1QVGZ

Structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1qvgZ00
1JJ2Z 1QVFZ 1VQP1 1Q822 1W2BY 1S721 3CC4Z 1YIJZ 3CCSZ 1YI2Z 3G71Z 3CCJ1 3OW2Z 3CCQZ 1VQ71 3CCRZ 1VQ61 1YITZ 1Q862 1Q861 3CCLZ 1W2BZ 2OTJ1 1VQ41 2QEX1 3CMA1 3CCEZ 3CCU1 1Q812 3CCMZ 3CC21 1VQM1 2QA41 1Q811 1K731 1VQK1 3I55Z 1VQ5Z 1VQNZ 1KQSZ 3CCV1 1YHQZ 1N8R1 1Q7Y2 1NJI1 1Q7Y1 1YJW1 1M1K2 1M1K1 3CD6Z 2OTL1 1VQ81 1VQL1 3CC7Z 1VQ9Z 1VQOZ 3CME1 1YJ9Z 3G4S1 3CC41 1QVGY 3CCS1 3I56Z 3CCQ1 3CCR1 1VQPZ 3CCL1 1K8A2 1K8A1 1QVGZ 1YJN1 1K732 1S72Z 3CCE1 3CXCY 3CPWY 1K9M2 3I551 1N8R2 1K9M1 1NJI2 3G6EZ 3CCJZ 1JJ2Y 1VQ7Z 1VQ6Z 1YJ91 2OTJZ 1YIJ1 1KD12 3CXCZ 2QEXZ 3CPWZ 3CMAZ 1YI21 1KD11 1VQ4Z 3G711 1M902 3CCUZ 1KC82 3CC2Z 1VQMZ 2QA4Z 1KC81 1M901 1VQKZ 3I561 3CCVZ 1YIT1 3OW2Y 1YJWZ 2OTLZ 1VQ8Z 1VQLZ 3CMEZ 3CCM1 1Q821 3G4SZ 1VQ51 1VQN1 1YHQ1 3G6E1 3CD61 1KQSY 3CC71 1VQ91 1VQO1 1QVFY 1YJNZ
chains in the Genus database with same CATH superfamily
1RNIA 1L1OC 1TWHI 3F3FC 5T6BA 1RQFA 1Y1WI 4NBEA 2O53A 4E2XA 2AYDA 2E2II 2IZ4A 3J80f 4MH4A 3T4NB 2B63I 1VQ71 3I4NI 1JWHC 3KIFA 3GTJI 1R9TI 5IP7I 2NAPA 3CCU1 3CCMZ 1VQM1 1K731 2VPWA 2VPXA 1VQK1 1I6HI 5C4XI 2VPZA 4E31A 2GTIA 2QKDA 4TNUA 1YJW1 1M1K1 2OTL1 4XX2A 1VQ81 2RHBA 3CC7Z 1VQ9Z 2W04A 3F3PC 1ZB8A 1QVGY 3J80b 1X3ZA 1S7MA 3D6WA 1RO2A 2J6AA 2R6MA 4A3DI 2VF1A 4E2WA 3JAMf 3S14I 4NH1C 1K8A2 1PFTA 2QLVB 1K732 5T64A 2JMOA 1K9M2 3TE5B 3NH5A 3I551 4NFRA 3S16I 5IP9I 1WZNA 1TWCI 3VB9A 5C44I 1KD11 1VQ4Z 3GTMI 4MD9A 1SIWA 2JA8I 1KC82 1M901 2QA4Z 4NB9A 2PK7A 3I561 4NBCA 3HKZA 2IV2X 3D9XA 2R7ZI 3JAMb 3IX0A 3CMEZ 1NUIA 4NBFA 2ZAEB 4A3LI 1X3WA 3HOWI 3H0GI 3IFUA 2I3CA 4E33A 5T67A 1QVFY 2V45A 3ESWA 3Q87A 4MD7A 1USPB 1P9NA 3RZDI 3CQZI 2V8IA 2G2KA 1ZB9A 3NH8A 4RVFA 1Y1VS 2RPRA 3D2LA 2JA5I 3GCFA 5IT9b 4NBDA 1TWFI 1YI2Z 1TWGI 4A3JI 4BY1I 3CCQZ 3PO3S 2RIQA 3CCRZ 1YITZ 1Q862 1W2BZ 2OTJ1 1RO4A 3S1RI 1VLAA 3CMA1 4A3MI 3CCEZ 4A3FI 3M3YI 2OOYB 1USPA 3S1QI 1FDOA 1VQ5Z 4MONA 3CCV1 2VUMI 3FKII 3CD6Z 2Q4ZA 3HOUI 2P3YA 1WIIA 1VQL1 5A2Qf 4HGYA 1FDIA 2NVTI 4DK1A 1QYPA 1X0TA 4RVHA 2E2JI 3J7A4 4MRIA 1Q16A 1K8A1 1YJN1 4BXXI 3M4OI 2V3VA 4RVDA 3CPWY 1K9M1 2VUGA 2JIMA 2M6NA 3NH4A 4E30A 1VQ7Z 3NFZA 5A2Qb 1YIJ1 4Y52I 2R93I 3CXCZ 1WCMI 3G711 3CCUZ 2KI7B 1VQKZ 1VQMZ 1KC81 4S1TA 2RBLA 3GTGI 1QF8A 3GTQI 1YJWZ 2QREB 2OTLZ 1VQ8Z 2JIOA 1DL6A 1VQN1 1NP6A 3PO2I 2PMZA 2OOXB 1YHQ1 3GTMS 2O4HA 1VQO1 2E2HI 4A3EI 1YUKA 2NVYI 3BG1B 4HH4A 3VMHA 3J81f 4NBGA 1VQP1 1QXFA 3S2HI 1Y8CA 2V8JA 1S721 3CC4Z 3IR7A 3CCSZ 3FQMA 1ML8A 4NBBA 2DE6A 3CCJ1 1Z03A 2JIQA 1VQ61 1Q861 4RVGA 3CCLZ 3GTOI 3IF8A 4RV9A 2QEX1 3GTKI 2W03A 4RS4A 4DQYB 4QTTA 1Q812 5FLXf 3CC21 1KQSZ 2JUBA 1Z02A 3VMGA 3J81b 1Q7Y2 2Y0SA 2PM9A 1YJ9Z 3VTNA 4A93I 3G4S1 1Z01A 3LUSA 4Y7NI 2BJOA 3NDIA 1YUAA 3CCQ1 3CCR1 2JIRA 2JA6I 4E2YA 1QVGZ 3U50C 3GKQA 2EGTA 3CCE1 2QRCB 1WJ2A 2K3RA 5FLXb 2NVXI 5FLMI 4AYBA 1SFOI 1TWAI 4A3II 2P28A 4CL1A 3G6EZ 4BBRI 2HF1A 2DE7A 4BBSI 2OTJZ 2YADA 3CMAZ 1KRLA 3BG0B 3KIHA 1RO0A 3CCVZ 1ZH1A 1WW9A 5D1OB 2JA7I 2LIYA 4NB8A 2LEXA 4E32A 4A3KI 1VQLZ 1AA6A 3CCM1 1Q821 1I3QI 3RZOI 3S1MI 3MZKB 1KQSY 2F4OA 3CC71 1VQ91 3QWUA 4MXUA 5C3EI 1YJNZ 2JR6A 4NBHA 1RLYA 2RT9A 3I07A 1JJ2Z 2JNYA 1QVFZ 2QRDB 4MD8A 5LL6f 5D1OA 3GTPI 1Q822 3EEDA 1W2BY 1N2FA 1YIJZ 2VPYA 4DGLA 3G71Z 5CM2M 3OW2Z 4QTUA 4BY7I 2IZ3A 3MONA 2KPIA 5D1PA 1VQ41 2YU9I 4A3CI 1Q811 2E7ZA 2QA41 3I55Z 1VQNZ 2JIPA 4A3GI 2R92I 3S1NI 2HU9A 1YHQZ 1N8R1 1NJI1 1Q7Y1 1M1K2 1VQOZ 2LFUA 3CME1 3CC41 3CCS1 2WAQA 3P5JB 3HOZI 2E9HA 1K83I 3I56Z 3S15I 4HGZA 3H3VJ 2GU2A 2M48A 4NOZA 1VQPZ 3CCL1 2OZKA 2Q51A 2DE5A 5AN9F 3GTLI 2GTHA 1S72Z 3TDHB 5IT9f 3CXCY 2AKLA 1N8R2 1NJI2 3S2DI 3CCJZ 4EWCA 1JJ2Y 4X6AI 3HOVI 1VQ6Z 3VMIA 1YJ91 1TFIA 1KD12 2K5RA 3MZLB 2QEXZ 3CPWZ 1YI21 1M902 3CC2Z 3EERA 3FQQA 1I50I 4A3BI 2H85A 1YIT1 3I4MI 1LQLA 3NDJA 3OW2Y 2WB1A 4E2ZA 3HOYI 2F4MA 3G4SZ 2JS4A 1VQ51 3HOXI 1Y1VI 2NVQI 2V8KA 3S17I 3G6E1 3CD61 2QR1B 4NBAA 5C4JI 3K7AI 3PO3I
chains in the Genus database with same CATH topology
1RNIA 1L1OC 1TWHI 3F3FC 5T6BA 1RQFA 1Y1WI 4NBEA 2O53A 4E2XA 2E2II 2IZ4A 3J80f 4MH4A 3T4NB 2B63I 1VQ71 3I4NI 1JWHC 3KIFA 3GTJI 1R9TI 5IP7I 3CCU1 3CCMZ 1VQM1 1K731 1VQK1 1I6HI 5C4XI 4E31A 2GTIA 2QKDA 4TNUA 1YJW1 1M1K1 2OTL1 4XX2A 1VQ81 2RHBA 3CC7Z 1VQ9Z 2W04A 3F3PC 1ZB8A 1QVGY 3J80b 1X3ZA 1S7MA 3D6WA 1RO2A 2J6AA 2R6MA 4A3DI 2VF1A 4E2WA 3JAMf 3S14I 4NH1C 1K8A2 1PFTA 2QLVB 1K732 5T64A 2JMOA 1K9M2 3TE5B 3NH5A 3I551 4NFRA 3S16I 5IP9I 1TWCI 3VB9A 5C44I 1KD11 1VQ4Z 3GTMI 4MD9A 2JA8I 1KC82 1M901 2QA4Z 4NB9A 2PK7A 3I561 4NBCA 3HKZA 3D9XA 2R7ZI 3JAMb 3IX0A 3CMEZ 1NUIA 4NBFA 2ZAEB 4A3LI 1X3WA 3HOWI 3H0GI 3IFUA 2I3CA 4E33A 5T67A 1QVFY 3ESWA 3Q87A 4MD7A 1USPB 1P9NA 3RZDI 3CQZI 2V8IA 2G2KA 1ZB9A 3NH8A 4RVFA 1Y1VS 2RPRA 2JA5I 3GCFA 5IT9b 4NBDA 1TWFI 1YI2Z 1TWGI 4A3JI 4BY1I 3CCQZ 3PO3S 2RIQA 3CCRZ 1YITZ 1Q862 1W2BZ 2OTJ1 1RO4A 3S1RI 1VLAA 3CMA1 4A3MI 3CCEZ 4A3FI 3M3YI 2OOYB 1USPA 3S1QI 1VQ5Z 4MONA 3CCV1 2VUMI 3FKII 3CD6Z 2Q4ZA 3HOUI 2P3YA 1WIIA 1VQL1 5A2Qf 4HGYA 2NVTI 4DK1A 1QYPA 1X0TA 4RVHA 2E2JI 3J7A4 4MRIA 1K8A1 1YJN1 4BXXI 3M4OI 4RVDA 3CPWY 1K9M1 2VUGA 2M6NA 3NH4A 4E30A 1VQ7Z 3NFZA 5A2Qb 1YIJ1 4Y52I 2R93I 3CXCZ 1WCMI 3G711 3CCUZ 2KI7B 1VQKZ 1VQMZ 1KC81 4S1TA 2RBLA 3GTGI 1QF8A 3GTQI 1YJWZ 2QREB 2OTLZ 1VQ8Z 1DL6A 1VQN1 1NP6A 3PO2I 2PMZA 2OOXB 1YHQ1 3GTMS 2O4HA 1VQO1 2E2HI 4A3EI 1YUKA 2NVYI 3BG1B 4HH4A 3VMHA 3J81f 4NBGA 1VQP1 3S2HI 2V8JA 1S721 3CC4Z 3CCSZ 3FQMA 1ML8A 4NBBA 2DE6A 3CCJ1 1Z03A 1VQ61 1Q861 4RVGA 3CCLZ 3GTOI 3IF8A 4RV9A 2QEX1 3GTKI 2W03A 4RS4A 4DQYB 4QTTA 1Q812 5FLXf 3CC21 1KQSZ 2JUBA 1Z02A 3VMGA 3J81b 1Q7Y2 2Y0SA 2PM9A 1YJ9Z 3VTNA 4A93I 3G4S1 1Z01A 3LUSA 4Y7NI 2BJOA 3NDIA 1YUAA 3CCQ1 3CCR1 2JA6I 4E2YA 1QVGZ 3U50C 3GKQA 2EGTA 3CCE1 2QRCB 2NVXI 2K3RA 5FLXb 5FLMI 4AYBA 1SFOI 1TWAI 4A3II 2P28A 4CL1A 3G6EZ 4BBRI 2HF1A 2DE7A 4BBSI 2OTJZ 2YADA 3CMAZ 1KRLA 3BG0B 3KIHA 1RO0A 3CCVZ 1ZH1A 1WW9A 5D1OB 2JA7I 2LIYA 4NB8A 4E32A 4A3KI 1VQLZ 3CCM1 1Q821 1I3QI 3RZOI 3S1MI 3MZKB 1KQSY 2F4OA 3CC71 1VQ91 3QWUA 4MXUA 5C3EI 1YJNZ 2JR6A 4NBHA 1RLYA 2RT9A 3I07A 1JJ2Z 2JNYA 1QVFZ 2QRDB 4MD8A 5LL6f 5D1OA 3GTPI 1Q822 3EEDA 1W2BY 1N2FA 1YIJZ 4DGLA 3G71Z 5CM2M 3OW2Z 4QTUA 4BY7I 2IZ3A 3MONA 2KPIA 5D1PA 1VQ41 2YU9I 4A3CI 1Q811 2QA41 3I55Z 1VQNZ 4A3GI 2R92I 3S1NI 2HU9A 1YHQZ 1N8R1 1NJI1 1Q7Y1 1M1K2 1VQOZ 2LFUA 3CME1 3CC41 3CCS1 2WAQA 3P5JB 3HOZI 2E9HA 1K83I 3I56Z 3S15I 4HGZA 3H3VJ 2GU2A 2M48A 4NOZA 1VQPZ 3CCL1 2OZKA 2Q51A 2DE5A 5AN9F 3GTLI 2GTHA 1S72Z 3TDHB 5IT9f 3CXCY 2AKLA 1N8R2 1NJI2 3S2DI 3CCJZ 4EWCA 1JJ2Y 4X6AI 3HOVI 1VQ6Z 3VMIA 1YJ91 1TFIA 1KD12 2K5RA 3MZLB 2QEXZ 3CPWZ 1YI21 1M902 3CC2Z 3EERA 3FQQA 1I50I 4A3BI 2H85A 1YIT1 3I4MI 1LQLA 3NDJA 3OW2Y 2WB1A 4E2ZA 3HOYI 2F4MA 3G4SZ 2JS4A 1VQ51 3HOXI 1Y1VI 2NVQI 2V8KA 3S17I 3G6E1 3CD61 2QR1B 4NBAA 5C4JI 3K7AI 3PO3I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JJ2 Z;  1QVF Z;  1VQP 1;  1Q82 2;  1W2B Y;  1S72 1;  3CC4 Z;  1YIJ Z;  3CCS Z;  1YI2 Z;  3G71 Z;  3CCJ 1;  3OW2 Z;  3CCQ Z;  1VQ7 1;  3CCR Z;  1VQ6 1;  1YIT Z;  1Q86 2;  1Q86 1;  3CCL Z;  1W2B Z;  2OTJ 1;  1VQ4 1;  2QEX 1;  3CMA 1;  3CCE Z;  3CCU 1;  1Q81 2;  3CCM Z;  3CC2 1;  1VQM 1;  2QA4 1;  1Q81 1;  1K73 1;  1VQK 1;  3I55 Z;  1VQ5 Z;  1VQN Z;  1KQS Z;  3CCV 1;  1YHQ Z;  1N8R 1;  1Q7Y 2;  1NJI 1;  1Q7Y 1;  1YJW 1;  1M1K 2;  1M1K 1;  3CD6 Z;  2OTL 1;  1VQ8 1;  1VQL 1;  3CC7 Z;  1VQ9 Z;  1VQO Z;  3CME 1;  1YJ9 Z;  3G4S 1;  3CC4 1;  1QVG Y;  3CCS 1;  3I56 Z;  3CCQ 1;  3CCR 1;  1VQP Z;  3CCL 1;  1K8A 2;  1K8A 1;  1QVG Z;  1YJN 1;  1K73 2;  1S72 Z;  3CCE 1;  3CXC Y;  3CPW Y;  1K9M 2;  3I55 1;  1N8R 2;  1K9M 1;  1NJI 2;  3G6E Z;  3CCJ Z;  1JJ2 Y;  1VQ7 Z;  1VQ6 Z;  1YJ9 1;  2OTJ Z;  1YIJ 1;  1KD1 2;  3CXC Z;  2QEX Z;  3CPW Z;  3CMA Z;  1YI2 1;  1KD1 1;  1VQ4 Z;  3G71 1;  1M90 2;  3CCU Z;  1KC8 2;  3CC2 Z;  1VQM Z;  2QA4 Z;  1KC8 1;  1M90 1;  1VQK Z;  3I56 1;  3CCV Z;  1YIT 1;  3OW2 Y;  1YJW Z;  2OTL Z;  1VQ8 Z;  1VQL Z;  3CME Z;  3CCM 1;  1Q82 1;  3G4S Z;  1VQ5 1;  1VQN 1;  1YHQ 1;  3G6E 1;  3CD6 1;  1KQS Y;  3CC7 1;  1VQ9 1;  1VQO 1;  1QVF Y;  1YJN Z; 
#chains in the Genus database with same CATH topology
 1RNI A;  1L1O C;  1TWH I;  3F3F C;  5T6B A;  1RQF A;  1Y1W I;  4NBE A;  2O53 A;  4E2X A;  2AYD A;  2E2I I;  2IZ4 A;  3J80 f;  4MH4 A;  3T4N B;  2B63 I;  1VQ7 1;  3I4N I;  1JWH C;  3KIF A;  3GTJ I;  1R9T I;  5IP7 I;  2NAP A;  3CCU 1;  3CCM Z;  1VQM 1;  1K73 1;  2VPW A;  2VPX A;  1VQK 1;  1I6H I;  5C4X I;  2VPZ A;  4E31 A;  2GTI A;  2QKD A;  4TNU A;  1YJW 1;  1M1K 1;  2OTL 1;  4XX2 A;  1VQ8 1;  2RHB A;  3CC7 Z;  1VQ9 Z;  2W04 A;  3F3P C;  1ZB8 A;  1QVG Y;  3J80 b;  1X3Z A;  1S7M A;  3D6W A;  1RO2 A;  2J6A A;  2R6M A;  4A3D I;  2VF1 A;  4E2W A;  3JAM f;  3S14 I;  4NH1 C;  1K8A 2;  1PFT A;  2QLV B;  1K73 2;  5T64 A;  2JMO A;  1K9M 2;  3TE5 B;  3NH5 A;  3I55 1;  4NFR A;  3S16 I;  5IP9 I;  1WZN A;  1TWC I;  3VB9 A;  5C44 I;  1KD1 1;  1VQ4 Z;  3GTM I;  4MD9 A;  1SIW A;  2JA8 I;  1KC8 2;  1M90 1;  2QA4 Z;  4NB9 A;  2PK7 A;  3I56 1;  4NBC A;  3HKZ A;  2IV2 X;  3D9X A;  2R7Z I;  3JAM b;  3IX0 A;  3CME Z;  1NUI A;  4NBF A;  2ZAE B;  4A3L I;  1X3W A;  3HOW I;  3H0G I;  3IFU A;  2I3C A;  4E33 A;  5T67 A;  1QVF Y;  2V45 A;  3ESW A;  3Q87 A;  4MD7 A;  1USP B;  1P9N A;  3RZD I;  3CQZ I;  2V8I A;  2G2K A;  1ZB9 A;  3NH8 A;  4RVF A;  1Y1V S;  2RPR A;  3D2L A;  2JA5 I;  3GCF A;  5IT9 b;  4NBD A;  1TWF I;  1YI2 Z;  1TWG I;  4A3J I;  4BY1 I;  3CCQ Z;  3PO3 S;  2RIQ A;  3CCR Z;  1YIT Z;  1Q86 2;  1W2B Z;  2OTJ 1;  1RO4 A;  3S1R I;  1VLA A;  3CMA 1;  4A3M I;  3CCE Z;  4A3F I;  3M3Y I;  2OOY B;  1USP A;  3S1Q I;  1FDO A;  1VQ5 Z;  4MON A;  3CCV 1;  2VUM I;  3FKI I;  3CD6 Z;  2Q4Z A;  3HOU I;  2P3Y A;  1WII A;  1VQL 1;  5A2Q f;  4HGY A;  1FDI A;  2NVT I;  4DK1 A;  1QYP A;  1X0T A;  4RVH A;  2E2J I;  3J7A 4;  4MRI A;  1Q16 A;  1K8A 1;  1YJN 1;  4BXX I;  3M4O I;  2V3V A;  4RVD A;  3CPW Y;  1K9M 1;  2VUG A;  2JIM A;  2M6N A;  3NH4 A;  4E30 A;  1VQ7 Z;  3NFZ A;  5A2Q b;  1YIJ 1;  4Y52 I;  2R93 I;  3CXC Z;  1WCM I;  3G71 1;  3CCU Z;  2KI7 B;  1VQK Z;  1VQM Z;  1KC8 1;  4S1T A;  2RBL A;  3GTG I;  1QF8 A;  3GTQ I;  1YJW Z;  2QRE B;  2OTL Z;  1VQ8 Z;  2JIO A;  1DL6 A;  1VQN 1;  1NP6 A;  3PO2 I;  2PMZ A;  2OOX B;  1YHQ 1;  3GTM S;  2O4H A;  1VQO 1;  2E2H I;  4A3E I;  1YUK A;  2NVY I;  3BG1 B;  4HH4 A;  3VMH A;  3J81 f;  4NBG A;  1VQP 1;  1QXF A;  3S2H I;  1Y8C A;  2V8J A;  1S72 1;  3CC4 Z;  3IR7 A;  3CCS Z;  3FQM A;  1ML8 A;  4NBB A;  2DE6 A;  3CCJ 1;  1Z03 A;  2JIQ A;  1VQ6 1;  1Q86 1;  4RVG A;  3CCL Z;  3GTO I;  3IF8 A;  4RV9 A;  2QEX 1;  3GTK I;  2W03 A;  4RS4 A;  4DQY B;  4QTT A;  1Q81 2;  5FLX f;  3CC2 1;  1KQS Z;  2JUB A;  1Z02 A;  3VMG A;  3J81 b;  1Q7Y 2;  2Y0S A;  2PM9 A;  1YJ9 Z;  3VTN A;  4A93 I;  3G4S 1;  1Z01 A;  3LUS A;  4Y7N I;  2BJO A;  3NDI A;  1YUA A;  3CCQ 1;  3CCR 1;  2JIR A;  2JA6 I;  4E2Y A;  1QVG Z;  3U50 C;  3GKQ A;  2EGT A;  3CCE 1;  2QRC B;  1WJ2 A;  2K3R A;  5FLX b;  2NVX I;  5FLM I;  4AYB A;  1SFO I;  1TWA I;  4A3I I;  2P28 A;  4CL1 A;  3G6E Z;  4BBR I;  2HF1 A;  2DE7 A;  4BBS I;  2OTJ Z;  2YAD A;  3CMA Z;  1KRL A;  3BG0 B;  3KIH A;  1RO0 A;  3CCV Z;  1ZH1 A;  1WW9 A;  5D1O B;  2JA7 I;  2LIY A;  4NB8 A;  2LEX A;  4E32 A;  4A3K I;  1VQL Z;  1AA6 A;  3CCM 1;  1Q82 1;  1I3Q I;  3RZO I;  3S1M I;  3MZK B;  1KQS Y;  2F4O A;  3CC7 1;  1VQ9 1;  3QWU A;  4MXU A;  5C3E I;  1YJN Z;  2JR6 A;  4NBH A;  1RLY A;  2RT9 A;  3I07 A;  1JJ2 Z;  2JNY A;  1QVF Z;  2QRD B;  4MD8 A;  5LL6 f;  5D1O A;  3GTP I;  1Q82 2;  3EED A;  1W2B Y;  1N2F A;  1YIJ Z;  2VPY A;  4DGL A;  3G71 Z;  5CM2 M;  3OW2 Z;  4QTU A;  4BY7 I;  2IZ3 A;  3MON A;  2KPI A;  5D1P A;  1VQ4 1;  2YU9 I;  4A3C I;  1Q81 1;  2E7Z A;  2QA4 1;  3I55 Z;  1VQN Z;  2JIP A;  4A3G I;  2R92 I;  3S1N I;  2HU9 A;  1YHQ Z;  1N8R 1;  1NJI 1;  1Q7Y 1;  1M1K 2;  1VQO Z;  2LFU A;  3CME 1;  3CC4 1;  3CCS 1;  2WAQ A;  3P5J B;  3HOZ I;  2E9H A;  1K83 I;  3I56 Z;  3S15 I;  4HGZ A;  3H3V J;  2GU2 A;  2M48 A;  4NOZ A;  1VQP Z;  3CCL 1;  2OZK A;  2Q51 A;  2DE5 A;  5AN9 F;  3GTL I;  2GTH A;  1S72 Z;  3TDH B;  5IT9 f;  3CXC Y;  2AKL A;  1N8R 2;  1NJI 2;  3S2D I;  3CCJ Z;  4EWC A;  1JJ2 Y;  4X6A I;  3HOV I;  1VQ6 Z;  3VMI A;  1YJ9 1;  1TFI A;  1KD1 2;  2K5R A;  3MZL B;  2QEX Z;  3CPW Z;  1YI2 1;  1M90 2;  3CC2 Z;  3EER A;  3FQQ A;  1I50 I;  4A3B I;  2H85 A;  1YIT 1;  3I4M I;  1LQL A;  3NDJ A;  3OW2 Y;  2WB1 A;  4E2Z A;  3HOY I;  2F4M A;  3G4S Z;  2JS4 A;  1VQ5 1;  3HOX I;  1Y1V I;  2NVQ I;  2V8K A;  3S17 I;  3G6E 1;  3CD6 1;  2QR1 B;  4NBA A;  5C4J I;  3K7A I;  3PO3 I; 
#chains in the Genus database with same CATH homology
 1RNI A;  1L1O C;  1TWH I;  3F3F C;  5T6B A;  1RQF A;  1Y1W I;  4NBE A;  2O53 A;  4E2X A;  2E2I I;  2IZ4 A;  3J80 f;  4MH4 A;  3T4N B;  2B63 I;  1VQ7 1;  3I4N I;  1JWH C;  3KIF A;  3GTJ I;  1R9T I;  5IP7 I;  3CCU 1;  3CCM Z;  1VQM 1;  1K73 1;  1VQK 1;  1I6H I;  5C4X I;  4E31 A;  2GTI A;  2QKD A;  4TNU A;  1YJW 1;  1M1K 1;  2OTL 1;  4XX2 A;  1VQ8 1;  2RHB A;  3CC7 Z;  1VQ9 Z;  2W04 A;  3F3P C;  1ZB8 A;  1QVG Y;  3J80 b;  1X3Z A;  1S7M A;  3D6W A;  1RO2 A;  2J6A A;  2R6M A;  4A3D I;  2VF1 A;  4E2W A;  3JAM f;  3S14 I;  4NH1 C;  1K8A 2;  1PFT A;  2QLV B;  1K73 2;  5T64 A;  2JMO A;  1K9M 2;  3TE5 B;  3NH5 A;  3I55 1;  4NFR A;  3S16 I;  5IP9 I;  1TWC I;  3VB9 A;  5C44 I;  1KD1 1;  1VQ4 Z;  3GTM I;  4MD9 A;  2JA8 I;  1KC8 2;  1M90 1;  2QA4 Z;  4NB9 A;  2PK7 A;  3I56 1;  4NBC A;  3HKZ A;  3D9X A;  2R7Z I;  3JAM b;  3IX0 A;  3CME Z;  1NUI A;  4NBF A;  2ZAE B;  4A3L I;  1X3W A;  3HOW I;  3H0G I;  3IFU A;  2I3C A;  4E33 A;  5T67 A;  1QVF Y;  3ESW A;  3Q87 A;  4MD7 A;  1USP B;  1P9N A;  3RZD I;  3CQZ I;  2V8I A;  2G2K A;  1ZB9 A;  3NH8 A;  4RVF A;  1Y1V S;  2RPR A;  2JA5 I;  3GCF A;  5IT9 b;  4NBD A;  1TWF I;  1YI2 Z;  1TWG I;  4A3J I;  4BY1 I;  3CCQ Z;  3PO3 S;  2RIQ A;  3CCR Z;  1YIT Z;  1Q86 2;  1W2B Z;  2OTJ 1;  1RO4 A;  3S1R I;  1VLA A;  3CMA 1;  4A3M I;  3CCE Z;  4A3F I;  3M3Y I;  2OOY B;  1USP A;  3S1Q I;  1VQ5 Z;  4MON A;  3CCV 1;  2VUM I;  3FKI I;  3CD6 Z;  2Q4Z A;  3HOU I;  2P3Y A;  1WII A;  1VQL 1;  5A2Q f;  4HGY A;  2NVT I;  4DK1 A;  1QYP A;  1X0T A;  4RVH A;  2E2J I;  3J7A 4;  4MRI A;  1K8A 1;  1YJN 1;  4BXX I;  3M4O I;  4RVD A;  3CPW Y;  1K9M 1;  2VUG A;  2M6N A;  3NH4 A;  4E30 A;  1VQ7 Z;  3NFZ A;  5A2Q b;  1YIJ 1;  4Y52 I;  2R93 I;  3CXC Z;  1WCM I;  3G71 1;  3CCU Z;  2KI7 B;  1VQK Z;  1VQM Z;  1KC8 1;  4S1T A;  2RBL A;  3GTG I;  1QF8 A;  3GTQ I;  1YJW Z;  2QRE B;  2OTL Z;  1VQ8 Z;  1DL6 A;  1VQN 1;  1NP6 A;  3PO2 I;  2PMZ A;  2OOX B;  1YHQ 1;  3GTM S;  2O4H A;  1VQO 1;  2E2H I;  4A3E I;  1YUK A;  2NVY I;  3BG1 B;  4HH4 A;  3VMH A;  3J81 f;  4NBG A;  1VQP 1;  3S2H I;  2V8J A;  1S72 1;  3CC4 Z;  3CCS Z;  3FQM A;  1ML8 A;  4NBB A;  2DE6 A;  3CCJ 1;  1Z03 A;  1VQ6 1;  1Q86 1;  4RVG A;  3CCL Z;  3GTO I;  3IF8 A;  4RV9 A;  2QEX 1;  3GTK I;  2W03 A;  4RS4 A;  4DQY B;  4QTT A;  1Q81 2;  5FLX f;  3CC2 1;  1KQS Z;  2JUB A;  1Z02 A;  3VMG A;  3J81 b;  1Q7Y 2;  2Y0S A;  2PM9 A;  1YJ9 Z;  3VTN A;  4A93 I;  3G4S 1;  1Z01 A;  3LUS A;  4Y7N I;  2BJO A;  3NDI A;  1YUA A;  3CCQ 1;  3CCR 1;  2JA6 I;  4E2Y A;  1QVG Z;  3U50 C;  3GKQ A;  2EGT A;  3CCE 1;  2QRC B;  2NVX I;  2K3R A;  5FLX b;  5FLM I;  4AYB A;  1SFO I;  1TWA I;  4A3I I;  2P28 A;  4CL1 A;  3G6E Z;  4BBR I;  2HF1 A;  2DE7 A;  4BBS I;  2OTJ Z;  2YAD A;  3CMA Z;  1KRL A;  3BG0 B;  3KIH A;  1RO0 A;  3CCV Z;  1ZH1 A;  1WW9 A;  5D1O B;  2JA7 I;  2LIY A;  4NB8 A;  4E32 A;  4A3K I;  1VQL Z;  3CCM 1;  1Q82 1;  1I3Q I;  3RZO I;  3S1M I;  3MZK B;  1KQS Y;  2F4O A;  3CC7 1;  1VQ9 1;  3QWU A;  4MXU A;  5C3E I;  1YJN Z;  2JR6 A;  4NBH A;  1RLY A;  2RT9 A;  3I07 A;  1JJ2 Z;  2JNY A;  1QVF Z;  2QRD B;  4MD8 A;  5LL6 f;  5D1O A;  3GTP I;  1Q82 2;  3EED A;  1W2B Y;  1N2F A;  1YIJ Z;  4DGL A;  3G71 Z;  5CM2 M;  3OW2 Z;  4QTU A;  4BY7 I;  2IZ3 A;  3MON A;  2KPI A;  5D1P A;  1VQ4 1;  2YU9 I;  4A3C I;  1Q81 1;  2QA4 1;  3I55 Z;  1VQN Z;  4A3G I;  2R92 I;  3S1N I;  2HU9 A;  1YHQ Z;  1N8R 1;  1NJI 1;  1Q7Y 1;  1M1K 2;  1VQO Z;  2LFU A;  3CME 1;  3CC4 1;  3CCS 1;  2WAQ A;  3P5J B;  3HOZ I;  2E9H A;  1K83 I;  3I56 Z;  3S15 I;  4HGZ A;  3H3V J;  2GU2 A;  2M48 A;  4NOZ A;  1VQP Z;  3CCL 1;  2OZK A;  2Q51 A;  2DE5 A;  5AN9 F;  3GTL I;  2GTH A;  1S72 Z;  3TDH B;  5IT9 f;  3CXC Y;  2AKL A;  1N8R 2;  1NJI 2;  3S2D I;  3CCJ Z;  4EWC A;  1JJ2 Y;  4X6A I;  3HOV I;  1VQ6 Z;  3VMI A;  1YJ9 1;  1TFI A;  1KD1 2;  2K5R A;  3MZL B;  2QEX Z;  3CPW Z;  1YI2 1;  1M90 2;  3CC2 Z;  3EER A;  3FQQ A;  1I50 I;  4A3B I;  2H85 A;  1YIT 1;  3I4M I;  1LQL A;  3NDJ A;  3OW2 Y;  2WB1 A;  4E2Z A;  3HOY I;  2F4M A;  3G4S Z;  2JS4 A;  1VQ5 1;  3HOX I;  1Y1V I;  2NVQ I;  2V8K A;  3S17 I;  3G6E 1;  3CD6 1;  2QR1 B;  4NBA A;  5C4J I;  3K7A I;  3PO3 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...