 2JR6A 1TWHI 1Q822 3CCS1 4A3DI 3CCSZ 3NDIA 4RVDA 2QR1B 3G71Z 3VTNA 1WCMI 3S15I 4MD7A 5A2Qb 3JAMb 1VQ71 1VQ7Z 4AYBA 2JA8I 3LUSA 4A3CI 5C4JI 1VQM1 1K9M2 3G6E1 1VQK1 3Q87A 3GTKI 1YIT1 1YITZ 3KIFA 3S1NI 3CCM1 5IP9I 2GU2A 3CCMZ 3HOVI 1KD12 1W2BZ 2K5RA 1X0TA 2HF1A 1VQ91 1VQ9Z 2I3CA 2JNYA 1YUKA 5FLXb 2W03A 1ZB9A 4BBRI 2NVQI 2E2HI 3PO2I 3S2HI 3S2DI 2DE6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPW Z;  3CCQ 1;  1VQN 1;  3CCQ Z;  1VQN Z;  3CCL 1;  3CCL Z;  1YIJ 1;  1YIJ Z;  1QVF Y;  1VQ8 1;  1M1K 2;  1W2B Y;  3CXC Y;  1YJW 1;  1KD1 1;  1YJW Z;  1VQP 1;  1VQP Z;  3I56 1;  3I56 Z;  1VQ6 Z;  3CCU 1;  3CCU Z;  1KQS Y;  1M90 2;  1KC8 2;  1QVG Z;  1M90 1;  3CCJ 1;  1VQ5 1;  1VQ5 Z;  3CC7 1;  3CC7 Z;  1Q7Y 2;  3CCE 1;  3CCE Z;  1Q7Y 1;  3CME 1;  2OTL 1;  2OTL Z;  3CME Z;  3G4S 1;  3CCV Z;  3G4S Z;  3CC4 1;  1YHQ 1;  1YHQ Z;  3CC4 Z;  1VQM Z;  1N8R 2;  1M1K 1;  1NJI 2;  3G6E Z;  1K8A 2;  1VQK Z;  1VQ6 1;  1VQO 1;  1NJI 1;  1VQO Z;  1Q86 2;  1K8A 1;  2QEX 1;  2QEX Z;  1KC8 1;  3OW2 Y;  1Q82 2;  3CCS 1;  2QA4 Z;  3CCS Z;  1K73 2;  1QVF Z;  3G71 Z;  1YJ9 1;  1K73 1;  1YJ9 Z;  3CPW Y;  1VQ4 Z;  1VQ7 1;  3CCV 1;  1VQ7 Z;  1Q81 2;  1KQS Z;  1VQM 1;  1K9M 2;  1S72 1;  1S72 Z;  1YJN Z;  3G6E 1;  1VQK 1;  3CMA 1;  3CMA Z;  1N8R 1;  1JJ2 Z;  2OTJ 1;  1QVG Y;  3CD6 1;  2OTJ Z;  1YIT 1;  3CD6 Z;  1YIT Z;  1Q86 1;  2QA4 1;  3CCM 1;  1VQL 1;  3CCM Z;  3I55 1;  1VQL Z;  3I55 Z;  3G71 1;  1Q82 1;  1KD1 2;  1W2B Z;  3CXC Z;  1VQ8 Z;  1VQ4 1;  1YI2 1;  1YI2 Z;  1VQ9 1;  1VQ9 Z;  3CC2 1;  3CC2 Z;  1YJN 1;  1Q81 1;  3CCR 1;  3CCR Z;  1K9M 1;  3OW2 Z;  3CCJ Z;  1JJ2 Y; 
#chains in the Genus database with same CATH topology
 4A3E I;  3CCQ 1;  3CCQ Z;  3GTP I;  3S16 I;  3IF8 A;  5C4X I;  4EWC A;  5CM2 M;  3HOZ I;  2WAQ A;  4DGL A;  3I56 1;  3GTQ I;  3I56 Z;  1ZH1 A;  1ZB8 A;  3CCU 1;  3P5J B;  3CCU Z;  1M90 2;  1KC8 2;  2P3Y A;  3J80 b;  2YU9 I;  2F4O A;  1M90 1;  5T64 A;  3GTM I;  4BY1 I;  5D1P A;  3CC7 1;  3CC7 Z;  1WZN A;  4HGZ A;  2F4M A;  1Q7Y 2;  2PK7 A;  4Y7N I;  3M4O I;  1Q7Y 1;  3CCV Z;  3CC4 1;  1YHQ 1;  1YHQ Z;  3CC4 Z;  2JIP A;  2V8I A;  1M1K 1;  2QKD A;  1VQ6 1;  5IP7 I;  1Y8C A;  2QEX 1;  2QEX Z;  1USP A;  4MD8 A;  3VMI A;  1QYP A;  3S1R I;  1YJ9 1;  2M6N A;  2IV2 X;  1YJ9 Z;  2NVX I;  3F3F C;  5T6B A;  1Z03 A;  4QTT A;  1Q81 2;  5C44 I;  4NBH A;  1S72 1;  3S14 I;  1S72 Z;  3S1M I;  3HOX I;  2ZAE B;  1N8R 1;  1TWG I;  1JJ2 Z;  2PMZ A;  3I07 A;  2OTJ 1;  2OTJ Z;  2EGT A;  4RVG A;  1DL6 A;  4NBC A;  3VB9 A;  4NB9 A;  3J81 f;  3I55 1;  3I55 Z;  1AA6 A;  3G71 1;  1Q82 1;  4XX2 A;  2NAP A;  2O53 A;  2RHB A;  2W04 A;  1VQ8 Z;  5FLM I;  2V8J A;  3GTM S;  4E2W A;  2KPI A;  1TWC I;  2M48 A;  3F3P C;  4MXU A;  1K9M 1;  3IFU A;  3CCJ Z;  4A3B I;  5C3E I;  2HU9 A;  2JIM A;  1N2F A;  1VQN 1;  2VUM I;  1VQN Z;  3NDJ A;  3CQZ I;  5D1O B;  4E2Y A;  1VLA A;  3MZK B;  2QRE B;  4QTU A;  3CXC Y;  2R7Z I;  2G2K A;  2VPZ A;  1KD1 1;  2AKL A;  2E7Z A;  3VMG A;  1KQS Y;  1RNI A;  2BJO A;  4E2Z A;  2VPW A;  4MRI A;  1USP B;  4RS4 A;  2GTI A;  1VQ5 1;  1VQ5 Z;  1FDO A;  1Y1V I;  3J7A 4;  1Z01 A;  1TWA I;  2V8K A;  2O4H A;  4NBB A;  4NBE A;  4NFR A;  4Y52 I;  4MON A;  2OTL 1;  2OTL Z;  3IX0 A;  4X6A I;  1WJ2 A;  1QXF A;  1NJI 2;  4E30 A;  2JUB A;  2Q51 A;  2GTH A;  1RQF A;  3RZD I;  1VQO 1;  5A2Q f;  1NJI 1;  1VQO Z;  1Q86 2;  4NB8 A;  1YUA A;  4HGY A;  3I4M I;  3NH4 A;  1KC8 1;  3OW2 Y;  1Z02 A;  3EER A;  2QA4 Z;  1K73 2;  2PM9 A;  1K73 1;  2NVT I;  3CPW Y;  5D1O A;  3GKQ A;  3MZL B;  1VQ4 Z;  3CCV 1;  1Y1W I;  2R6M A;  1KQS Z;  1R9T I;  3EED A;  3GTJ I;  2E2I I;  1YJN Z;  3CMA 1;  3CMA Z;  5AN9 F;  1QVG Y;  3CD6 1;  3CD6 Z;  3PO3 I;  4A3I I;  1FDI A;  3FQQ A;  1NP6 A;  5LL6 f;  1WII A;  1RO0 A;  4TNU A;  2KI7 B;  3NH8 A;  1PFT A;  4A93 I;  3S1Q I;  2OOY B;  2VF1 A;  2RPR A;  1Q81 1;  3CCR 1;  3CCR Z;  1RLY A;  4NBD A;  3OW2 Z;  2LEX A;  2Q4Z A;  2JA6 I;  1I3Q I;  3VMH A;  1WW9 A;  1TWF I;  2Y0S A;  4DQY B;  4MH4 A;  3CPW Z;  1YIJ 1;  1YIJ Z;  3K7A I;  1QVF Y;  1VQ8 1;  1W2B Y;  2JIR A;  1VQP 1;  1VQP Z;  2RIQ A;  2P28 A;  1QVG Z;  1RO2 A;  4NBF A;  3T4N B;  3CCJ 1;  4A3M I;  4A3J I;  2R92 I;  3CME 1;  3HOU I;  3CME Z;  1S7M A;  4RVF A;  5IT9 f;  3PO3 S;  1VQM Z;  2DE7 A;  4E2X A;  3G6E Z;  1K8A 2;  1VQK Z;  4BBS I;  1K8A 1;  1JWH C;  2V3V A;  1QF8 A;  1Q16 A;  2QLV B;  3HOY I;  4E33 A;  2JA5 I;  1QVF Z;  2IZ3 A;  4E32 A;  2RBL A;  3H0G I;  4RV9 A;  2JMO A;  2V45 A;  3IR7 A;  1P9N A;  4E31 A;  2RT9 A;  1X3W A;  4NBA A;  3BG0 B;  4A3K I;  2J6A A;  4BY7 I;  1L1O C;  2QRD B;  3JAM f;  2JA7 I;  2JS4 A;  3KIH A;  3GTL I;  1Q86 1;  4DK1 A;  4NH1 C;  4NOZ A;  2QA4 1;  2E9H A;  1ML8 A;  3S17 I;  1VQL 1;  1VQL Z;  3HKZ A;  1K83 I;  3CXC Z;  1TFI A;  1VQ4 1;  3GCF A;  1YI2 1;  1YI2 Z;  2H85 A;  3I4N I;  2QRC B;  3FKI I;  3ESW A;  3CC2 1;  3J81 b;  3CC2 Z;  1YJN 1;  4A3G I;  3QWU A;  1NUI A;  3D9X A;  1JJ2 Y;  5T67 A;  1SFO I;  1I6H I;  3U50 C;  3BG1 B;  5FLX f;  3CCL 1;  3CCL Z;  3NH5 A;  2LIY A;  3TE5 B;  3NFZ A;  2YAD A;  1M1K 2;  2B63 I;  3TDH B;  1YJW 1;  3FQM A;  1YJW Z;  2E2J I;  3HOW I;  1VQ6 Z;  3GTG I;  2K3R A;  1Y1V S;  2LFU A;  4S1T A;  2NVY I;  1X3Z A;  4A3F I;  2JIQ A;  4BXX I;  5IT9 b;  3H3V J;  4RVH A;  4NBG A;  2IZ4 A;  4A3L I;  1I50 I;  2DE5 A;  3CCE 1;  2VUG A;  2JIO A;  3CCE Z;  3MON A;  3J80 f;  2WB1 A;  3G4S 1;  4MD9 A;  3G4S Z;  4CL1 A;  2R93 I;  3GTO I;  1N8R 2;  1RO4 A;  2OZK A;  1LQL A;  3M3Y I;  1KRL A;  3RZO I;  2OOX B;  3D6W A;  4HH4 A;  2JR6 A;  1TWH I;  1Q82 2;  3CCS 1;  4A3D I;  3CCS Z;  3NDI A;  4RVD A;  2QR1 B;  3G71 Z;  3VTN A;  1WCM I;  3S15 I;  4MD7 A;  5A2Q b;  3JAM b;  1VQ7 1;  1VQ7 Z;  4AYB A;  2JA8 I;  3LUS A;  4A3C I;  5C4J I;  1VQM 1;  1K9M 2;  3G6E 1;  1VQK 1;  3Q87 A;  3GTK I;  1YIT 1;  1YIT Z;  3KIF A;  3S1N I;  3CCM 1;  5IP9 I;  2GU2 A;  3CCM Z;  3HOV I;  3D2L A;  1W2B Z;  1KD1 2;  2K5R A;  1X0T A;  2HF1 A;  2AYD A;  1VQ9 1;  1VQ9 Z;  2I3C A;  2VPY A;  2VPX A;  2JNY A;  1YUK A;  5FLX b;  2W03 A;  1ZB9 A;  4BBR I;  2NVQ I;  2E2H I;  1SIW A;  3PO2 I;  3S2H I;  3S2D I;  2DE6 A; 
#chains in the Genus database with same CATH homology
 4A3E I;  3CCQ 1;  3CCQ Z;  3GTP I;  3S16 I;  3IF8 A;  5C4X I;  4EWC A;  5CM2 M;  3HOZ I;  2WAQ A;  4DGL A;  3I56 1;  3GTQ I;  3I56 Z;  1ZH1 A;  1ZB8 A;  3CCU 1;  3P5J B;  3CCU Z;  1M90 2;  1KC8 2;  2P3Y A;  3J80 b;  2YU9 I;  2F4O A;  1M90 1;  5T64 A;  3GTM I;  4BY1 I;  5D1P A;  3CC7 1;  3CC7 Z;  4HGZ A;  2F4M A;  1Q7Y 2;  2PK7 A;  4Y7N I;  3M4O I;  1Q7Y 1;  3CCV Z;  3CC4 1;  1YHQ 1;  1YHQ Z;  3CC4 Z;  2V8I A;  1M1K 1;  2QKD A;  1VQ6 1;  5IP7 I;  2QEX 1;  2QEX Z;  1USP A;  4MD8 A;  3VMI A;  1QYP A;  3S1R I;  1YJ9 1;  2M6N A;  1YJ9 Z;  2NVX I;  3F3F C;  5T6B A;  1Z03 A;  4QTT A;  1Q81 2;  5C44 I;  4NBH A;  1S72 1;  3S14 I;  1S72 Z;  3S1M I;  3HOX I;  2ZAE B;  1N8R 1;  1TWG I;  1JJ2 Z;  2PMZ A;  3I07 A;  2OTJ 1;  2OTJ Z;  2EGT A;  4RVG A;  1DL6 A;  4NBC A;  3VB9 A;  4NB9 A;  3J81 f;  3I55 1;  3I55 Z;  3G71 1;  1Q82 1;  4XX2 A;  2O53 A;  2RHB A;  2W04 A;  1VQ8 Z;  5FLM I;  2V8J A;  3GTM S;  4E2W A;  2KPI A;  1TWC I;  2M48 A;  3F3P C;  4MXU A;  1K9M 1;  3IFU A;  3CCJ Z;  4A3B I;  5C3E I;  2HU9 A;  1N2F A;  1VQN 1;  2VUM I;  1VQN Z;  3NDJ A;  3CQZ I;  5D1O B;  4E2Y A;  1VLA A;  3MZK B;  2QRE B;  4QTU A;  3CXC Y;  2R7Z I;  2G2K A;  1KD1 1;  2AKL A;  3VMG A;  1KQS Y;  1RNI A;  2BJO A;  4E2Z A;  4MRI A;  1USP B;  4RS4 A;  2GTI A;  1VQ5 1;  1VQ5 Z;  1Y1V I;  3J7A 4;  1Z01 A;  1TWA I;  2V8K A;  2O4H A;  4NBB A;  4NBE A;  4NFR A;  4Y52 I;  4MON A;  2OTL 1;  2OTL Z;  3IX0 A;  4X6A I;  1NJI 2;  4E30 A;  2JUB A;  2Q51 A;  2GTH A;  1RQF A;  3RZD I;  1VQO 1;  5A2Q f;  1NJI 1;  1VQO Z;  1Q86 2;  4NB8 A;  1YUA A;  4HGY A;  3I4M I;  3NH4 A;  1KC8 1;  3OW2 Y;  1Z02 A;  3EER A;  2QA4 Z;  1K73 2;  2PM9 A;  1K73 1;  2NVT I;  3CPW Y;  5D1O A;  3GKQ A;  3MZL B;  1VQ4 Z;  3CCV 1;  1Y1W I;  2R6M A;  1KQS Z;  1R9T I;  3EED A;  3GTJ I;  2E2I I;  1YJN Z;  3CMA 1;  3CMA Z;  5AN9 F;  1QVG Y;  3CD6 1;  3CD6 Z;  3PO3 I;  4A3I I;  3FQQ A;  1NP6 A;  5LL6 f;  1WII A;  1RO0 A;  4TNU A;  2KI7 B;  3NH8 A;  1PFT A;  4A93 I;  3S1Q I;  2OOY B;  2VF1 A;  2RPR A;  1Q81 1;  3CCR 1;  3CCR Z;  1RLY A;  4NBD A;  3OW2 Z;  2Q4Z A;  2JA6 I;  1I3Q I;  3VMH A;  1WW9 A;  1TWF I;  2Y0S A;  4DQY B;  4MH4 A;  3CPW Z;  1YIJ 1;  1YIJ Z;  3K7A I;  1QVF Y;  1VQ8 1;  1W2B Y;  1VQP 1;  1VQP Z;  2RIQ A;  2P28 A;  1QVG Z;  1RO2 A;  4NBF A;  3T4N B;  3CCJ 1;  4A3M I;  4A3J I;  2R92 I;  3CME 1;  3HOU I;  3CME Z;  1S7M A;  4RVF A;  5IT9 f;  3PO3 S;  1VQM Z;  2DE7 A;  4E2X A;  3G6E Z;  1K8A 2;  1VQK Z;  4BBS I;  1K8A 1;  1JWH C;  1QF8 A;  2QLV B;  3HOY I;  4E33 A;  2JA5 I;  1QVF Z;  2IZ3 A;  4E32 A;  2RBL A;  3H0G I;  4RV9 A;  2JMO A;  1P9N A;  4E31 A;  2RT9 A;  1X3W A;  4NBA A;  3BG0 B;  4A3K I;  2J6A A;  4BY7 I;  1L1O C;  2QRD B;  3JAM f;  2JA7 I;  2JS4 A;  3KIH A;  3GTL I;  1Q86 1;  4DK1 A;  4NH1 C;  4NOZ A;  2QA4 1;  2E9H A;  1ML8 A;  3S17 I;  1VQL 1;  1VQL Z;  3HKZ A;  1K83 I;  3CXC Z;  1TFI A;  1VQ4 1;  3GCF A;  1YI2 1;  1YI2 Z;  2H85 A;  3I4N I;  2QRC B;  3FKI I;  3ESW A;  3CC2 1;  3J81 b;  3CC2 Z;  1YJN 1;  4A3G I;  3QWU A;  1NUI A;  3D9X A;  1JJ2 Y;  5T67 A;  1SFO I;  1I6H I;  3U50 C;  3BG1 B;  5FLX f;  3CCL 1;  3CCL Z;  3NH5 A;  2LIY A;  3TE5 B;  3NFZ A;  2YAD A;  1M1K 2;  2B63 I;  3TDH B;  1YJW 1;  3FQM A;  1YJW Z;  2E2J I;  3HOW I;  1VQ6 Z;  3GTG I;  2K3R A;  1Y1V S;  2LFU A;  4S1T A;  2NVY I;  1X3Z A;  4A3F I;  4BXX I;  5IT9 b;  3H3V J;  4RVH A;  4NBG A;  2IZ4 A;  4A3L I;  1I50 I;  2DE5 A;  3CCE 1;  2VUG A;  3CCE Z;  3MON A;  3J80 f;  2WB1 A;  3G4S 1;  4MD9 A;  3G4S Z;  4CL1 A;  2R93 I;  3GTO I;  1N8R 2;  1RO4 A;  2OZK A;  1LQL A;  3M3Y I;  1KRL A;  3RZO I;  2OOX B;  3D6W A;  4HH4 A;  2JR6 A;  1TWH I;  1Q82 2;  3CCS 1;  4A3D I;  3CCS Z;  3NDI A;  4RVD A;  2QR1 B;  3G71 Z;  3VTN A;  1WCM I;  3S15 I;  4MD7 A;  5A2Q b;  3JAM b;  1VQ7 1;  1VQ7 Z;  4AYB A;  2JA8 I;  3LUS A;  4A3C I;  5C4J I;  1VQM 1;  1K9M 2;  3G6E 1;  1VQK 1;  3Q87 A;  3GTK I;  1YIT 1;  1YIT Z;  3KIF A;  3S1N I;  3CCM 1;  5IP9 I;  2GU2 A;  3CCM Z;  3HOV I;  1KD1 2;  1W2B Z;  2K5R A;  1X0T A;  2HF1 A;  1VQ9 1;  1VQ9 Z;  2I3C A;  2JNY A;  1YUK A;  5FLX b;  2W03 A;  1ZB9 A;  4BBR I;  2NVQ I;  2E2H I;  3PO2 I;  3S2H I;  3S2D I;  2DE6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...