1VQL1

The structure of the transition state analogue "dcsn" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vql100
3CCLZ 1VQ5Z 1VQ91 3I55Z 1K9M2 3CME1 3G4S1 3CCMZ 3I551 3CC2Z 3CPWY 1Q862 2OTJ1 1YHQ1 3CXCZ 3CCM1 1Q7Y1 1VQ81 1VQ4Z 3G711 3CCSZ 1YI21 1KC81 1YJNZ 3CXCY 1VQ41 3G6E1 3CCS1 1VQKZ 3CCU1 1QVGZ 1Q821 1YJN1 1K731 3CCQZ 1VQ6Z 1VQK1 3CCL1 1VQ51 1Q7Y2 1KC82 1QVGY 1JJ2Z 3CCQ1 1VQ7Z 3CC21 2OTLZ 1KD11 1VQMZ 1Q822 1JJ2Y 1K732 1KQSZ 3CMAZ 2OTL1 1VQOZ 1VQM1 1M901 1W2BZ 1K8A1 3I56Z 1N8R1 1YITZ 1VQO1 3OW2Z 3CCJZ 1Q811 1VQNZ 1KD12 1YJWZ 3I561 1NJI1 3CD6Z 1YIT1 1W2BY 1QVFZ 1VQ61 3CCEZ 1S72Z 2QEXZ 3CCVZ 1YJW1 2QA4Z 1M902 3CCE1 1S721 1K8A2 3CPWZ 1N8R2 3CCV1 1QVFY 1VQ71 1YJ9Z 1M1K1 1Q812 2QA41 2OTJZ 1YHQZ 3CC7Z 1NJI2 3CC4Z 3CMA1 1YJ91 1VQ8Z 1KQSY 1VQPZ 3G71Z 1YI2Z 3CCRZ 1K9M1 3CC71 1YIJZ 3CC41 1VQLZ 3G6EZ 1VQP1 3CCJ1 3CCR1 1VQ9Z 1Q861 1VQN1 3CCUZ 3OW2Y 1YIJ1 1M1K2 3CD61 3CMEZ 3G4SZ 1VQL1 2QEX1
chains in the Genus database with same CATH superfamily
3VMIA 1WZNA 4NFRA 2F4OA 3CCMZ 2VPZA 1ZB9A 2OTJ1 3CCM1 3KIHA 2KI7B 3VB9A 3VTNA 5FLXf 4E31A 3NH4A 3CCSZ 2RHBA 2V8KA 3CCS1 3CCU1 2AYDA 3CCQZ 4A3GI 1VLAA 3J81f 1TWHI 5A2Qf 2JUBA 4HGZA 3CCQ1 1QVGY 1JJ2Z 1Y1WI 5LL6f 3CC21 3EEDA 1PFTA 1SFOI 4HGYA 4X6AI 5IP9I 1X0TA 1K8A1 3I56Z 3HOUI 3I07A 1YITZ 1K83I 2QKDA 2G2KA 3CCJZ 3NH8A 5D1OA 2W03A 4MD8A 3I561 4CL1A 4RV9A 3PO3S 1YIT1 2AKLA 2M48A 4BXXI 1Y1VS 4NOZA 2QEXZ 3NDJA 5D1PA 5C4XI 4RVDA 3RZOI 2IZ3A 4DGLA 1M902 2QR1B 1Z03A 1YJ9Z 1L1OC 1WW9A 2NVYI 1X3WA 1YHQZ 1YUKA 3CC4Z 2O4HA 3CMA1 1YJ91 3D2LA 3S17I 3CCRZ 3PO3I 3CC41 1Y1VI 3HKZA 3G6EZ 4S1TA 3CCR1 2HU9A 4NBBA 4A93I 2GTIA 1QF8A 2PM9A 3CMEZ 1VQ5Z 4E33A 3HOZI 3MZKB 3H0GI 3CME1 2VF1A 5C44I 1N2FA 1QXFA 3F3FC 2DE5A 1NUIA 1Q862 2Y0SA 1Q7Y1 2JR6A 1VQ4Z 3GTPI 5IT9b 1USPA 3G711 3J7A4 5AN9F 4NBAA 1TWCI 3CXCY 3HOVI 1VQ41 1DL6A 2M6NA 4MD9A 1QVGZ 1Q821 2I3CA 1K731 3H3VJ 2BJOA 3HOWI 1YUAA 2E7ZA 1ML8A 4EWCA 3GTQI 4E2WA 3M3YI 2K3RA 2WAQA 3BG1B 1KD11 3S2DI 4DQYB 4RVFA 5T6BA 3QWUA 3GTKI 1RO0A 2O53A 3PO2I 5C4JI 3GTOI 2JA8I 2DE7A 2PK7A 1N8R1 3NFZA 4MD7A 2VUGA 1Q811 1VQNZ 2VPYA 3P5JB 3VMGA 2QLVB 1RLYA 4E2YA 1W2BY 5IT9f 3CD6Z 3CCEZ 3S1QI 1S72Z 4RS4A 3CCVZ 3BG0B 3FQMA 3IX0A 4A3MI 5FLMI 2JIQA 4NH1C 3CCE1 4XX2A 1S721 1K8A2 2P28A 3CPWZ 3CCV1 4A3II 4BY7I 1Z02A 1M1K1 4BBSI 3IR7A 3CC7Z 3S1MI 2K5RA 3F3PC 3S1NI 2V3VA 1VQ8Z 1VQPZ 4NBEA 1YI2Z 2OOYB 1K9M1 2QRCB 3CC71 4MRIA 2OZKA 2E2II 2JA7I 1VQLZ 4RVGA 1VQP1 2VPXA 3CCJ1 1VQ9Z 4HH4A 2JIOA 2VUMI 1VQL1 2QEX1 3CCLZ 1VQ91 3I55Z 1S7MA 2RPRA 1Y8CA 3K7AI 1RO4A 1X3ZA 1WJ2A 4A3DI 3I551 2Q51A 3CPWY 3CQZI 2V8IA 2V45A 2V8JA 1I6HI 1RO2A 1YHQ1 3D6WA 2WB1A 3T4NB 2IV2X 3CXCZ 3S2HI 3MONA 2J6AA 2IZ4A 3MZLB 3GTMS 1Z01A 3ESWA 1KC81 4RVHA 4MXUA 1YJNZ 4A3KI 1LQLA 3G6E1 1VQKZ 2JA6I 3FKII 1YJN1 2LIYA 1VQ6Z 1VQK1 3NDIA 1VQ51 1Q7Y2 4A3LI 2GU2A 3J80f 1VQ7Z 5IP7I 3GTMI 1VQMZ 1FDOA 1ZH1A 1Q822 1R9TI 1K732 1I50I 2R6MA 1TWAI 2OOXB 4AYBA 1VQM1 4TNUA 1W2BZ 3GCFA 4E30A 2NVXI 3FQQA 2QREB 2B63I 1KD12 1NJI1 1KRLA 3KIFA 4BY1I 4A3FI 4A3EI 4NB8A 3RZDI 2R92I 3I4MI 2QA4Z 2E9HA 1N8R2 1QVFY 4NBDA 3M4OI 3S14I 1Q16A 4E2XA 2RIQA 1Q812 1RQFA 2QA41 2OTJZ 4MH4A 1FDIA 5T64A 3I4NI 2GTHA 4DK1A 5C3EI 2NVTI 1WCMI 2EGTA 4Y7NI 2KPIA 2ZAEB 3GTGI 2YU9I 1VQN1 3CCUZ 1M1K2 3CD61 5D1OB 3G4SZ 4BBRI 2Q4ZA 3GTLI 1K9M2 3JAMb 3G4S1 2E2HI 3CC2Z 3D9XA 2JA5I 2F4MA 2RBLA 2PMZA 4A3JI 2NAPA 1VQ81 2JIPA 1YI21 2QRDB 3J80b 3TDHB 1TWFI 2NVQI 3GTJI 4Y52I 4NBHA 3LUSA 2LEXA 3NH5A 1TFIA 2E2JI 3CCL1 2JIMA 4NBCA 2R93I 2JIRA 1I3QI 1KC82 3EERA 1WIIA 2YADA 4NBGA 5T67A 2LFUA 2OTLZ 4A3BI 1JJ2Y 3IF8A 1QYPA 1KQSZ 3CMAZ 2OTL1 2JMOA 1VQOZ 3IFUA 3JAMf 2H85A 1M901 1USPB 3TE5B 1JWHC 1VQO1 3S15I 3OW2Z 3HOXI 3GKQA 1ZB8A 1YJWZ 4E2ZA 4A3CI 4NB9A 3VMHA 2VPWA 2R7ZI 1QVFZ 1VQ61 3S1RI 1TWGI 2P3YA 3U50C 1YJW1 3HOYI 4E32A 5FLXb 1P9NA 4QTUA 1VQ71 2JNYA 3Q87A 4QTTA 1NJI2 2HF1A 5CM2M 1RNIA 4MONA 1KQSY 3S16I 3G71Z 1SIWA 1YIJZ 1AA6A 1NP6A 2DE6A 2JS4A 4NBFA 3J81b 5A2Qb 1Q861 3OW2Y 1YIJ1 2W04A 2RT9A
chains in the Genus database with same CATH topology
3VMIA 4NFRA 2F4OA 3CCMZ 1ZB9A 2OTJ1 3CCM1 3KIHA 2KI7B 3VB9A 3VTNA 5FLXf 4E31A 3NH4A 3CCSZ 2RHBA 2V8KA 3CCS1 3CCU1 3CCQZ 4A3GI 1VLAA 3J81f 1TWHI 5A2Qf 2JUBA 4HGZA 3CCQ1 1QVGY 1JJ2Z 1Y1WI 5LL6f 3CC21 3EEDA 1PFTA 1SFOI 4HGYA 4X6AI 5IP9I 1X0TA 1K8A1 3I56Z 3HOUI 3I07A 1YITZ 1K83I 2QKDA 2G2KA 3CCJZ 3NH8A 5D1OA 2W03A 4MD8A 3I561 4CL1A 4RV9A 3PO3S 1YIT1 2AKLA 2M48A 4BXXI 1Y1VS 4NOZA 2QEXZ 3NDJA 5D1PA 5C4XI 4RVDA 3RZOI 2IZ3A 4DGLA 1M902 2QR1B 1Z03A 1YJ9Z 1L1OC 1WW9A 2NVYI 1X3WA 1YHQZ 1YUKA 3CC4Z 2O4HA 3CMA1 1YJ91 3S17I 3CCRZ 3PO3I 3CC41 1Y1VI 3HKZA 3G6EZ 4S1TA 3CCR1 2HU9A 4NBBA 4A93I 2GTIA 1QF8A 2PM9A 3CMEZ 1VQ5Z 4E33A 3HOZI 3MZKB 3H0GI 3CME1 2VF1A 5C44I 1N2FA 3F3FC 2DE5A 1NUIA 1Q862 2Y0SA 1Q7Y1 2JR6A 1VQ4Z 3GTPI 5IT9b 1USPA 3G711 3J7A4 5AN9F 4NBAA 1TWCI 3CXCY 3HOVI 1VQ41 1DL6A 2M6NA 4MD9A 1QVGZ 1Q821 2I3CA 1K731 3H3VJ 2BJOA 3HOWI 1YUAA 1ML8A 4EWCA 3GTQI 4E2WA 3M3YI 2K3RA 2WAQA 3BG1B 1KD11 3S2DI 4DQYB 4RVFA 5T6BA 3QWUA 3GTKI 1RO0A 2O53A 3PO2I 5C4JI 3GTOI 2JA8I 2DE7A 2PK7A 1N8R1 3NFZA 4MD7A 2VUGA 1Q811 1VQNZ 3P5JB 3VMGA 2QLVB 1RLYA 4E2YA 1W2BY 5IT9f 3CD6Z 3CCEZ 3S1QI 1S72Z 4RS4A 3CCVZ 3BG0B 3FQMA 3IX0A 4A3MI 5FLMI 4NH1C 3CCE1 4XX2A 1S721 1K8A2 2P28A 3CPWZ 3CCV1 4A3II 4BY7I 1Z02A 1M1K1 4BBSI 3CC7Z 3S1MI 2K5RA 3F3PC 3S1NI 1VQ8Z 1VQPZ 4NBEA 1YI2Z 2OOYB 1K9M1 2QRCB 3CC71 4MRIA 2OZKA 2E2II 2JA7I 1VQLZ 4RVGA 1VQP1 3CCJ1 1VQ9Z 4HH4A 2VUMI 1VQL1 2QEX1 3CCLZ 1VQ91 3I55Z 1S7MA 2RPRA 3K7AI 1RO4A 1X3ZA 4A3DI 3I551 2Q51A 3CPWY 3CQZI 2V8IA 2V8JA 1I6HI 1RO2A 1YHQ1 3D6WA 2WB1A 3T4NB 3CXCZ 3S2HI 3MONA 2J6AA 2IZ4A 3MZLB 3GTMS 1Z01A 3ESWA 1KC81 4RVHA 4MXUA 1YJNZ 4A3KI 1LQLA 3G6E1 1VQKZ 2JA6I 3FKII 1YJN1 2LIYA 1VQ6Z 1VQK1 3NDIA 1VQ51 1Q7Y2 4A3LI 2GU2A 3J80f 1VQ7Z 5IP7I 3GTMI 1VQMZ 1ZH1A 1Q822 1R9TI 1K732 1I50I 2R6MA 1TWAI 2OOXB 4AYBA 1VQM1 4TNUA 1W2BZ 3GCFA 4E30A 2NVXI 3FQQA 2QREB 2B63I 1KD12 1NJI1 1KRLA 3KIFA 4BY1I 4A3FI 4A3EI 4NB8A 3RZDI 2R92I 3I4MI 2QA4Z 2E9HA 1N8R2 1QVFY 4NBDA 3M4OI 3S14I 4E2XA 2RIQA 1Q812 1RQFA 2QA41 2OTJZ 4MH4A 5T64A 3I4NI 2GTHA 4DK1A 5C3EI 2NVTI 1WCMI 2EGTA 4Y7NI 2KPIA 2ZAEB 3GTGI 2YU9I 1VQN1 3CCUZ 1M1K2 3CD61 5D1OB 3G4SZ 4BBRI 2Q4ZA 3GTLI 1K9M2 3JAMb 3G4S1 2E2HI 3CC2Z 3D9XA 2JA5I 2F4MA 2RBLA 2PMZA 4A3JI 1VQ81 1YI21 2QRDB 3J80b 3TDHB 1TWFI 2NVQI 3GTJI 4Y52I 4NBHA 3LUSA 3NH5A 1TFIA 2E2JI 3CCL1 4NBCA 2R93I 1I3QI 1KC82 3EERA 1WIIA 2YADA 4NBGA 5T67A 2LFUA 2OTLZ 4A3BI 1JJ2Y 3IF8A 1QYPA 1KQSZ 3CMAZ 2OTL1 2JMOA 1VQOZ 3IFUA 3JAMf 2H85A 1M901 1USPB 3TE5B 1JWHC 1VQO1 3S15I 3OW2Z 3HOXI 3GKQA 1ZB8A 1YJWZ 4E2ZA 4A3CI 4NB9A 3VMHA 2R7ZI 1QVFZ 1VQ61 3S1RI 1TWGI 2P3YA 3U50C 1YJW1 3HOYI 4E32A 5FLXb 1P9NA 4QTUA 1VQ71 2JNYA 3Q87A 4QTTA 1NJI2 2HF1A 5CM2M 1RNIA 4MONA 1KQSY 3S16I 3G71Z 1YIJZ 1NP6A 2DE6A 2JS4A 4NBFA 3J81b 5A2Qb 1Q861 3OW2Y 1YIJ1 2W04A 2RT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCL Z;  1VQ5 Z;  1VQ9 1;  3I55 Z;  1K9M 2;  3CME 1;  3G4S 1;  3CCM Z;  3I55 1;  3CC2 Z;  3CPW Y;  1Q86 2;  2OTJ 1;  1YHQ 1;  3CXC Z;  3CCM 1;  1Q7Y 1;  1VQ8 1;  1VQ4 Z;  3G71 1;  3CCS Z;  1YI2 1;  1KC8 1;  1YJN Z;  3CXC Y;  1VQ4 1;  3G6E 1;  3CCS 1;  1VQK Z;  3CCU 1;  1QVG Z;  1Q82 1;  1YJN 1;  1K73 1;  3CCQ Z;  1VQ6 Z;  1VQK 1;  3CCL 1;  1VQ5 1;  1Q7Y 2;  1KC8 2;  1QVG Y;  1JJ2 Z;  3CCQ 1;  1VQ7 Z;  3CC2 1;  2OTL Z;  1KD1 1;  1VQM Z;  1Q82 2;  1JJ2 Y;  1K73 2;  1KQS Z;  3CMA Z;  2OTL 1;  1VQO Z;  1VQM 1;  1M90 1;  1W2B Z;  1K8A 1;  3I56 Z;  1N8R 1;  1YIT Z;  1VQO 1;  3OW2 Z;  3CCJ Z;  1Q81 1;  1VQN Z;  1KD1 2;  1YJW Z;  3I56 1;  1NJI 1;  3CD6 Z;  1YIT 1;  1W2B Y;  1QVF Z;  1VQ6 1;  3CCE Z;  1S72 Z;  2QEX Z;  3CCV Z;  1YJW 1;  2QA4 Z;  1M90 2;  3CCE 1;  1S72 1;  1K8A 2;  3CPW Z;  1N8R 2;  3CCV 1;  1QVF Y;  1VQ7 1;  1YJ9 Z;  1M1K 1;  1Q81 2;  2QA4 1;  2OTJ Z;  1YHQ Z;  3CC7 Z;  1NJI 2;  3CC4 Z;  3CMA 1;  1YJ9 1;  1VQ8 Z;  1KQS Y;  1VQP Z;  3G71 Z;  1YI2 Z;  3CCR Z;  1K9M 1;  3CC7 1;  1YIJ Z;  3CC4 1;  1VQL Z;  3G6E Z;  1VQP 1;  3CCJ 1;  3CCR 1;  1VQ9 Z;  1Q86 1;  1VQN 1;  3CCU Z;  3OW2 Y;  1YIJ 1;  1M1K 2;  3CD6 1;  3CME Z;  3G4S Z;  1VQL 1;  2QEX 1; 
#chains in the Genus database with same CATH topology
 3VMI A;  1WZN A;  4NFR A;  2F4O A;  3CCM Z;  2VPZ A;  1ZB9 A;  2OTJ 1;  3CCM 1;  3KIH A;  2KI7 B;  3VB9 A;  3VTN A;  5FLX f;  4E31 A;  3NH4 A;  3CCS Z;  2RHB A;  2V8K A;  3CCS 1;  3CCU 1;  2AYD A;  3CCQ Z;  4A3G I;  1VLA A;  3J81 f;  1TWH I;  5A2Q f;  2JUB A;  4HGZ A;  3CCQ 1;  1QVG Y;  1JJ2 Z;  1Y1W I;  5LL6 f;  3CC2 1;  3EED A;  1PFT A;  1SFO I;  4HGY A;  4X6A I;  5IP9 I;  1X0T A;  1K8A 1;  3I56 Z;  3HOU I;  3I07 A;  1YIT Z;  1K83 I;  2QKD A;  2G2K A;  3CCJ Z;  3NH8 A;  5D1O A;  2W03 A;  4MD8 A;  3I56 1;  4CL1 A;  4RV9 A;  3PO3 S;  1YIT 1;  2AKL A;  2M48 A;  4BXX I;  1Y1V S;  4NOZ A;  2QEX Z;  3NDJ A;  5D1P A;  5C4X I;  4RVD A;  3RZO I;  2IZ3 A;  4DGL A;  1M90 2;  2QR1 B;  1Z03 A;  1YJ9 Z;  1L1O C;  1WW9 A;  2NVY I;  1X3W A;  1YHQ Z;  1YUK A;  3CC4 Z;  2O4H A;  3CMA 1;  1YJ9 1;  3D2L A;  3S17 I;  3CCR Z;  3PO3 I;  3CC4 1;  1Y1V I;  3HKZ A;  3G6E Z;  4S1T A;  3CCR 1;  2HU9 A;  4NBB A;  4A93 I;  2GTI A;  1QF8 A;  2PM9 A;  3CME Z;  1VQ5 Z;  4E33 A;  3HOZ I;  3MZK B;  3H0G I;  3CME 1;  2VF1 A;  5C44 I;  1N2F A;  1QXF A;  3F3F C;  2DE5 A;  1NUI A;  1Q86 2;  2Y0S A;  1Q7Y 1;  2JR6 A;  1VQ4 Z;  3GTP I;  5IT9 b;  1USP A;  3G71 1;  3J7A 4;  5AN9 F;  4NBA A;  1TWC I;  3CXC Y;  3HOV I;  1VQ4 1;  1DL6 A;  2M6N A;  4MD9 A;  1QVG Z;  1Q82 1;  2I3C A;  1K73 1;  3H3V J;  2BJO A;  3HOW I;  1YUA A;  2E7Z A;  1ML8 A;  4EWC A;  3GTQ I;  4E2W A;  3M3Y I;  2K3R A;  2WAQ A;  3BG1 B;  1KD1 1;  3S2D I;  4DQY B;  4RVF A;  5T6B A;  3QWU A;  3GTK I;  1RO0 A;  2O53 A;  3PO2 I;  5C4J I;  3GTO I;  2JA8 I;  2DE7 A;  2PK7 A;  1N8R 1;  3NFZ A;  4MD7 A;  2VUG A;  1Q81 1;  1VQN Z;  2VPY A;  3P5J B;  3VMG A;  2QLV B;  1RLY A;  4E2Y A;  1W2B Y;  5IT9 f;  3CD6 Z;  3CCE Z;  3S1Q I;  1S72 Z;  4RS4 A;  3CCV Z;  3BG0 B;  3FQM A;  3IX0 A;  4A3M I;  5FLM I;  2JIQ A;  4NH1 C;  3CCE 1;  4XX2 A;  1S72 1;  1K8A 2;  2P28 A;  3CPW Z;  3CCV 1;  4A3I I;  4BY7 I;  1Z02 A;  1M1K 1;  4BBS I;  3IR7 A;  3CC7 Z;  3S1M I;  2K5R A;  3F3P C;  3S1N I;  2V3V A;  1VQ8 Z;  1VQP Z;  4NBE A;  1YI2 Z;  2OOY B;  1K9M 1;  2QRC B;  3CC7 1;  4MRI A;  2OZK A;  2E2I I;  2JA7 I;  1VQL Z;  4RVG A;  1VQP 1;  2VPX A;  3CCJ 1;  1VQ9 Z;  4HH4 A;  2JIO A;  2VUM I;  1VQL 1;  2QEX 1;  3CCL Z;  1VQ9 1;  3I55 Z;  1S7M A;  2RPR A;  1Y8C A;  3K7A I;  1RO4 A;  1X3Z A;  1WJ2 A;  4A3D I;  3I55 1;  2Q51 A;  3CPW Y;  3CQZ I;  2V8I A;  2V45 A;  2V8J A;  1I6H I;  1RO2 A;  1YHQ 1;  3D6W A;  2WB1 A;  3T4N B;  2IV2 X;  3CXC Z;  3S2H I;  3MON A;  2J6A A;  2IZ4 A;  3MZL B;  3GTM S;  1Z01 A;  3ESW A;  1KC8 1;  4RVH A;  4MXU A;  1YJN Z;  4A3K I;  1LQL A;  3G6E 1;  1VQK Z;  2JA6 I;  3FKI I;  1YJN 1;  2LIY A;  1VQ6 Z;  1VQK 1;  3NDI A;  1VQ5 1;  1Q7Y 2;  4A3L I;  2GU2 A;  3J80 f;  1VQ7 Z;  5IP7 I;  3GTM I;  1VQM Z;  1FDO A;  1ZH1 A;  1Q82 2;  1R9T I;  1K73 2;  1I50 I;  2R6M A;  1TWA I;  2OOX B;  4AYB A;  1VQM 1;  4TNU A;  1W2B Z;  3GCF A;  4E30 A;  2NVX I;  3FQQ A;  2QRE B;  2B63 I;  1KD1 2;  1NJI 1;  1KRL A;  3KIF A;  4BY1 I;  4A3F I;  4A3E I;  4NB8 A;  3RZD I;  2R92 I;  3I4M I;  2QA4 Z;  2E9H A;  1N8R 2;  1QVF Y;  4NBD A;  3M4O I;  3S14 I;  1Q16 A;  4E2X A;  2RIQ A;  1Q81 2;  1RQF A;  2QA4 1;  2OTJ Z;  4MH4 A;  1FDI A;  5T64 A;  3I4N I;  2GTH A;  4DK1 A;  5C3E I;  2NVT I;  1WCM I;  2EGT A;  4Y7N I;  2KPI A;  2ZAE B;  3GTG I;  2YU9 I;  1VQN 1;  3CCU Z;  1M1K 2;  3CD6 1;  5D1O B;  3G4S Z;  4BBR I;  2Q4Z A;  3GTL I;  1K9M 2;  3JAM b;  3G4S 1;  2E2H I;  3CC2 Z;  3D9X A;  2JA5 I;  2F4M A;  2RBL A;  2PMZ A;  4A3J I;  2NAP A;  1VQ8 1;  2JIP A;  1YI2 1;  2QRD B;  3J80 b;  3TDH B;  1TWF I;  2NVQ I;  3GTJ I;  4Y52 I;  4NBH A;  3LUS A;  2LEX A;  3NH5 A;  1TFI A;  2E2J I;  3CCL 1;  2JIM A;  4NBC A;  2R93 I;  2JIR A;  1I3Q I;  1KC8 2;  3EER A;  1WII A;  2YAD A;  4NBG A;  5T67 A;  2LFU A;  2OTL Z;  4A3B I;  1JJ2 Y;  3IF8 A;  1QYP A;  1KQS Z;  3CMA Z;  2OTL 1;  2JMO A;  1VQO Z;  3IFU A;  3JAM f;  2H85 A;  1M90 1;  1USP B;  3TE5 B;  1JWH C;  1VQO 1;  3S15 I;  3OW2 Z;  3HOX I;  3GKQ A;  1ZB8 A;  1YJW Z;  4E2Z A;  4A3C I;  4NB9 A;  3VMH A;  2VPW A;  2R7Z I;  1QVF Z;  1VQ6 1;  3S1R I;  1TWG I;  2P3Y A;  3U50 C;  1YJW 1;  3HOY I;  4E32 A;  5FLX b;  1P9N A;  4QTU A;  1VQ7 1;  2JNY A;  3Q87 A;  4QTT A;  1NJI 2;  2HF1 A;  5CM2 M;  1RNI A;  4MON A;  1KQS Y;  3S16 I;  3G71 Z;  1SIW A;  1YIJ Z;  1AA6 A;  1NP6 A;  2DE6 A;  2JS4 A;  4NBF A;  3J81 b;  5A2Q b;  1Q86 1;  3OW2 Y;  1YIJ 1;  2W04 A;  2RT9 A; 
#chains in the Genus database with same CATH homology
 3VMI A;  4NFR A;  2F4O A;  3CCM Z;  1ZB9 A;  2OTJ 1;  3CCM 1;  3KIH A;  2KI7 B;  3VB9 A;  3VTN A;  5FLX f;  4E31 A;  3NH4 A;  3CCS Z;  2RHB A;  2V8K A;  3CCS 1;  3CCU 1;  3CCQ Z;  4A3G I;  1VLA A;  3J81 f;  1TWH I;  5A2Q f;  2JUB A;  4HGZ A;  3CCQ 1;  1QVG Y;  1JJ2 Z;  1Y1W I;  5LL6 f;  3CC2 1;  3EED A;  1PFT A;  1SFO I;  4HGY A;  4X6A I;  5IP9 I;  1X0T A;  1K8A 1;  3I56 Z;  3HOU I;  3I07 A;  1YIT Z;  1K83 I;  2QKD A;  2G2K A;  3CCJ Z;  3NH8 A;  5D1O A;  2W03 A;  4MD8 A;  3I56 1;  4CL1 A;  4RV9 A;  3PO3 S;  1YIT 1;  2AKL A;  2M48 A;  4BXX I;  1Y1V S;  4NOZ A;  2QEX Z;  3NDJ A;  5D1P A;  5C4X I;  4RVD A;  3RZO I;  2IZ3 A;  4DGL A;  1M90 2;  2QR1 B;  1Z03 A;  1YJ9 Z;  1L1O C;  1WW9 A;  2NVY I;  1X3W A;  1YHQ Z;  1YUK A;  3CC4 Z;  2O4H A;  3CMA 1;  1YJ9 1;  3S17 I;  3CCR Z;  3PO3 I;  3CC4 1;  1Y1V I;  3HKZ A;  3G6E Z;  4S1T A;  3CCR 1;  2HU9 A;  4NBB A;  4A93 I;  2GTI A;  1QF8 A;  2PM9 A;  3CME Z;  1VQ5 Z;  4E33 A;  3HOZ I;  3MZK B;  3H0G I;  3CME 1;  2VF1 A;  5C44 I;  1N2F A;  3F3F C;  2DE5 A;  1NUI A;  1Q86 2;  2Y0S A;  1Q7Y 1;  2JR6 A;  1VQ4 Z;  3GTP I;  5IT9 b;  1USP A;  3G71 1;  3J7A 4;  5AN9 F;  4NBA A;  1TWC I;  3CXC Y;  3HOV I;  1VQ4 1;  1DL6 A;  2M6N A;  4MD9 A;  1QVG Z;  1Q82 1;  2I3C A;  1K73 1;  3H3V J;  2BJO A;  3HOW I;  1YUA A;  1ML8 A;  4EWC A;  3GTQ I;  4E2W A;  3M3Y I;  2K3R A;  2WAQ A;  3BG1 B;  1KD1 1;  3S2D I;  4DQY B;  4RVF A;  5T6B A;  3QWU A;  3GTK I;  1RO0 A;  2O53 A;  3PO2 I;  5C4J I;  3GTO I;  2JA8 I;  2DE7 A;  2PK7 A;  1N8R 1;  3NFZ A;  4MD7 A;  2VUG A;  1Q81 1;  1VQN Z;  3P5J B;  3VMG A;  2QLV B;  1RLY A;  4E2Y A;  1W2B Y;  5IT9 f;  3CD6 Z;  3CCE Z;  3S1Q I;  1S72 Z;  4RS4 A;  3CCV Z;  3BG0 B;  3FQM A;  3IX0 A;  4A3M I;  5FLM I;  4NH1 C;  3CCE 1;  4XX2 A;  1S72 1;  1K8A 2;  2P28 A;  3CPW Z;  3CCV 1;  4A3I I;  4BY7 I;  1Z02 A;  1M1K 1;  4BBS I;  3CC7 Z;  3S1M I;  2K5R A;  3F3P C;  3S1N I;  1VQ8 Z;  1VQP Z;  4NBE A;  1YI2 Z;  2OOY B;  1K9M 1;  2QRC B;  3CC7 1;  4MRI A;  2OZK A;  2E2I I;  2JA7 I;  1VQL Z;  4RVG A;  1VQP 1;  3CCJ 1;  1VQ9 Z;  4HH4 A;  2VUM I;  1VQL 1;  2QEX 1;  3CCL Z;  1VQ9 1;  3I55 Z;  1S7M A;  2RPR A;  3K7A I;  1RO4 A;  1X3Z A;  4A3D I;  3I55 1;  2Q51 A;  3CPW Y;  3CQZ I;  2V8I A;  2V8J A;  1I6H I;  1RO2 A;  1YHQ 1;  3D6W A;  2WB1 A;  3T4N B;  3CXC Z;  3S2H I;  3MON A;  2J6A A;  2IZ4 A;  3MZL B;  3GTM S;  1Z01 A;  3ESW A;  1KC8 1;  4RVH A;  4MXU A;  1YJN Z;  4A3K I;  1LQL A;  3G6E 1;  1VQK Z;  2JA6 I;  3FKI I;  1YJN 1;  2LIY A;  1VQ6 Z;  1VQK 1;  3NDI A;  1VQ5 1;  1Q7Y 2;  4A3L I;  2GU2 A;  3J80 f;  1VQ7 Z;  5IP7 I;  3GTM I;  1VQM Z;  1ZH1 A;  1Q82 2;  1R9T I;  1K73 2;  1I50 I;  2R6M A;  1TWA I;  2OOX B;  4AYB A;  1VQM 1;  4TNU A;  1W2B Z;  3GCF A;  4E30 A;  2NVX I;  3FQQ A;  2QRE B;  2B63 I;  1KD1 2;  1NJI 1;  1KRL A;  3KIF A;  4BY1 I;  4A3F I;  4A3E I;  4NB8 A;  3RZD I;  2R92 I;  3I4M I;  2QA4 Z;  2E9H A;  1N8R 2;  1QVF Y;  4NBD A;  3M4O I;  3S14 I;  4E2X A;  2RIQ A;  1Q81 2;  1RQF A;  2QA4 1;  2OTJ Z;  4MH4 A;  5T64 A;  3I4N I;  2GTH A;  4DK1 A;  5C3E I;  2NVT I;  1WCM I;  2EGT A;  4Y7N I;  2KPI A;  2ZAE B;  3GTG I;  2YU9 I;  1VQN 1;  3CCU Z;  1M1K 2;  3CD6 1;  5D1O B;  3G4S Z;  4BBR I;  2Q4Z A;  3GTL I;  1K9M 2;  3JAM b;  3G4S 1;  2E2H I;  3CC2 Z;  3D9X A;  2JA5 I;  2F4M A;  2RBL A;  2PMZ A;  4A3J I;  1VQ8 1;  1YI2 1;  2QRD B;  3J80 b;  3TDH B;  1TWF I;  2NVQ I;  3GTJ I;  4Y52 I;  4NBH A;  3LUS A;  3NH5 A;  1TFI A;  2E2J I;  3CCL 1;  4NBC A;  2R93 I;  1I3Q I;  1KC8 2;  3EER A;  1WII A;  2YAD A;  4NBG A;  5T67 A;  2LFU A;  2OTL Z;  4A3B I;  1JJ2 Y;  3IF8 A;  1QYP A;  1KQS Z;  3CMA Z;  2OTL 1;  2JMO A;  1VQO Z;  3IFU A;  3JAM f;  2H85 A;  1M90 1;  1USP B;  3TE5 B;  1JWH C;  1VQO 1;  3S15 I;  3OW2 Z;  3HOX I;  3GKQ A;  1ZB8 A;  1YJW Z;  4E2Z A;  4A3C I;  4NB9 A;  3VMH A;  2R7Z I;  1QVF Z;  1VQ6 1;  3S1R I;  1TWG I;  2P3Y A;  3U50 C;  1YJW 1;  3HOY I;  4E32 A;  5FLX b;  1P9N A;  4QTU A;  1VQ7 1;  2JNY A;  3Q87 A;  4QTT A;  1NJI 2;  2HF1 A;  5CM2 M;  1RNI A;  4MON A;  1KQS Y;  3S16 I;  3G71 Z;  1YIJ Z;  1NP6 A;  2DE6 A;  2JS4 A;  4NBF A;  3J81 b;  5A2Q b;  1Q86 1;  3OW2 Y;  1YIJ 1;  2W04 A;  2RT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...