1QVGZ

Structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1qvgZ00
1VQMZ 1YJN1 1M901 1VQ9Z 1K8A1 2QA41 3CC7Z 1QVGY 1VQOZ 1QVGZ 3OW2Y 3CCQ1 1YIJZ 3OW2Z 1KD12 3CCU1 3CCJ1 1YJWZ 1M1K2 3CCS1 3CCRZ 3CD61 2OTJ1 1VQNZ 1K9M2 3G4S1 1VQ71 1Q861 1M902 1K8A2 1KQSY 1VQ91 1YJ9Z 1W2BY 3CC71 1YI2Z 1VQO1 1W2BZ 1K731 1VQPZ 3CPWY 1YIJ1 1VQ6Z 3CPWZ 3CCMZ 1YJW1 1VQKZ 3CXCY 3CMEZ 3I56Z 3CXCZ 1YHQZ 3CCR1 2OTLZ 1VQ5Z 3I55Z 1VQN1 1K9M1 1Q862 1S72Z 1Q811 3CC2Z 3G71Z 1YJ91 1JJ2Y 1K732 1YI21 1JJ2Z 1VQP1 1KQSZ 1VQ61 3CCM1 1VQK1 3CME1 3I561 1VQLZ 1YHQ1 1VQ4Z 3CMA1 1VQ8Z 2OTL1 1VQ51 3I551 1QVFY 3CMAZ 1QVFZ 2QEXZ 1YITZ 1Q812 1S721 3CC4Z 3CC21 3CCLZ 3G711 1N8R1 3CCVZ 3CCEZ 1Q822 3G6EZ 1NJI2 1YJNZ 1VQL1 1VQ41 2QA4Z 1VQ81 1Q821 1NJI1 1KC82 3CCQZ 2QEX1 1Q7Y2 3CCUZ 1KD11 1YIT1 3CCJZ 3CC41 1N8R2 1KC81 3CCSZ 1M1K1 3CCL1 1Q7Y1 3CD6Z 1VQM1 2OTJZ 3CCV1 3CCE1 3G4SZ 3G6E1 1VQ7Z
chains in the Genus database with same CATH superfamily
2YADA 1VLAA 3GTOI 1K8A1 2ZAEB 2PK7A 3CCQ1 1YIJZ 3K7AI 4BBRI 2JA8I 4Y7NI 5T64A 2R6MA 1R9TI 2J6AA 3CCS1 1WZNA 3Q87A 3D2LA 3CD61 2PM9A 2RBLA 3ESWA 1VQ91 3CC71 2VPYA 1W2BZ 3KIFA 1VQPZ 2EGTA 3CPWY 2E9HA 1VQ6Z 4X6AI 5FLXb 3I56Z 3GKQA 1X3ZA 1VQ5Z 1NUIA 2OOYB 2DE6A 4NBEA 1TFIA 2IZ3A 4MONA 1YI21 3NFZA 4NH1C 1KQSZ 4HGYA 3CCM1 3S16I 1VQK1 2QKDA 1TWGI 4BBSI 4MH4A 2F4OA 2KPIA 3NH4A 2IZ4A 2JIQA 3RZDI 3I07A 3F3FC 1S721 4NBDA 2OZKA 1N8R1 2HU9A 3VMGA 4E32A 4NBFA 2KI7B 2VPZA 1Q822 3G6EZ 1K83I 4BY1I 3M3YI 1TWAI 4RVHA 1Q821 2E2II 1QYPA 4E2XA 3CCQZ 2VUGA 2M6NA 1KD11 3S1NI 1Y8CA 1RO2A 1USPB 3CCSZ 2NAPA 4MD7A 2WB1A 3CD6Z 2QLVB 2QREB 1VQM1 3J80f 3D6WA 3CCE1 3VB9A 2JIMA 3TDHB 1VQ9Z 3PO3S 4HH4A 3CC7Z 2AKLA 1FDOA 3PO3I 4DK1A 1Z02A 3CCU1 4QTUA 2OOXB 1M1K2 2Q4ZA 3F3PC 1RLYA 3EERA 1KRLA 4MRIA 3KIHA 1ML8A 1Z03A 4E33A 3P5JB 2OTJ1 4MD9A 4QTTA 1VQ71 3IF8A 1SIWA 1Q16A 1K8A2 1YUAA 1YI2Z 1VQO1 3BG0B 2WAQA 3CPWZ 2YU9I 3CCMZ 1Z01A 1VQKZ 2LEXA 5CM2M 3U50C 3PO2I 1USPA 2HF1A 3VMIA 1TWCI 3NDJA 1S72Z 2QRCB 4MXUA 1YJ91 2I3CA 2PMZA 2H85A 1QXFA 3J81f 2E2JI 1P9NA 1TWHI 2RT9A 3GTGI 3GTQI 4E2ZA 2K5RA 4A3DI 1YHQ1 3CMA1 2JNYA 5A2Qf 3I551 2VF1A 1ZB9A 4A3GI 1NP6A 4E31A 2RIQA 2LIYA 2O4HA 2RPRA 3S17I 4NOZA 3CC21 1RQFA 3G711 2O53A 2GU2A 1Y1VI 1WJ2A 3VMHA 3CCEZ 2G2KA 4RV9A 4A93I 1VQL1 3JAMb 3H3VJ 5C4XI 3FQMA 1WIIA 3QWUA 3CCUZ 2V8JA 4A3EI 2JIRA 1N8R2 3CCL1 3HOYI 2R93I 3I4MI 4XX2A 2OTJZ 2E2HI 3CCV1 2JMOA 1VQ7Z 1K9M1 1YJN1 1M901 3MZKB 3FKII 1N2FA 2QA41 2JUBA 2RHBA 4NBAA 1QVGY 5IT9b 1VQOZ 3OW2Y 4E30A 2AYDA 1L1OC 3IR7A 4NBBA 1KD12 4E2YA 3CCJ1 4S1TA 1S7MA 1I6HI 4NB8A 3HOWI 3CQZI 1Q861 1KQSY 1YJ9Z 2GTHA 2R7ZI 2BJOA 1K731 3I4NI 3T4NB 2W03A 3M4OI 2V3VA 1YJW1 3CXCY 5D1OA 4A3BI 3J81b 2NVYI 4A3FI 1LQLA 3CCR1 1YHQZ 4BY7I 3I55Z 2NVXI 4NBCA 1VQN1 3FQQA 5A2Qb 4AYBA 1Q811 2E7ZA 3CC2Z 3G71Z 1JJ2Y 5T67A 3CME1 2F4MA 1VQLZ 2P28A 3GTKI 3BG1B 2OTL1 1QVFY 1X0TA 3EEDA 3NDIA 2M48A 3GTMS 4NBGA 4E2WA 3HOVI 3S2HI 4RVDA 3CCLZ 5D1PA 3GTMI 1WW9A 1RO0A 3MZLB 2JA5I 3S15I 2V45A 3S1QI 2K3RA 2VPXA 3CCVZ 1NJI2 4A3KI 1YUKA 1YJNZ 2VPWA 1VQ41 2QA4Z 1VQ81 4A3MI 1NJI1 2GTIA 4CL1A 2V8KA 2QEX1 4TNUA 2QRDB 1Q7Y2 1YIT1 2LFUA 3CCJZ 3CC41 3MONA 2Q51A 4RVGA 1Q7Y1 3HOZI 1Y1VS 3NH8A 3GCFA 4NBHA 1JWHC 4DGLA 1VQMZ 1DL6A 4NB9A 1AA6A 2V8IA 1WCMI 1RO4A 4EWCA 5T6BA 3J7A4 1QVGZ 3J80b 5C44I 5C4JI 3OW2Z 2JS4A 2R92I 4A3JI 5D1OB 1YJWZ 2IV2X 3S1MI 1X3WA 3CCRZ 2DE5A 1VQNZ 1ZB8A 1TWFI 1K9M2 1FDIA 3G4S1 3TE5B 3NH5A 1M902 4NFRA 1SFOI 1W2BY 2P3YA 3H0GI 3HKZA 5IP9I 1QF8A 3D9XA 1YIJ1 4RVFA 3GTLI 4A3II 3CMEZ 5LL6f 2JIPA 3CXCZ 4Y52I 1RNIA 2OTLZ 2VUMI 1Q862 4A3CI 1K732 3GTJI 1JJ2Z 3S1RI 5FLXf 2NVTI 3S2DI 2Y0SA 1VQP1 4A3LI 3HOUI 1VQ61 3GTPI 2W04A 3I561 2JIOA 1VQ4Z 3IX0A 2B63I 1VQ8Z 3IFUA 1VQ51 3LUSA 1I50I 3CMAZ 4BXXI 1QVFZ 2QEXZ 3RZOI 1YITZ 1Q812 3CC4Z 3S14I 2JA7I 3JAMf 1ZH1A 3HOXI 5AN9F 4RS4A 2DE7A 5IP7I 4MD8A 2NVQI 3VTNA 2JA6I 1KC82 1I3QI 5C3EI 4HGZA 1KC81 5FLMI 1M1K1 1Y1WI 1PFTA 4DQYB 5IT9f 2JR6A 2QR1B 3G4SZ 3G6E1
chains in the Genus database with same CATH topology
2YADA 1VLAA 3GTOI 1K8A1 2ZAEB 2PK7A 3CCQ1 1YIJZ 3K7AI 4BBRI 2JA8I 4Y7NI 5T64A 2R6MA 1R9TI 2J6AA 3CCS1 3Q87A 3CD61 2PM9A 2RBLA 3ESWA 1VQ91 3CC71 1W2BZ 3KIFA 1VQPZ 2EGTA 3CPWY 2E9HA 1VQ6Z 4X6AI 5FLXb 3I56Z 3GKQA 1X3ZA 1VQ5Z 1NUIA 2OOYB 2DE6A 4NBEA 1TFIA 2IZ3A 4MONA 1YI21 3NFZA 4NH1C 1KQSZ 4HGYA 3CCM1 3S16I 1VQK1 2QKDA 1TWGI 4BBSI 4MH4A 2F4OA 2KPIA 3NH4A 2IZ4A 3RZDI 3I07A 3F3FC 1S721 4NBDA 2OZKA 1N8R1 2HU9A 3VMGA 4E32A 4NBFA 2KI7B 1Q822 3G6EZ 1K83I 4BY1I 3M3YI 1TWAI 4RVHA 1Q821 2E2II 1QYPA 4E2XA 3CCQZ 2VUGA 2M6NA 1KD11 3S1NI 1RO2A 1USPB 3CCSZ 4MD7A 2WB1A 3CD6Z 2QLVB 2QREB 1VQM1 3J80f 3D6WA 3CCE1 3VB9A 3TDHB 1VQ9Z 3PO3S 4HH4A 3CC7Z 2AKLA 3PO3I 4DK1A 1Z02A 3CCU1 4QTUA 2OOXB 1M1K2 2Q4ZA 3F3PC 1RLYA 3EERA 1KRLA 4MRIA 3KIHA 1ML8A 1Z03A 4E33A 3P5JB 2OTJ1 4MD9A 4QTTA 1VQ71 3IF8A 1K8A2 1YUAA 1YI2Z 1VQO1 3BG0B 2WAQA 3CPWZ 2YU9I 3CCMZ 1Z01A 1VQKZ 5CM2M 3U50C 3PO2I 1USPA 2HF1A 3VMIA 1TWCI 3NDJA 1S72Z 2QRCB 4MXUA 1YJ91 2I3CA 2PMZA 2H85A 3J81f 2E2JI 1P9NA 1TWHI 2RT9A 3GTGI 3GTQI 4E2ZA 2K5RA 4A3DI 1YHQ1 3CMA1 2JNYA 5A2Qf 3I551 2VF1A 1ZB9A 4A3GI 1NP6A 4E31A 2RIQA 2LIYA 2O4HA 2RPRA 3S17I 4NOZA 3CC21 1RQFA 3G711 2O53A 2GU2A 1Y1VI 3VMHA 3CCEZ 2G2KA 4RV9A 4A93I 1VQL1 3JAMb 3H3VJ 5C4XI 3FQMA 1WIIA 3QWUA 3CCUZ 2V8JA 4A3EI 1N8R2 3CCL1 3HOYI 2R93I 3I4MI 4XX2A 2OTJZ 2E2HI 3CCV1 2JMOA 1VQ7Z 1K9M1 1YJN1 1M901 3MZKB 3FKII 1N2FA 2QA41 2JUBA 2RHBA 4NBAA 1QVGY 5IT9b 1VQOZ 3OW2Y 4E30A 4NBBA 1L1OC 1KD12 4E2YA 3CCJ1 4S1TA 1S7MA 1I6HI 4NB8A 3HOWI 3CQZI 1Q861 1KQSY 1YJ9Z 2GTHA 2R7ZI 2BJOA 1K731 3I4NI 3T4NB 2W03A 3M4OI 1YJW1 3CXCY 5D1OA 4A3BI 3J81b 2NVYI 4A3FI 1LQLA 3CCR1 1YHQZ 4BY7I 3I55Z 2NVXI 4NBCA 1VQN1 3FQQA 5A2Qb 4AYBA 1Q811 3CC2Z 3G71Z 1JJ2Y 5T67A 3CME1 2F4MA 1VQLZ 2P28A 3GTKI 3BG1B 2OTL1 1QVFY 1X0TA 3EEDA 3NDIA 2M48A 3GTMS 4NBGA 4E2WA 3HOVI 3S2HI 4RVDA 3CCLZ 5D1PA 3GTMI 1WW9A 1RO0A 3MZLB 2JA5I 3S15I 3S1QI 2K3RA 3CCVZ 1NJI2 4A3KI 1YUKA 1YJNZ 1VQ41 2QA4Z 1VQ81 4A3MI 1NJI1 2GTIA 4CL1A 2V8KA 2QEX1 4TNUA 2QRDB 1Q7Y2 1YIT1 2LFUA 3CCJZ 3CC41 3MONA 2Q51A 4RVGA 1Q7Y1 3HOZI 1Y1VS 3NH8A 3GCFA 4NBHA 1JWHC 4DGLA 1VQMZ 1DL6A 4NB9A 2V8IA 1WCMI 1RO4A 4EWCA 5T6BA 3J7A4 1QVGZ 3J80b 5C44I 5C4JI 3OW2Z 2JS4A 2R92I 4A3JI 5D1OB 1YJWZ 3S1MI 1X3WA 3CCRZ 2DE5A 1VQNZ 1ZB8A 1TWFI 1K9M2 3G4S1 3TE5B 3NH5A 1M902 4NFRA 1SFOI 1W2BY 2P3YA 3H0GI 3HKZA 5IP9I 1QF8A 3D9XA 1YIJ1 4RVFA 3GTLI 4A3II 3CMEZ 5LL6f 3CXCZ 4Y52I 1RNIA 2OTLZ 2VUMI 1Q862 4A3CI 1K732 3GTJI 1JJ2Z 3S1RI 5FLXf 2NVTI 3S2DI 2Y0SA 1VQP1 4A3LI 3HOUI 1VQ61 3GTPI 2W04A 3I561 1VQ4Z 3IX0A 2B63I 1VQ8Z 3IFUA 1VQ51 3LUSA 1I50I 3CMAZ 4BXXI 1QVFZ 2QEXZ 3RZOI 1YITZ 1Q812 3CC4Z 3S14I 2JA7I 3JAMf 1ZH1A 3HOXI 5AN9F 4RS4A 2DE7A 5IP7I 4MD8A 2NVQI 3VTNA 2JA6I 1KC82 1I3QI 5C3EI 4HGZA 1KC81 5FLMI 1M1K1 1Y1WI 1PFTA 4DQYB 5IT9f 2JR6A 2QR1B 3G4SZ 3G6E1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQM Z;  1YJN 1;  1M90 1;  1VQ9 Z;  1K8A 1;  2QA4 1;  3CC7 Z;  1QVG Y;  1VQO Z;  1QVG Z;  3OW2 Y;  3CCQ 1;  1YIJ Z;  3OW2 Z;  1KD1 2;  3CCU 1;  3CCJ 1;  1YJW Z;  1M1K 2;  3CCS 1;  3CCR Z;  3CD6 1;  2OTJ 1;  1VQN Z;  1K9M 2;  3G4S 1;  1VQ7 1;  1Q86 1;  1M90 2;  1K8A 2;  1KQS Y;  1VQ9 1;  1YJ9 Z;  1W2B Y;  3CC7 1;  1YI2 Z;  1VQO 1;  1W2B Z;  1K73 1;  1VQP Z;  3CPW Y;  1YIJ 1;  1VQ6 Z;  3CPW Z;  3CCM Z;  1YJW 1;  1VQK Z;  3CXC Y;  3CME Z;  3I56 Z;  3CXC Z;  1YHQ Z;  3CCR 1;  2OTL Z;  1VQ5 Z;  3I55 Z;  1VQN 1;  1K9M 1;  1Q86 2;  1S72 Z;  1Q81 1;  3CC2 Z;  3G71 Z;  1YJ9 1;  1JJ2 Y;  1K73 2;  1YI2 1;  1JJ2 Z;  1VQP 1;  1KQS Z;  1VQ6 1;  3CCM 1;  1VQK 1;  3CME 1;  3I56 1;  1VQL Z;  1YHQ 1;  1VQ4 Z;  3CMA 1;  1VQ8 Z;  2OTL 1;  1VQ5 1;  3I55 1;  1QVF Y;  3CMA Z;  1QVF Z;  2QEX Z;  1YIT Z;  1Q81 2;  1S72 1;  3CC4 Z;  3CC2 1;  3CCL Z;  3G71 1;  1N8R 1;  3CCV Z;  3CCE Z;  1Q82 2;  3G6E Z;  1NJI 2;  1YJN Z;  1VQL 1;  1VQ4 1;  2QA4 Z;  1VQ8 1;  1Q82 1;  1NJI 1;  1KC8 2;  3CCQ Z;  2QEX 1;  1Q7Y 2;  3CCU Z;  1KD1 1;  1YIT 1;  3CCJ Z;  3CC4 1;  1N8R 2;  1KC8 1;  3CCS Z;  1M1K 1;  3CCL 1;  1Q7Y 1;  3CD6 Z;  1VQM 1;  2OTJ Z;  3CCV 1;  3CCE 1;  3G4S Z;  3G6E 1;  1VQ7 Z; 
#chains in the Genus database with same CATH topology
 2YAD A;  1VLA A;  3GTO I;  1K8A 1;  2ZAE B;  2PK7 A;  3CCQ 1;  1YIJ Z;  3K7A I;  4BBR I;  2JA8 I;  4Y7N I;  5T64 A;  2R6M A;  1R9T I;  2J6A A;  3CCS 1;  1WZN A;  3Q87 A;  3D2L A;  3CD6 1;  2PM9 A;  2RBL A;  3ESW A;  1VQ9 1;  3CC7 1;  2VPY A;  1W2B Z;  3KIF A;  1VQP Z;  2EGT A;  3CPW Y;  2E9H A;  1VQ6 Z;  4X6A I;  5FLX b;  3I56 Z;  3GKQ A;  1X3Z A;  1VQ5 Z;  1NUI A;  2OOY B;  2DE6 A;  4NBE A;  1TFI A;  2IZ3 A;  4MON A;  1YI2 1;  3NFZ A;  4NH1 C;  1KQS Z;  4HGY A;  3CCM 1;  3S16 I;  1VQK 1;  2QKD A;  1TWG I;  4BBS I;  4MH4 A;  2F4O A;  2KPI A;  3NH4 A;  2IZ4 A;  2JIQ A;  3RZD I;  3I07 A;  3F3F C;  1S72 1;  4NBD A;  2OZK A;  1N8R 1;  2HU9 A;  3VMG A;  4E32 A;  4NBF A;  2KI7 B;  2VPZ A;  1Q82 2;  3G6E Z;  1K83 I;  4BY1 I;  3M3Y I;  1TWA I;  4RVH A;  1Q82 1;  2E2I I;  1QYP A;  4E2X A;  3CCQ Z;  2VUG A;  2M6N A;  1KD1 1;  3S1N I;  1Y8C A;  1RO2 A;  1USP B;  3CCS Z;  2NAP A;  4MD7 A;  2WB1 A;  3CD6 Z;  2QLV B;  2QRE B;  1VQM 1;  3J80 f;  3D6W A;  3CCE 1;  3VB9 A;  2JIM A;  3TDH B;  1VQ9 Z;  3PO3 S;  4HH4 A;  3CC7 Z;  2AKL A;  1FDO A;  3PO3 I;  4DK1 A;  1Z02 A;  3CCU 1;  4QTU A;  2OOX B;  1M1K 2;  2Q4Z A;  3F3P C;  1RLY A;  3EER A;  1KRL A;  4MRI A;  3KIH A;  1ML8 A;  1Z03 A;  4E33 A;  3P5J B;  2OTJ 1;  4MD9 A;  4QTT A;  1VQ7 1;  3IF8 A;  1SIW A;  1Q16 A;  1K8A 2;  1YUA A;  1YI2 Z;  1VQO 1;  3BG0 B;  2WAQ A;  3CPW Z;  2YU9 I;  3CCM Z;  1Z01 A;  1VQK Z;  2LEX A;  5CM2 M;  3U50 C;  3PO2 I;  1USP A;  2HF1 A;  3VMI A;  1TWC I;  3NDJ A;  1S72 Z;  2QRC B;  4MXU A;  1YJ9 1;  2I3C A;  2PMZ A;  2H85 A;  1QXF A;  3J81 f;  2E2J I;  1P9N A;  1TWH I;  2RT9 A;  3GTG I;  3GTQ I;  4E2Z A;  2K5R A;  4A3D I;  1YHQ 1;  3CMA 1;  2JNY A;  5A2Q f;  3I55 1;  2VF1 A;  1ZB9 A;  4A3G I;  1NP6 A;  4E31 A;  2RIQ A;  2LIY A;  2O4H A;  2RPR A;  3S17 I;  4NOZ A;  3CC2 1;  1RQF A;  3G71 1;  2O53 A;  2GU2 A;  1Y1V I;  1WJ2 A;  3VMH A;  3CCE Z;  2G2K A;  4RV9 A;  4A93 I;  1VQL 1;  3JAM b;  3H3V J;  5C4X I;  3FQM A;  1WII A;  3QWU A;  3CCU Z;  2V8J A;  4A3E I;  2JIR A;  1N8R 2;  3CCL 1;  3HOY I;  2R93 I;  3I4M I;  4XX2 A;  2OTJ Z;  2E2H I;  3CCV 1;  2JMO A;  1VQ7 Z;  1K9M 1;  1YJN 1;  1M90 1;  3MZK B;  3FKI I;  1N2F A;  2QA4 1;  2JUB A;  2RHB A;  4NBA A;  1QVG Y;  5IT9 b;  1VQO Z;  3OW2 Y;  4E30 A;  2AYD A;  1L1O C;  3IR7 A;  4NBB A;  1KD1 2;  4E2Y A;  3CCJ 1;  4S1T A;  1S7M A;  1I6H I;  4NB8 A;  3HOW I;  3CQZ I;  1Q86 1;  1KQS Y;  1YJ9 Z;  2GTH A;  2R7Z I;  2BJO A;  1K73 1;  3I4N I;  3T4N B;  2W03 A;  3M4O I;  2V3V A;  1YJW 1;  3CXC Y;  5D1O A;  4A3B I;  3J81 b;  2NVY I;  4A3F I;  1LQL A;  3CCR 1;  1YHQ Z;  4BY7 I;  3I55 Z;  2NVX I;  4NBC A;  1VQN 1;  3FQQ A;  5A2Q b;  4AYB A;  1Q81 1;  2E7Z A;  3CC2 Z;  3G71 Z;  1JJ2 Y;  5T67 A;  3CME 1;  2F4M A;  1VQL Z;  2P28 A;  3GTK I;  3BG1 B;  2OTL 1;  1QVF Y;  1X0T A;  3EED A;  3NDI A;  2M48 A;  3GTM S;  4NBG A;  4E2W A;  3HOV I;  3S2H I;  4RVD A;  3CCL Z;  5D1P A;  3GTM I;  1WW9 A;  1RO0 A;  3MZL B;  2JA5 I;  3S15 I;  2V45 A;  3S1Q I;  2K3R A;  2VPX A;  3CCV Z;  1NJI 2;  4A3K I;  1YUK A;  1YJN Z;  2VPW A;  1VQ4 1;  2QA4 Z;  1VQ8 1;  4A3M I;  1NJI 1;  2GTI A;  4CL1 A;  2V8K A;  2QEX 1;  4TNU A;  2QRD B;  1Q7Y 2;  1YIT 1;  2LFU A;  3CCJ Z;  3CC4 1;  3MON A;  2Q51 A;  4RVG A;  1Q7Y 1;  3HOZ I;  1Y1V S;  3NH8 A;  3GCF A;  4NBH A;  1JWH C;  4DGL A;  1VQM Z;  1DL6 A;  4NB9 A;  1AA6 A;  2V8I A;  1WCM I;  1RO4 A;  4EWC A;  5T6B A;  3J7A 4;  1QVG Z;  3J80 b;  5C44 I;  5C4J I;  3OW2 Z;  2JS4 A;  2R92 I;  4A3J I;  5D1O B;  1YJW Z;  2IV2 X;  3S1M I;  1X3W A;  3CCR Z;  2DE5 A;  1VQN Z;  1ZB8 A;  1TWF I;  1K9M 2;  1FDI A;  3G4S 1;  3TE5 B;  3NH5 A;  1M90 2;  4NFR A;  1SFO I;  1W2B Y;  2P3Y A;  3H0G I;  3HKZ A;  5IP9 I;  1QF8 A;  3D9X A;  1YIJ 1;  4RVF A;  3GTL I;  4A3I I;  3CME Z;  5LL6 f;  2JIP A;  3CXC Z;  4Y52 I;  1RNI A;  2OTL Z;  2VUM I;  1Q86 2;  4A3C I;  1K73 2;  3GTJ I;  1JJ2 Z;  3S1R I;  5FLX f;  2NVT I;  3S2D I;  2Y0S A;  1VQP 1;  4A3L I;  3HOU I;  1VQ6 1;  3GTP I;  2W04 A;  3I56 1;  2JIO A;  1VQ4 Z;  3IX0 A;  2B63 I;  1VQ8 Z;  3IFU A;  1VQ5 1;  3LUS A;  1I50 I;  3CMA Z;  4BXX I;  1QVF Z;  2QEX Z;  3RZO I;  1YIT Z;  1Q81 2;  3CC4 Z;  3S14 I;  2JA7 I;  3JAM f;  1ZH1 A;  3HOX I;  5AN9 F;  4RS4 A;  2DE7 A;  5IP7 I;  4MD8 A;  2NVQ I;  3VTN A;  2JA6 I;  1KC8 2;  1I3Q I;  5C3E I;  4HGZ A;  1KC8 1;  5FLM I;  1M1K 1;  1Y1W I;  1PFT A;  4DQY B;  5IT9 f;  2JR6 A;  2QR1 B;  3G4S Z;  3G6E 1; 
#chains in the Genus database with same CATH homology
 2YAD A;  1VLA A;  3GTO I;  1K8A 1;  2ZAE B;  2PK7 A;  3CCQ 1;  1YIJ Z;  3K7A I;  4BBR I;  2JA8 I;  4Y7N I;  5T64 A;  2R6M A;  1R9T I;  2J6A A;  3CCS 1;  3Q87 A;  3CD6 1;  2PM9 A;  2RBL A;  3ESW A;  1VQ9 1;  3CC7 1;  1W2B Z;  3KIF A;  1VQP Z;  2EGT A;  3CPW Y;  2E9H A;  1VQ6 Z;  4X6A I;  5FLX b;  3I56 Z;  3GKQ A;  1X3Z A;  1VQ5 Z;  1NUI A;  2OOY B;  2DE6 A;  4NBE A;  1TFI A;  2IZ3 A;  4MON A;  1YI2 1;  3NFZ A;  4NH1 C;  1KQS Z;  4HGY A;  3CCM 1;  3S16 I;  1VQK 1;  2QKD A;  1TWG I;  4BBS I;  4MH4 A;  2F4O A;  2KPI A;  3NH4 A;  2IZ4 A;  3RZD I;  3I07 A;  3F3F C;  1S72 1;  4NBD A;  2OZK A;  1N8R 1;  2HU9 A;  3VMG A;  4E32 A;  4NBF A;  2KI7 B;  1Q82 2;  3G6E Z;  1K83 I;  4BY1 I;  3M3Y I;  1TWA I;  4RVH A;  1Q82 1;  2E2I I;  1QYP A;  4E2X A;  3CCQ Z;  2VUG A;  2M6N A;  1KD1 1;  3S1N I;  1RO2 A;  1USP B;  3CCS Z;  4MD7 A;  2WB1 A;  3CD6 Z;  2QLV B;  2QRE B;  1VQM 1;  3J80 f;  3D6W A;  3CCE 1;  3VB9 A;  3TDH B;  1VQ9 Z;  3PO3 S;  4HH4 A;  3CC7 Z;  2AKL A;  3PO3 I;  4DK1 A;  1Z02 A;  3CCU 1;  4QTU A;  2OOX B;  1M1K 2;  2Q4Z A;  3F3P C;  1RLY A;  3EER A;  1KRL A;  4MRI A;  3KIH A;  1ML8 A;  1Z03 A;  4E33 A;  3P5J B;  2OTJ 1;  4MD9 A;  4QTT A;  1VQ7 1;  3IF8 A;  1K8A 2;  1YUA A;  1YI2 Z;  1VQO 1;  3BG0 B;  2WAQ A;  3CPW Z;  2YU9 I;  3CCM Z;  1Z01 A;  1VQK Z;  5CM2 M;  3U50 C;  3PO2 I;  1USP A;  2HF1 A;  3VMI A;  1TWC I;  3NDJ A;  1S72 Z;  2QRC B;  4MXU A;  1YJ9 1;  2I3C A;  2PMZ A;  2H85 A;  3J81 f;  2E2J I;  1P9N A;  1TWH I;  2RT9 A;  3GTG I;  3GTQ I;  4E2Z A;  2K5R A;  4A3D I;  1YHQ 1;  3CMA 1;  2JNY A;  5A2Q f;  3I55 1;  2VF1 A;  1ZB9 A;  4A3G I;  1NP6 A;  4E31 A;  2RIQ A;  2LIY A;  2O4H A;  2RPR A;  3S17 I;  4NOZ A;  3CC2 1;  1RQF A;  3G71 1;  2O53 A;  2GU2 A;  1Y1V I;  3VMH A;  3CCE Z;  2G2K A;  4RV9 A;  4A93 I;  1VQL 1;  3JAM b;  3H3V J;  5C4X I;  3FQM A;  1WII A;  3QWU A;  3CCU Z;  2V8J A;  4A3E I;  1N8R 2;  3CCL 1;  3HOY I;  2R93 I;  3I4M I;  4XX2 A;  2OTJ Z;  2E2H I;  3CCV 1;  2JMO A;  1VQ7 Z;  1K9M 1;  1YJN 1;  1M90 1;  3MZK B;  3FKI I;  1N2F A;  2QA4 1;  2JUB A;  2RHB A;  4NBA A;  1QVG Y;  5IT9 b;  1VQO Z;  3OW2 Y;  4E30 A;  4NBB A;  1L1O C;  1KD1 2;  4E2Y A;  3CCJ 1;  4S1T A;  1S7M A;  1I6H I;  4NB8 A;  3HOW I;  3CQZ I;  1Q86 1;  1KQS Y;  1YJ9 Z;  2GTH A;  2R7Z I;  2BJO A;  1K73 1;  3I4N I;  3T4N B;  2W03 A;  3M4O I;  1YJW 1;  3CXC Y;  5D1O A;  4A3B I;  3J81 b;  2NVY I;  4A3F I;  1LQL A;  3CCR 1;  1YHQ Z;  4BY7 I;  3I55 Z;  2NVX I;  4NBC A;  1VQN 1;  3FQQ A;  5A2Q b;  4AYB A;  1Q81 1;  3CC2 Z;  3G71 Z;  1JJ2 Y;  5T67 A;  3CME 1;  2F4M A;  1VQL Z;  2P28 A;  3GTK I;  3BG1 B;  2OTL 1;  1QVF Y;  1X0T A;  3EED A;  3NDI A;  2M48 A;  3GTM S;  4NBG A;  4E2W A;  3HOV I;  3S2H I;  4RVD A;  3CCL Z;  5D1P A;  3GTM I;  1WW9 A;  1RO0 A;  3MZL B;  2JA5 I;  3S15 I;  3S1Q I;  2K3R A;  3CCV Z;  1NJI 2;  4A3K I;  1YUK A;  1YJN Z;  1VQ4 1;  2QA4 Z;  1VQ8 1;  4A3M I;  1NJI 1;  2GTI A;  4CL1 A;  2V8K A;  2QEX 1;  4TNU A;  2QRD B;  1Q7Y 2;  1YIT 1;  2LFU A;  3CCJ Z;  3CC4 1;  3MON A;  2Q51 A;  4RVG A;  1Q7Y 1;  3HOZ I;  1Y1V S;  3NH8 A;  3GCF A;  4NBH A;  1JWH C;  4DGL A;  1VQM Z;  1DL6 A;  4NB9 A;  2V8I A;  1WCM I;  1RO4 A;  4EWC A;  5T6B A;  3J7A 4;  1QVG Z;  3J80 b;  5C44 I;  5C4J I;  3OW2 Z;  2JS4 A;  2R92 I;  4A3J I;  5D1O B;  1YJW Z;  3S1M I;  1X3W A;  3CCR Z;  2DE5 A;  1VQN Z;  1ZB8 A;  1TWF I;  1K9M 2;  3G4S 1;  3TE5 B;  3NH5 A;  1M90 2;  4NFR A;  1SFO I;  1W2B Y;  2P3Y A;  3H0G I;  3HKZ A;  5IP9 I;  1QF8 A;  3D9X A;  1YIJ 1;  4RVF A;  3GTL I;  4A3I I;  3CME Z;  5LL6 f;  3CXC Z;  4Y52 I;  1RNI A;  2OTL Z;  2VUM I;  1Q86 2;  4A3C I;  1K73 2;  3GTJ I;  1JJ2 Z;  3S1R I;  5FLX f;  2NVT I;  3S2D I;  2Y0S A;  1VQP 1;  4A3L I;  3HOU I;  1VQ6 1;  3GTP I;  2W04 A;  3I56 1;  1VQ4 Z;  3IX0 A;  2B63 I;  1VQ8 Z;  3IFU A;  1VQ5 1;  3LUS A;  1I50 I;  3CMA Z;  4BXX I;  1QVF Z;  2QEX Z;  3RZO I;  1YIT Z;  1Q81 2;  3CC4 Z;  3S14 I;  2JA7 I;  3JAM f;  1ZH1 A;  3HOX I;  5AN9 F;  4RS4 A;  2DE7 A;  5IP7 I;  4MD8 A;  2NVQ I;  3VTN A;  2JA6 I;  1KC8 2;  1I3Q I;  5C3E I;  4HGZ A;  1KC8 1;  5FLM I;  1M1K 1;  1Y1W I;  1PFT A;  4DQY B;  5IT9 f;  2JR6 A;  2QR1 B;  3G4S Z;  3G6E 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...