1VQL1

The structure of the transition state analogue "dcsn" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vql100
3G6E1 1S721 1VQO1 3CCS1 1S72Z 3CCSZ 2OTJ1 2OTJZ 3CC71 1JJ2Z 3CC7Z 1M1K2 1KC82 1VQ81 3CPWY 1Q822 1VQ51 1QVFZ 1VQ5Z 1VQM1 3G4S1 1VQMZ 3G4SZ 1VQP1 1VQK1 1M1K1 1VQ91 1QVGY 1YIJ1 1Q821 1YJWZ 1YITZ 3CCJ1 3CCJZ 1VQ6Z 1Q812 1YJ9Z 1K9M2 1NJI2 3CCL1 3CPWZ 3CCLZ 3CCEZ 1K731 1Q811 1K9M1 1VQLZ 1NJI1 1QVGZ 3I55Z 1YJNZ 1N8R2 1VQ41 1VQ4Z 1KC81 3CMA1 2OTL1 3CMAZ 2OTLZ 3CCR1 1YJW1 1VQ7Z 1YI2Z 1K8A2 3CCRZ 1YIT1 1VQ61 1Q7Y2 1VQN1 1VQNZ 1YJ91 3CME1 3CMEZ 1K8A1 3CCU1 1KD12 3CCUZ 3CC21 2QEXZ 3CCM1 3CCE1 1KQSY 3CC2Z 1YHQZ 3CCMZ 1Q7Y1 1W2BY 1Q862 1VQL1 3I551 1YJN1 3CC4Z 1Q861 1YI21 1VQ71 1KQSZ 2QA41 1N8R1 2QA4Z 1M902 3CCV1 3CCVZ 1W2BZ 3CXCY 3CD61 3G6EZ 1VQOZ 3CD6Z 3OW2Y 2QEX1 1YHQ1 1M901 1VQ8Z 1KD11 3I561 1VQPZ 3I56Z 1JJ2Y 3CC41 1VQKZ 3G711 3G71Z 1VQ9Z 1YIJZ 1QVFY 3CCQ1 3CXCZ 3CCQZ 3OW2Z 1K732
chains in the Genus database with same CATH superfamily
5D1OB 2DE7A 4RS4A 4E2WA 1S72Z 3CCSZ 4HGZA 4CL1A 2OTJZ 1KC82 2B63I 4E2XA 1YUKA 3GKQA 4BBSI 1VQMZ 3LUSA 2JIOA 1SFOI 4XX2A 1YIJ1 3NDJA 2M6NA 1WIIA 1YJWZ 1KRLA 5T6BA 1VQ6Z 5D1PA 2LIYA 2V8JA 3I07A 1YJ9Z 1K9M2 3CCLZ 1R9TI 1JWHC 3S17I 3GCFA 1Q811 3HOUI 2DE6A 1QVGZ 1WZNA 2E7ZA 1VQ4Z 5D1OA 2JR6A 2E2HI 4QTTA 3CMAZ 4E32A 1YJW1 1VQ7Z 3CCRZ 2J6AA 2KPIA 1VQ61 1Q7Y2 3IX0A 1VQN1 4MRIA 1YJ91 3MONA 1Q16A 3GTLI 3CCU1 2DE5A 4A3EI 1KQSY 5A2Qf 2RHBA 2H85A 3CCMZ 2QLVB 2RIQA 2R92I 4A3GI 4MH4A 1ZB9A 1QYPA 1Q861 1FDIA 4BY7I 5FLXf 4NBFA 1VQ71 1I50I 4S1TA 4QTUA 3KIHA 3JAMf 1ZB8A 1N8R1 2JA5I 2QA4Z 4RVGA 3KIFA 1FDOA 2RBLA 3VB9A 3OW2Y 2AKLA 2E2II 1VQ8Z 2P3YA 2VUGA 2O53A 5T67A 1VQKZ 4A3BI 3G711 1S7MA 1VQ9Z 3BG1B 2F4MA 3F3PC 3TDHB 4A3FI 3GTQI 3CQZI 1Y1WI 2V8IA 2WAQA 1JJ2Z 1M1K2 1AA6A 4NBGA 1VQ81 3NH5A 1VQK1 3HOWI 5IP9I 2IZ4A 1VQ91 1QVGY 1Q821 2NVYI 5C44I 4Y52I 1NUIA 3HOXI 1RO2A 3CPWZ 3D2LA 3CCEZ 1SIWA 1VQLZ 1NJI1 2VPZA 2NVQI 1N8R2 3S2DI 3J81b 4E30A 3H0GI 2OTL1 2VUMI 2NAPA 1K8A2 3VMHA 1WW9A 1VQNZ 4NBDA 2I3CA 3S2HI 2RT9A 3CCUZ 3CC21 4E31A 1USPA 4NH1C 3CCE1 1YHQZ 3S14I 1VQL1 2JMOA 2WB1A 2BJOA 2QRDB 2GTHA 2YU9I 2RPRA 1M902 3CCV1 4TNUA 1W2BZ 2JS4A 4MD9A 1I6HI 3NH8A 4A93I 1WJ2A 4RVFA 1YHQ1 1Y8CA 1VLAA 1KD11 3Q87A 3GTPI 2K3RA 1TWGI 1JJ2Y 1Z02A 5FLMI 3G71Z 3CCQ1 4NOZA 4MD8A 4E2YA 2V45A 3PO2I 3CC71 3FKII 2V3VA 5A2Qb 1X3ZA 3CPWY 2O4HA 3K7AI 1VQ51 1QVFZ 3G4S1 3S1RI 4RVDA 4Y7NI 3ESWA 2HF1A 3F3FC 3CCJ1 4NB8A 5T64A 5FLXb 5CM2M 2R93I 3J80b 4NBBA 3GTGI 1Q812 4DGLA 3PO3S 1X3WA 1Z01A 3GTMS 3S1NI 1K731 2OOXB 1K9M1 3I55Z 1YJNZ 1Y1VI 3EEDA 1WCMI 4AYBA 5LL6f 2E9HA 2VPWA 3EERA 3I4MI 2OTLZ 3IR7A 2GU2A 1YI2Z 3FQQA 1Y1VS 3T4NB 1X0TA 1I3QI 3CME1 4HH4A 1TWCI 1KD12 2QEXZ 3CC2Z 1Q7Y1 2VF1A 3M3YI 1W2BY 1Q862 1P9NA 3HKZA 3I551 3J81f 2YADA 1YJN1 3S1QI 1ZH1A 2G2KA 2EGTA 2JA8I 5C4JI 1YI21 2Q4ZA 1TWHI 1RQFA 3IFUA 3MZKB 4NBCA 2E2JI 4HGYA 3HOZI 5IT9b 3FQMA 3D9XA 3NH4A 3CCVZ 3S16I 3CD61 3G6EZ 4A3CI 1VQOZ 1N2FA 4MD7A 3M4OI 2QEX1 1YUAA 5C4XI 1TWAI 2R6MA 2AYDA 1RO4A 4EWCA 3I561 1VQPZ 1PFTA 2W04A 3VMIA 5AN9F 4A3LI 4RV9A 1RNIA 1QVFY 2V8KA 2JIMA 3GTOI 3CXCZ 3CCQZ 3GTKI 3NDIA 3NFZA 1K732 4NBAA 1NP6A 3RZOI 1RO0A 3G6E1 1S721 1VQO1 3CCS1 1DL6A 2OTJ1 4MXUA 3RZDI 3CC7Z 4A3JI 4BXXI 1TWFI 1Q822 2IZ3A 1ML8A 1VQ5Z 1VQM1 2LEXA 1RLYA 2NVTI 3G4SZ 1VQP1 3TE5B 3IF8A 2IV2X 1M1K1 2R7ZI 2JA7I 2JIRA 2Q51A 3D6WA 4MONA 1YITZ 4BY1I 3CCJZ 4X6AI 4E33A 2F4OA 3S1MI 1NJI2 3CCL1 1QXFA 2PM9A 2JIPA 2NVXI 4NBHA 4NBEA 3VTNA 2ZAEB 3P5JB 3QWUA 2VPYA 2PMZA 2Y0SA 3I4NI 1VQ41 2KI7B 5C3EI 1TFIA 2PK7A 2GTIA 1KC81 3PO3I 3CMA1 3H3VJ 3J80f 3CCR1 1YIT1 2OZKA 3GTMI 2JUBA 3HOYI 3JAMb 1LQLA 1K83I 2QKDA 3CMEZ 1K8A1 2JA6I 3CCM1 3HOVI 2M48A 4BBRI 1L1OC 3VMGA 2P28A 3S15I 2QREB 3CC4Z 3GTJI 4E2ZA 1Z03A 3U50C 2HU9A 3BG0B 1KQSZ 2QA41 2K5RA 2LFUA 4A3DI 4NFRA 2JIQA 3J7A4 3CXCY 2QR1B 2QRCB 4DK1A 3CD6Z 4A3KI 1M901 4RVHA 1USPB 4A3MI 3I56Z 4A3II 3CC41 2OOYB 2W03A 2VPXA 1YIJZ 4NB9A 3MZLB 4DQYB 2JNYA 5IT9f 3OW2Z 5IP7I 1QF8A
chains in the Genus database with same CATH topology
5D1OB 2DE7A 4RS4A 4E2WA 1S72Z 3CCSZ 4HGZA 4CL1A 2OTJZ 1KC82 2B63I 4E2XA 1YUKA 3GKQA 4BBSI 1VQMZ 3LUSA 1SFOI 4XX2A 1YIJ1 3NDJA 2M6NA 1WIIA 1YJWZ 1KRLA 5T6BA 1VQ6Z 5D1PA 2LIYA 2V8JA 3I07A 1YJ9Z 1K9M2 3CCLZ 1R9TI 1JWHC 3S17I 3GCFA 1Q811 3HOUI 2DE6A 1QVGZ 1VQ4Z 5D1OA 2JR6A 2E2HI 4QTTA 3CMAZ 4E32A 1YJW1 1VQ7Z 3CCRZ 2J6AA 2KPIA 1VQ61 1Q7Y2 3IX0A 1VQN1 4MRIA 1YJ91 3MONA 3GTLI 3CCU1 2DE5A 4A3EI 1KQSY 5A2Qf 2RHBA 2H85A 3CCMZ 2QLVB 2RIQA 2R92I 4A3GI 4MH4A 1ZB9A 1QYPA 1Q861 4BY7I 5FLXf 4NBFA 1VQ71 1I50I 4S1TA 4QTUA 3KIHA 3JAMf 1ZB8A 1N8R1 2JA5I 2QA4Z 4RVGA 3KIFA 2RBLA 3VB9A 3OW2Y 2AKLA 2E2II 1VQ8Z 2P3YA 2VUGA 2O53A 5T67A 1VQKZ 4A3BI 3G711 1S7MA 1VQ9Z 3BG1B 2F4MA 3F3PC 3TDHB 4A3FI 3GTQI 3CQZI 1Y1WI 2V8IA 2WAQA 1JJ2Z 1M1K2 4NBGA 1VQ81 3NH5A 1VQK1 3HOWI 5IP9I 2IZ4A 1VQ91 1QVGY 1Q821 2NVYI 5C44I 4Y52I 1NUIA 3HOXI 1RO2A 3CPWZ 3CCEZ 1VQLZ 1NJI1 2NVQI 1N8R2 3S2DI 3J81b 4E30A 3H0GI 2OTL1 2VUMI 1K8A2 3VMHA 1WW9A 1VQNZ 4NBDA 2I3CA 3S2HI 2RT9A 3CCUZ 3CC21 4E31A 1USPA 4NH1C 3CCE1 1YHQZ 3S14I 1VQL1 2JMOA 2WB1A 2BJOA 2QRDB 2GTHA 2YU9I 2RPRA 1M902 3CCV1 4TNUA 1W2BZ 2JS4A 4MD9A 1I6HI 3NH8A 4A93I 4RVFA 1YHQ1 1VLAA 1KD11 3Q87A 3GTPI 2K3RA 1TWGI 1JJ2Y 1Z02A 5FLMI 3G71Z 3CCQ1 4NOZA 4MD8A 4E2YA 3PO2I 3CC71 3FKII 5A2Qb 1X3ZA 3CPWY 2O4HA 3K7AI 1VQ51 1QVFZ 3G4S1 3S1RI 4RVDA 4Y7NI 3ESWA 2HF1A 3F3FC 3CCJ1 4NB8A 5T64A 5FLXb 5CM2M 2R93I 3J80b 4NBBA 3GTGI 1Q812 4DGLA 3PO3S 1X3WA 1Z01A 3GTMS 3S1NI 1K731 2OOXB 1K9M1 3I55Z 1YJNZ 1Y1VI 3EEDA 1WCMI 4AYBA 5LL6f 2E9HA 3EERA 3I4MI 2OTLZ 2GU2A 1YI2Z 3FQQA 1Y1VS 3T4NB 1X0TA 1I3QI 3CME1 4HH4A 1TWCI 1KD12 2QEXZ 3CC2Z 1Q7Y1 2VF1A 3M3YI 1W2BY 1Q862 1P9NA 3HKZA 3I551 3J81f 2YADA 1YJN1 3S1QI 1ZH1A 2G2KA 2EGTA 2JA8I 5C4JI 1YI21 2Q4ZA 1TWHI 1RQFA 3IFUA 3MZKB 4NBCA 2E2JI 4HGYA 3HOZI 5IT9b 3FQMA 3D9XA 3NH4A 3CCVZ 3S16I 3CD61 3G6EZ 4A3CI 1VQOZ 1N2FA 4MD7A 3M4OI 2QEX1 1YUAA 5C4XI 1TWAI 2R6MA 1RO4A 4EWCA 3I561 1VQPZ 1PFTA 2W04A 3VMIA 5AN9F 4A3LI 4RV9A 1RNIA 1QVFY 2V8KA 3GTOI 3CXCZ 3CCQZ 3GTKI 3NDIA 3NFZA 1K732 4NBAA 1NP6A 3RZOI 1RO0A 3G6E1 1S721 1VQO1 3CCS1 1DL6A 2OTJ1 4MXUA 3RZDI 3CC7Z 4A3JI 4BXXI 1TWFI 1Q822 2IZ3A 1ML8A 1VQ5Z 1VQM1 1RLYA 2NVTI 3G4SZ 1VQP1 3TE5B 3IF8A 1M1K1 2R7ZI 2JA7I 2Q51A 3D6WA 4MONA 1YITZ 4BY1I 3CCJZ 4X6AI 4E33A 2F4OA 3S1MI 1NJI2 3CCL1 2PM9A 2NVXI 4NBHA 4NBEA 3VTNA 2ZAEB 3P5JB 3QWUA 2PMZA 2Y0SA 3I4NI 1VQ41 2KI7B 5C3EI 1TFIA 2PK7A 2GTIA 1KC81 3PO3I 3CMA1 3H3VJ 3J80f 3CCR1 1YIT1 2OZKA 3GTMI 2JUBA 3HOYI 3JAMb 1LQLA 1K83I 2QKDA 3CMEZ 1K8A1 2JA6I 3CCM1 3HOVI 2M48A 4BBRI 1L1OC 3VMGA 2P28A 3S15I 2QREB 3CC4Z 3GTJI 4E2ZA 1Z03A 3U50C 2HU9A 3BG0B 1KQSZ 2QA41 2K5RA 2LFUA 4A3DI 4NFRA 3J7A4 3CXCY 2QR1B 2QRCB 4DK1A 3CD6Z 4A3KI 1M901 4RVHA 1USPB 4A3MI 3I56Z 4A3II 3CC41 2OOYB 2W03A 1YIJZ 4NB9A 3MZLB 4DQYB 2JNYA 5IT9f 3OW2Z 5IP7I 1QF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6E 1;  1S72 1;  1VQO 1;  3CCS 1;  1S72 Z;  3CCS Z;  2OTJ 1;  2OTJ Z;  3CC7 1;  1JJ2 Z;  3CC7 Z;  1M1K 2;  1KC8 2;  1VQ8 1;  3CPW Y;  1Q82 2;  1VQ5 1;  1QVF Z;  1VQ5 Z;  1VQM 1;  3G4S 1;  1VQM Z;  3G4S Z;  1VQP 1;  1VQK 1;  1M1K 1;  1VQ9 1;  1QVG Y;  1YIJ 1;  1Q82 1;  1YJW Z;  1YIT Z;  3CCJ 1;  3CCJ Z;  1VQ6 Z;  1Q81 2;  1YJ9 Z;  1K9M 2;  1NJI 2;  3CCL 1;  3CPW Z;  3CCL Z;  3CCE Z;  1K73 1;  1Q81 1;  1K9M 1;  1VQL Z;  1NJI 1;  1QVG Z;  3I55 Z;  1YJN Z;  1N8R 2;  1VQ4 1;  1VQ4 Z;  1KC8 1;  3CMA 1;  2OTL 1;  3CMA Z;  2OTL Z;  3CCR 1;  1YJW 1;  1VQ7 Z;  1YI2 Z;  1K8A 2;  3CCR Z;  1YIT 1;  1VQ6 1;  1Q7Y 2;  1VQN 1;  1VQN Z;  1YJ9 1;  3CME 1;  3CME Z;  1K8A 1;  3CCU 1;  1KD1 2;  3CCU Z;  3CC2 1;  2QEX Z;  3CCM 1;  3CCE 1;  1KQS Y;  3CC2 Z;  1YHQ Z;  3CCM Z;  1Q7Y 1;  1W2B Y;  1Q86 2;  1VQL 1;  3I55 1;  1YJN 1;  3CC4 Z;  1Q86 1;  1YI2 1;  1VQ7 1;  1KQS Z;  2QA4 1;  1N8R 1;  2QA4 Z;  1M90 2;  3CCV 1;  3CCV Z;  1W2B Z;  3CXC Y;  3CD6 1;  3G6E Z;  1VQO Z;  3CD6 Z;  3OW2 Y;  2QEX 1;  1YHQ 1;  1M90 1;  1VQ8 Z;  1KD1 1;  3I56 1;  1VQP Z;  3I56 Z;  1JJ2 Y;  3CC4 1;  1VQK Z;  3G71 1;  3G71 Z;  1VQ9 Z;  1YIJ Z;  1QVF Y;  3CCQ 1;  3CXC Z;  3CCQ Z;  3OW2 Z;  1K73 2; 
#chains in the Genus database with same CATH topology
 5D1O B;  2DE7 A;  4RS4 A;  4E2W A;  1S72 Z;  3CCS Z;  4HGZ A;  4CL1 A;  2OTJ Z;  1KC8 2;  2B63 I;  4E2X A;  1YUK A;  3GKQ A;  4BBS I;  1VQM Z;  3LUS A;  2JIO A;  1SFO I;  4XX2 A;  1YIJ 1;  3NDJ A;  2M6N A;  1WII A;  1YJW Z;  1KRL A;  5T6B A;  1VQ6 Z;  5D1P A;  2LIY A;  2V8J A;  3I07 A;  1YJ9 Z;  1K9M 2;  3CCL Z;  1R9T I;  1JWH C;  3S17 I;  3GCF A;  1Q81 1;  3HOU I;  2DE6 A;  1QVG Z;  1WZN A;  2E7Z A;  1VQ4 Z;  5D1O A;  2JR6 A;  2E2H I;  4QTT A;  3CMA Z;  4E32 A;  1YJW 1;  1VQ7 Z;  3CCR Z;  2J6A A;  2KPI A;  1VQ6 1;  1Q7Y 2;  3IX0 A;  1VQN 1;  4MRI A;  1YJ9 1;  3MON A;  1Q16 A;  3GTL I;  3CCU 1;  2DE5 A;  4A3E I;  1KQS Y;  5A2Q f;  2RHB A;  2H85 A;  3CCM Z;  2QLV B;  2RIQ A;  2R92 I;  4A3G I;  4MH4 A;  1ZB9 A;  1QYP A;  1Q86 1;  1FDI A;  4BY7 I;  5FLX f;  4NBF A;  1VQ7 1;  1I50 I;  4S1T A;  4QTU A;  3KIH A;  3JAM f;  1ZB8 A;  1N8R 1;  2JA5 I;  2QA4 Z;  4RVG A;  3KIF A;  1FDO A;  2RBL A;  3VB9 A;  3OW2 Y;  2AKL A;  2E2I I;  1VQ8 Z;  2P3Y A;  2VUG A;  2O53 A;  5T67 A;  1VQK Z;  4A3B I;  3G71 1;  1S7M A;  1VQ9 Z;  3BG1 B;  2F4M A;  3F3P C;  3TDH B;  4A3F I;  3GTQ I;  3CQZ I;  1Y1W I;  2V8I A;  2WAQ A;  1JJ2 Z;  1M1K 2;  1AA6 A;  4NBG A;  1VQ8 1;  3NH5 A;  1VQK 1;  3HOW I;  5IP9 I;  2IZ4 A;  1VQ9 1;  1QVG Y;  1Q82 1;  2NVY I;  5C44 I;  4Y52 I;  1NUI A;  3HOX I;  1RO2 A;  3CPW Z;  3D2L A;  3CCE Z;  1SIW A;  1VQL Z;  1NJI 1;  2VPZ A;  2NVQ I;  1N8R 2;  3S2D I;  3J81 b;  4E30 A;  3H0G I;  2OTL 1;  2VUM I;  2NAP A;  1K8A 2;  3VMH A;  1WW9 A;  1VQN Z;  4NBD A;  2I3C A;  3S2H I;  2RT9 A;  3CCU Z;  3CC2 1;  4E31 A;  1USP A;  4NH1 C;  3CCE 1;  1YHQ Z;  3S14 I;  1VQL 1;  2JMO A;  2WB1 A;  2BJO A;  2QRD B;  2GTH A;  2YU9 I;  2RPR A;  1M90 2;  3CCV 1;  4TNU A;  1W2B Z;  2JS4 A;  4MD9 A;  1I6H I;  3NH8 A;  4A93 I;  1WJ2 A;  4RVF A;  1YHQ 1;  1Y8C A;  1VLA A;  1KD1 1;  3Q87 A;  3GTP I;  2K3R A;  1TWG I;  1JJ2 Y;  1Z02 A;  5FLM I;  3G71 Z;  3CCQ 1;  4NOZ A;  4MD8 A;  4E2Y A;  2V45 A;  3PO2 I;  3CC7 1;  3FKI I;  2V3V A;  5A2Q b;  1X3Z A;  3CPW Y;  2O4H A;  3K7A I;  1VQ5 1;  1QVF Z;  3G4S 1;  3S1R I;  4RVD A;  4Y7N I;  3ESW A;  2HF1 A;  3F3F C;  3CCJ 1;  4NB8 A;  5T64 A;  5FLX b;  5CM2 M;  2R93 I;  3J80 b;  4NBB A;  3GTG I;  1Q81 2;  4DGL A;  3PO3 S;  1X3W A;  1Z01 A;  3GTM S;  3S1N I;  1K73 1;  2OOX B;  1K9M 1;  3I55 Z;  1YJN Z;  1Y1V I;  3EED A;  1WCM I;  4AYB A;  5LL6 f;  2E9H A;  2VPW A;  3EER A;  3I4M I;  2OTL Z;  3IR7 A;  2GU2 A;  1YI2 Z;  3FQQ A;  1Y1V S;  3T4N B;  1X0T A;  1I3Q I;  3CME 1;  4HH4 A;  1TWC I;  1KD1 2;  2QEX Z;  3CC2 Z;  1Q7Y 1;  2VF1 A;  3M3Y I;  1W2B Y;  1Q86 2;  1P9N A;  3HKZ A;  3I55 1;  3J81 f;  2YAD A;  1YJN 1;  3S1Q I;  1ZH1 A;  2G2K A;  2EGT A;  2JA8 I;  5C4J I;  1YI2 1;  2Q4Z A;  1TWH I;  1RQF A;  3IFU A;  3MZK B;  4NBC A;  2E2J I;  4HGY A;  3HOZ I;  5IT9 b;  3FQM A;  3D9X A;  3NH4 A;  3CCV Z;  3S16 I;  3CD6 1;  3G6E Z;  4A3C I;  1VQO Z;  1N2F A;  4MD7 A;  3M4O I;  2QEX 1;  1YUA A;  5C4X I;  1TWA I;  2R6M A;  2AYD A;  1RO4 A;  4EWC A;  3I56 1;  1VQP Z;  1PFT A;  2W04 A;  3VMI A;  5AN9 F;  4A3L I;  4RV9 A;  1RNI A;  1QVF Y;  2V8K A;  2JIM A;  3GTO I;  3CXC Z;  3CCQ Z;  3GTK I;  3NDI A;  3NFZ A;  1K73 2;  4NBA A;  1NP6 A;  3RZO I;  1RO0 A;  3G6E 1;  1S72 1;  1VQO 1;  3CCS 1;  1DL6 A;  2OTJ 1;  4MXU A;  3RZD I;  3CC7 Z;  4A3J I;  4BXX I;  1TWF I;  1Q82 2;  2IZ3 A;  1ML8 A;  1VQ5 Z;  1VQM 1;  2LEX A;  1RLY A;  2NVT I;  3G4S Z;  1VQP 1;  3TE5 B;  3IF8 A;  2IV2 X;  1M1K 1;  2R7Z I;  2JA7 I;  2JIR A;  2Q51 A;  3D6W A;  4MON A;  1YIT Z;  4BY1 I;  3CCJ Z;  4X6A I;  4E33 A;  2F4O A;  3S1M I;  1NJI 2;  3CCL 1;  1QXF A;  2PM9 A;  2JIP A;  2NVX I;  4NBH A;  4NBE A;  3VTN A;  2ZAE B;  3P5J B;  3QWU A;  2VPY A;  2PMZ A;  2Y0S A;  3I4N I;  1VQ4 1;  2KI7 B;  5C3E I;  1TFI A;  2PK7 A;  2GTI A;  1KC8 1;  3PO3 I;  3CMA 1;  3H3V J;  3J80 f;  3CCR 1;  1YIT 1;  2OZK A;  3GTM I;  2JUB A;  3HOY I;  3JAM b;  1LQL A;  1K83 I;  2QKD A;  3CME Z;  1K8A 1;  2JA6 I;  3CCM 1;  3HOV I;  2M48 A;  4BBR I;  1L1O C;  3VMG A;  2P28 A;  3S15 I;  2QRE B;  3CC4 Z;  3GTJ I;  4E2Z A;  1Z03 A;  3U50 C;  2HU9 A;  3BG0 B;  1KQS Z;  2QA4 1;  2K5R A;  2LFU A;  4A3D I;  4NFR A;  2JIQ A;  3J7A 4;  3CXC Y;  2QR1 B;  2QRC B;  4DK1 A;  3CD6 Z;  4A3K I;  1M90 1;  4RVH A;  1USP B;  4A3M I;  3I56 Z;  4A3I I;  3CC4 1;  2OOY B;  2W03 A;  2VPX A;  1YIJ Z;  4NB9 A;  3MZL B;  4DQY B;  2JNY A;  5IT9 f;  3OW2 Z;  5IP7 I;  1QF8 A; 
#chains in the Genus database with same CATH homology
 5D1O B;  2DE7 A;  4RS4 A;  4E2W A;  1S72 Z;  3CCS Z;  4HGZ A;  4CL1 A;  2OTJ Z;  1KC8 2;  2B63 I;  4E2X A;  1YUK A;  3GKQ A;  4BBS I;  1VQM Z;  3LUS A;  1SFO I;  4XX2 A;  1YIJ 1;  3NDJ A;  2M6N A;  1WII A;  1YJW Z;  1KRL A;  5T6B A;  1VQ6 Z;  5D1P A;  2LIY A;  2V8J A;  3I07 A;  1YJ9 Z;  1K9M 2;  3CCL Z;  1R9T I;  1JWH C;  3S17 I;  3GCF A;  1Q81 1;  3HOU I;  2DE6 A;  1QVG Z;  1VQ4 Z;  5D1O A;  2JR6 A;  2E2H I;  4QTT A;  3CMA Z;  4E32 A;  1YJW 1;  1VQ7 Z;  3CCR Z;  2J6A A;  2KPI A;  1VQ6 1;  1Q7Y 2;  3IX0 A;  1VQN 1;  4MRI A;  1YJ9 1;  3MON A;  3GTL I;  3CCU 1;  2DE5 A;  4A3E I;  1KQS Y;  5A2Q f;  2RHB A;  2H85 A;  3CCM Z;  2QLV B;  2RIQ A;  2R92 I;  4A3G I;  4MH4 A;  1ZB9 A;  1QYP A;  1Q86 1;  4BY7 I;  5FLX f;  4NBF A;  1VQ7 1;  1I50 I;  4S1T A;  4QTU A;  3KIH A;  3JAM f;  1ZB8 A;  1N8R 1;  2JA5 I;  2QA4 Z;  4RVG A;  3KIF A;  2RBL A;  3VB9 A;  3OW2 Y;  2AKL A;  2E2I I;  1VQ8 Z;  2P3Y A;  2VUG A;  2O53 A;  5T67 A;  1VQK Z;  4A3B I;  3G71 1;  1S7M A;  1VQ9 Z;  3BG1 B;  2F4M A;  3F3P C;  3TDH B;  4A3F I;  3GTQ I;  3CQZ I;  1Y1W I;  2V8I A;  2WAQ A;  1JJ2 Z;  1M1K 2;  4NBG A;  1VQ8 1;  3NH5 A;  1VQK 1;  3HOW I;  5IP9 I;  2IZ4 A;  1VQ9 1;  1QVG Y;  1Q82 1;  2NVY I;  5C44 I;  4Y52 I;  1NUI A;  3HOX I;  1RO2 A;  3CPW Z;  3CCE Z;  1VQL Z;  1NJI 1;  2NVQ I;  1N8R 2;  3S2D I;  3J81 b;  4E30 A;  3H0G I;  2OTL 1;  2VUM I;  1K8A 2;  3VMH A;  1WW9 A;  1VQN Z;  4NBD A;  2I3C A;  3S2H I;  2RT9 A;  3CCU Z;  3CC2 1;  4E31 A;  1USP A;  4NH1 C;  3CCE 1;  1YHQ Z;  3S14 I;  1VQL 1;  2JMO A;  2WB1 A;  2BJO A;  2QRD B;  2GTH A;  2YU9 I;  2RPR A;  1M90 2;  3CCV 1;  4TNU A;  1W2B Z;  2JS4 A;  4MD9 A;  1I6H I;  3NH8 A;  4A93 I;  4RVF A;  1YHQ 1;  1VLA A;  1KD1 1;  3Q87 A;  3GTP I;  2K3R A;  1TWG I;  1JJ2 Y;  1Z02 A;  5FLM I;  3G71 Z;  3CCQ 1;  4NOZ A;  4MD8 A;  4E2Y A;  3PO2 I;  3CC7 1;  3FKI I;  5A2Q b;  1X3Z A;  3CPW Y;  2O4H A;  3K7A I;  1VQ5 1;  1QVF Z;  3G4S 1;  3S1R I;  4RVD A;  4Y7N I;  3ESW A;  2HF1 A;  3F3F C;  3CCJ 1;  4NB8 A;  5T64 A;  5FLX b;  5CM2 M;  2R93 I;  3J80 b;  4NBB A;  3GTG I;  1Q81 2;  4DGL A;  3PO3 S;  1X3W A;  1Z01 A;  3GTM S;  3S1N I;  1K73 1;  2OOX B;  1K9M 1;  3I55 Z;  1YJN Z;  1Y1V I;  3EED A;  1WCM I;  4AYB A;  5LL6 f;  2E9H A;  3EER A;  3I4M I;  2OTL Z;  2GU2 A;  1YI2 Z;  3FQQ A;  1Y1V S;  3T4N B;  1X0T A;  1I3Q I;  3CME 1;  4HH4 A;  1TWC I;  1KD1 2;  2QEX Z;  3CC2 Z;  1Q7Y 1;  2VF1 A;  3M3Y I;  1W2B Y;  1Q86 2;  1P9N A;  3HKZ A;  3I55 1;  3J81 f;  2YAD A;  1YJN 1;  3S1Q I;  1ZH1 A;  2G2K A;  2EGT A;  2JA8 I;  5C4J I;  1YI2 1;  2Q4Z A;  1TWH I;  1RQF A;  3IFU A;  3MZK B;  4NBC A;  2E2J I;  4HGY A;  3HOZ I;  5IT9 b;  3FQM A;  3D9X A;  3NH4 A;  3CCV Z;  3S16 I;  3CD6 1;  3G6E Z;  4A3C I;  1VQO Z;  1N2F A;  4MD7 A;  3M4O I;  2QEX 1;  1YUA A;  5C4X I;  1TWA I;  2R6M A;  1RO4 A;  4EWC A;  3I56 1;  1VQP Z;  1PFT A;  2W04 A;  3VMI A;  5AN9 F;  4A3L I;  4RV9 A;  1RNI A;  1QVF Y;  2V8K A;  3GTO I;  3CXC Z;  3CCQ Z;  3GTK I;  3NDI A;  3NFZ A;  1K73 2;  4NBA A;  1NP6 A;  3RZO I;  1RO0 A;  3G6E 1;  1S72 1;  1VQO 1;  3CCS 1;  1DL6 A;  2OTJ 1;  4MXU A;  3RZD I;  3CC7 Z;  4A3J I;  4BXX I;  1TWF I;  1Q82 2;  2IZ3 A;  1ML8 A;  1VQ5 Z;  1VQM 1;  1RLY A;  2NVT I;  3G4S Z;  1VQP 1;  3TE5 B;  3IF8 A;  1M1K 1;  2R7Z I;  2JA7 I;  2Q51 A;  3D6W A;  4MON A;  1YIT Z;  4BY1 I;  3CCJ Z;  4X6A I;  4E33 A;  2F4O A;  3S1M I;  1NJI 2;  3CCL 1;  2PM9 A;  2NVX I;  4NBH A;  4NBE A;  3VTN A;  2ZAE B;  3P5J B;  3QWU A;  2PMZ A;  2Y0S A;  3I4N I;  1VQ4 1;  2KI7 B;  5C3E I;  1TFI A;  2PK7 A;  2GTI A;  1KC8 1;  3PO3 I;  3CMA 1;  3H3V J;  3J80 f;  3CCR 1;  1YIT 1;  2OZK A;  3GTM I;  2JUB A;  3HOY I;  3JAM b;  1LQL A;  1K83 I;  2QKD A;  3CME Z;  1K8A 1;  2JA6 I;  3CCM 1;  3HOV I;  2M48 A;  4BBR I;  1L1O C;  3VMG A;  2P28 A;  3S15 I;  2QRE B;  3CC4 Z;  3GTJ I;  4E2Z A;  1Z03 A;  3U50 C;  2HU9 A;  3BG0 B;  1KQS Z;  2QA4 1;  2K5R A;  2LFU A;  4A3D I;  4NFR A;  3J7A 4;  3CXC Y;  2QR1 B;  2QRC B;  4DK1 A;  3CD6 Z;  4A3K I;  1M90 1;  4RVH A;  1USP B;  4A3M I;  3I56 Z;  4A3I I;  3CC4 1;  2OOY B;  2W03 A;  1YIJ Z;  4NB9 A;  3MZL B;  4DQY B;  2JNY A;  5IT9 f;  3OW2 Z;  5IP7 I;  1QF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...