1VQL1

The structure of the transition state analogue "dcsn" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vql100
3CCRZ 2OTJZ 1YIJZ 3CXCZ 3G4S1 3CCL1 1Q7Y2 1K9M1 3CD6Z 3CCS1 1YJW1 1M902 1VQ9Z 1VQLZ 1K8A1 3G6E1 3CMEZ 2QA41 1YJ9Z 1VQ5Z 3CC41 3CCV1 1YI2Z 1YIT1 1NJI2 3I561 1K8A2 1KD11 3I551 1K731 3CC71 1VQ7Z 1Q821 3CC21 3G711 1KQSZ 3CCE1 1N8R2 1VQ91 1KD12 1QVGY 1K732 1VQ81 3CCEZ 3G4SZ 1W2BZ 1VQKZ 1YJNZ 1VQ8Z 1VQ61 1Q7Y1 1VQN1 3CC2Z 1VQL1 3CCR1 3CMAZ 3CCU1 3G6EZ 1JJ2Y 1QVFY 3CCLZ 3OW2Z 3CC4Z 3I55Z 3CCMZ 3CD61 1YHQ1 3I56Z 1QVGZ 3CCJ1 1NJI1 3CPWZ 3G71Z 3CCSZ 1KQSY 2OTL1 1VQ6Z 3CCQ1 1YIJ1 1M1K1 1VQPZ 1KC81 3CXCY 3CME1 2QA4Z 1YITZ 1VQ41 1VQ51 1YJWZ 1YJN1 1VQOZ 1VQ4Z 3CC7Z 1VQ71 3CCVZ 1Q811 1JJ2Z 1VQK1 3CPWY 1VQMZ 3CCJZ 1K9M2 1Q812 1M901 2QEXZ 3OW2Y 1QVFZ 1VQO1 3CCM1 1Q861 3CCUZ 1W2BY 3CMA1 1YJ91 1S72Z 1M1K2 1KC82 1Q862 1VQP1 1S721 1Q822 1YI21 3CCQZ 1YHQZ 1N8R1 2QEX1 2OTJ1 1VQNZ 1VQM1 2OTLZ
chains in the Genus database with same CATH superfamily
1YUKA 2OTJZ 3P5JB 1AA6A 3G4S1 2E9HA 2K5RA 5D1OA 1VQ9Z 4RVGA 1TWGI 4E33A 2H85A 1YJ9Z 3I4NI 3RZOI 3CC41 3CCV1 2P28A 3S14I 3I561 1USPA 1K8A2 1KD11 1K731 4HGZA 3HKZA 3H3VJ 2J6AA 1KD12 1WJ2A 1TWAI 2YADA 1K732 1RO4A 1VQ81 1W2BZ 1VQKZ 2G2KA 4S1TA 3CQZI 1VQ8Z 3GTPI 1Q7Y1 2V8KA 1N2FA 2VPWA 1VQL1 3CCR1 3CMAZ 3G6EZ 3CCLZ 3IF8A 3CC4Z 1NP6A 3FQQA 3CD61 3I56Z 3F3FC 2W04A 4TNUA 4EWCA 2O53A 4CL1A 3KIFA 2E7ZA 5T6BA 1ML8A 1RLYA 1WZNA 2JS4A 1KC81 2PK7A 2JNYA 2Q51A 2AKLA 4BBSI 1VQ41 1I6HI 1Z01A 4RV9A 3TDHB 2WB1A 2PMZA 5T64A 3CC7Z 3EEDA 1Q811 2M6NA 2E2II 3GCFA 2F4MA 4A93I 4MD9A 2K3RA 1M901 3OW2Y 1RO0A 1M1K2 1JWHC 2OOYB 1DL6A 3NDIA 3I4MI 1VQP1 1Q822 3VMGA 3LUSA 3JAMb 3CCQZ 4MONA 1X3ZA 4XX2A 4E2XA 2V8IA 4Y7NI 2GTIA 2KPIA 3D9XA 1VQM1 3CCRZ 1YIJZ 2VF1A 2VPYA 3NDJA 1Z03A 1FDOA 3VTNA 2R6MA 3CD6Z 1YJW1 2RIQA 3QWUA 1M902 2QRCB 4A3II 3G6E1 1TWCI 1ZB8A 2YU9I 1VQ5Z 4X6AI 1YI2Z 1NJI2 2BJOA 3I551 3RZDI 4QTUA 2VUMI 3J81b 1VQ7Z 2IZ4A 1Q821 3CC21 3G711 1TWFI 4MXUA 1VQ91 3HOYI 4E32A 3S16I 2F4OA 1X3WA 1QVGY 3NH5A 5AN9F 3G4SZ 2IZ3A 5C4XI 1YJNZ 2DE7A 2WAQA 3F3PC 2NVXI 3FQMA 4NBAA 5LL6f 2E2HI 1QXFA 3H0GI 4A3DI 2OOXB 1VLAA 3GTMI 1JJ2Y 2JA8I 1WCMI 2VPZA 4BY1I 1QVGZ 2M48A 3CCJ1 1NJI1 2W03A 4A3JI 1YUAA 3M4OI 3CCSZ 1VQ6Z 3CCQ1 3T4NB 4MD8A 1VQPZ 3VB9A 2DE6A 3CXCY 1S7MA 2QA4Z 3S2HI 1P9NA 3GKQA 1QYPA 2R93I 2V45A 3J80f 1VQ4Z 1VQ71 1WW9A 2R7ZI 3EERA 4MH4A 3CPWY 2JMOA 3PO3I 3CCJZ 3K7AI 1Q812 2JA5I 3HOXI 1QF8A 3HOVI 2O4HA 2EGTA 1W2BY 5D1OB 1S721 1YI21 2HU9A 1YHQZ 3S1RI 1N8R1 2QEX1 4NBHA 4NBBA 1VQNZ 1USPB 2OTLZ 1WIIA 2DE5A 5CM2M 1LQLA 3CXCZ 4NB9A 2OZKA 3CCL1 2QREB 4BBRI 1K9M1 3HOZI 3I07A 1VQLZ 3GTQI 3GTOI 4DK1A 1TFIA 3CMEZ 2JA7I 4BXXI 3PO2I 1YIT1 2Y0SA 2NVYI 4A3LI 3TE5B 2LFUA 3CC71 3HOWI 1KQSZ 1N8R2 1FDIA 2NVTI 3PO3S 3NH4A 5C3EI 3D2LA 1TWHI 4RVFA 3CCEZ 4RVDA 2VPXA 2JIPA 2JA6I 5C44I 4A3FI 3VMIA 1Z02A 4HH4A 5FLMI 3CCMZ 3J81f 4MRIA 2NAPA 3CPWZ 2AYDA 3GTGI 3M3YI 4NB8A 3S1NI 2JUBA 3S15I 2V3VA 2P3YA 4MD7A 2QLVB 3GTJI 3CME1 1YITZ 3S1MI 5IP9I 1L1OC 4A3CI 2QRDB 1YJN1 2JIRA 2NVQI 3KIHA 4A3BI 1I3QI 5IP7I 2JIQA 1RQFA 4DGLA 2QEXZ 2RHBA 3Q87A 4NBFA 3MZLB 1VQO1 1K83I 1Q861 3U50C 3CMA1 3ESWA 2RT9A 5C4JI 1S72Z 2KI7B 2ZAEB 4A3EI 3GTKI 3BG0B 3NH8A 1NUIA 1Q862 3J80b 2PM9A 3MONA 2R92I 3VMHA 1RNIA 2HF1A 2V8JA 3MZKB 4BY7I 5D1PA 5IT9b 4HGYA 4DQYB 2JIMA 2RPRA 4Y52I 1Q7Y2 4NFRA 2JR6A 3CCS1 1K8A1 2QA41 4NOZA 5FLXb 2RBLA 3IX0A 2LEXA 1SFOI 4A3MI 5FLXf 4E2WA 1Q16A 3D6WA 2QKDA 2VUGA 2IV2X 3CCE1 1R9TI 2GTHA 3HOUI 3IR7A 2JIOA 4NBDA 1KRLA 4NBCA 4NH1C 1ZB9A 3S1QI 1VQN1 5T67A 3CC2Z 1I50I 3CCU1 4RS4A 1QVFY 1Y8CA 3OW2Z 1Y1VS 3I55Z 4E30A 4A3KI 2I3CA 1YHQ1 1PFTA 2QR1B 1X0TA 3G71Z 1RO2A 1KQSY 2LIYA 2OTL1 1SIWA 1YIJ1 1M1K1 2Q4ZA 3FKII 3BG1B 1VQ51 2B63I 1YJWZ 1VQOZ 3GTLI 3JAMf 3CCVZ 3S2DI 4E31A 4AYBA 4NBGA 1JJ2Z 1VQK1 1VQMZ 1Y1WI 4E2YA 1K9M2 3S17I 3IFUA 4A3GI 4RVHA 1Y1VI 2GU2A 3J7A4 1ZH1A 3GTMS 4QTTA 1QVFZ 3CCM1 3CCUZ 5A2Qb 2E2JI 1YJ91 5A2Qf 4E2ZA 1KC82 3NFZA 5IT9f 2OTJ1 4NBEA 1VQ61
chains in the Genus database with same CATH topology
1YUKA 2OTJZ 3P5JB 3G4S1 2E9HA 2K5RA 5D1OA 1VQ9Z 4RVGA 1TWGI 4E33A 2H85A 1YJ9Z 3I4NI 3RZOI 3CC41 3CCV1 2P28A 3S14I 3I561 1USPA 1K8A2 1KD11 1K731 4HGZA 3HKZA 3H3VJ 2J6AA 1KD12 1TWAI 2YADA 1K732 1RO4A 1VQ81 1W2BZ 1VQKZ 2G2KA 4S1TA 3CQZI 1VQ8Z 3GTPI 1Q7Y1 2V8KA 1N2FA 1VQL1 3CCR1 3CMAZ 3G6EZ 3CCLZ 3IF8A 3CC4Z 1NP6A 3FQQA 3CD61 3I56Z 3F3FC 2W04A 4TNUA 4EWCA 2O53A 4CL1A 3KIFA 5T6BA 1ML8A 1RLYA 2JS4A 1KC81 2PK7A 2JNYA 2Q51A 2AKLA 4BBSI 1VQ41 1I6HI 1Z01A 4RV9A 3TDHB 2WB1A 2PMZA 5T64A 3CC7Z 3EEDA 1Q811 2M6NA 2E2II 3GCFA 2F4MA 4A93I 4MD9A 2K3RA 1M901 3OW2Y 1RO0A 1M1K2 1JWHC 2OOYB 1DL6A 3NDIA 3I4MI 1VQP1 1Q822 3VMGA 3LUSA 3JAMb 3CCQZ 4MONA 1X3ZA 4XX2A 4E2XA 2V8IA 4Y7NI 2GTIA 2KPIA 3D9XA 1VQM1 3CCRZ 1YIJZ 2VF1A 3NDJA 1Z03A 3VTNA 2R6MA 3CD6Z 1YJW1 2RIQA 3QWUA 1M902 2QRCB 4A3II 3G6E1 1TWCI 1ZB8A 2YU9I 1VQ5Z 4X6AI 1YI2Z 1NJI2 2BJOA 3I551 3RZDI 4QTUA 2VUMI 3J81b 2IZ4A 1VQ7Z 1Q821 3CC21 3G711 1TWFI 4MXUA 1VQ91 3HOYI 4E32A 3S16I 2F4OA 1X3WA 1QVGY 3NH5A 5AN9F 3G4SZ 2IZ3A 5C4XI 1YJNZ 2DE7A 2WAQA 3F3PC 2NVXI 3FQMA 4NBAA 5LL6f 2E2HI 3H0GI 4A3DI 2OOXB 1VLAA 3GTMI 1JJ2Y 2JA8I 1WCMI 4BY1I 1QVGZ 2M48A 3CCJ1 1NJI1 2W03A 4A3JI 1YUAA 3M4OI 3CCSZ 1VQ6Z 3CCQ1 3T4NB 4MD8A 1VQPZ 3VB9A 2DE6A 3CXCY 1S7MA 2QA4Z 3S2HI 1P9NA 3GKQA 1QYPA 2R93I 3J80f 1VQ4Z 1VQ71 1WW9A 2R7ZI 3EERA 4MH4A 3CPWY 2JMOA 3PO3I 3CCJZ 3K7AI 1Q812 2JA5I 3HOXI 1QF8A 3HOVI 2O4HA 2EGTA 1W2BY 5D1OB 1S721 1YI21 2HU9A 1YHQZ 3S1RI 1N8R1 2QEX1 4NBHA 4NBBA 1VQNZ 1USPB 2OTLZ 1WIIA 2DE5A 5CM2M 1LQLA 3CXCZ 4NB9A 2OZKA 3CCL1 2QREB 4BBRI 1K9M1 3HOZI 3I07A 1VQLZ 3GTQI 3GTOI 4DK1A 1TFIA 3CMEZ 2JA7I 4BXXI 3PO2I 1YIT1 2Y0SA 2NVYI 4A3LI 3TE5B 2LFUA 3CC71 3HOWI 1KQSZ 1N8R2 2NVTI 3PO3S 3NH4A 5C3EI 1TWHI 4RVFA 3CCEZ 4RVDA 2JA6I 5C44I 4A3FI 3VMIA 1Z02A 4HH4A 5FLMI 3CCMZ 3J81f 4MRIA 3CPWZ 3GTGI 3M3YI 4NB8A 3S1NI 2JUBA 3S15I 2P3YA 4MD7A 2QLVB 3GTJI 3CME1 1YITZ 3S1MI 5IP9I 1L1OC 4A3CI 2QRDB 1YJN1 2NVQI 3KIHA 4A3BI 1I3QI 5IP7I 1RQFA 4DGLA 2QEXZ 2RHBA 3Q87A 4NBFA 3MZLB 1VQO1 1K83I 1Q861 3U50C 3CMA1 3ESWA 2RT9A 5C4JI 1S72Z 2KI7B 2ZAEB 4A3EI 3GTKI 3BG0B 3NH8A 1NUIA 1Q862 3J80b 2PM9A 3MONA 2R92I 3VMHA 1RNIA 2HF1A 2V8JA 3MZKB 4BY7I 5D1PA 5IT9b 4HGYA 4DQYB 2RPRA 4Y52I 1Q7Y2 4NFRA 2JR6A 3CCS1 1K8A1 2QA41 4NOZA 5FLXb 2RBLA 3IX0A 1SFOI 4A3MI 5FLXf 4E2WA 3D6WA 2QKDA 2VUGA 3CCE1 1R9TI 2GTHA 3HOUI 4NBDA 1KRLA 4NBCA 4NH1C 1ZB9A 3S1QI 1VQN1 5T67A 3CC2Z 1I50I 3CCU1 4RS4A 1QVFY 3OW2Z 1Y1VS 3I55Z 4E30A 4A3KI 2I3CA 1YHQ1 1PFTA 2QR1B 1X0TA 3G71Z 1RO2A 1KQSY 2LIYA 2OTL1 1YIJ1 1M1K1 2Q4ZA 3FKII 3BG1B 1VQ51 2B63I 1YJWZ 1VQOZ 3GTLI 3JAMf 3CCVZ 3S2DI 4E31A 4AYBA 4NBGA 1JJ2Z 1VQK1 1VQMZ 1Y1WI 4E2YA 1K9M2 3S17I 3IFUA 4A3GI 4RVHA 1Y1VI 2GU2A 3J7A4 1ZH1A 3GTMS 4QTTA 1QVFZ 3CCM1 3CCUZ 5A2Qb 2E2JI 1YJ91 5A2Qf 4E2ZA 1KC82 3NFZA 5IT9f 2OTJ1 4NBEA 1VQ61
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCR Z;  2OTJ Z;  1YIJ Z;  3CXC Z;  3G4S 1;  3CCL 1;  1Q7Y 2;  1K9M 1;  3CD6 Z;  3CCS 1;  1YJW 1;  1M90 2;  1VQ9 Z;  1VQL Z;  1K8A 1;  3G6E 1;  3CME Z;  2QA4 1;  1YJ9 Z;  1VQ5 Z;  3CC4 1;  3CCV 1;  1YI2 Z;  1YIT 1;  1NJI 2;  3I56 1;  1K8A 2;  1KD1 1;  3I55 1;  1K73 1;  3CC7 1;  1VQ7 Z;  1Q82 1;  3CC2 1;  3G71 1;  1KQS Z;  3CCE 1;  1N8R 2;  1VQ9 1;  1KD1 2;  1QVG Y;  1K73 2;  1VQ8 1;  3CCE Z;  3G4S Z;  1W2B Z;  1VQK Z;  1YJN Z;  1VQ8 Z;  1VQ6 1;  1Q7Y 1;  1VQN 1;  3CC2 Z;  1VQL 1;  3CCR 1;  3CMA Z;  3CCU 1;  3G6E Z;  1JJ2 Y;  1QVF Y;  3CCL Z;  3OW2 Z;  3CC4 Z;  3I55 Z;  3CCM Z;  3CD6 1;  1YHQ 1;  3I56 Z;  1QVG Z;  3CCJ 1;  1NJI 1;  3CPW Z;  3G71 Z;  3CCS Z;  1KQS Y;  2OTL 1;  1VQ6 Z;  3CCQ 1;  1YIJ 1;  1M1K 1;  1VQP Z;  1KC8 1;  3CXC Y;  3CME 1;  2QA4 Z;  1YIT Z;  1VQ4 1;  1VQ5 1;  1YJW Z;  1YJN 1;  1VQO Z;  1VQ4 Z;  3CC7 Z;  1VQ7 1;  3CCV Z;  1Q81 1;  1JJ2 Z;  1VQK 1;  3CPW Y;  1VQM Z;  3CCJ Z;  1K9M 2;  1Q81 2;  1M90 1;  2QEX Z;  3OW2 Y;  1QVF Z;  1VQO 1;  3CCM 1;  1Q86 1;  3CCU Z;  1W2B Y;  3CMA 1;  1YJ9 1;  1S72 Z;  1M1K 2;  1KC8 2;  1Q86 2;  1VQP 1;  1S72 1;  1Q82 2;  1YI2 1;  3CCQ Z;  1YHQ Z;  1N8R 1;  2QEX 1;  2OTJ 1;  1VQN Z;  1VQM 1;  2OTL Z; 
#chains in the Genus database with same CATH topology
 1YUK A;  2OTJ Z;  3P5J B;  1AA6 A;  3G4S 1;  2E9H A;  2K5R A;  5D1O A;  1VQ9 Z;  4RVG A;  1TWG I;  4E33 A;  2H85 A;  1YJ9 Z;  3I4N I;  3RZO I;  3CC4 1;  3CCV 1;  2P28 A;  3S14 I;  3I56 1;  1USP A;  1K8A 2;  1KD1 1;  1K73 1;  4HGZ A;  3HKZ A;  3H3V J;  2J6A A;  1KD1 2;  1WJ2 A;  1TWA I;  2YAD A;  1K73 2;  1RO4 A;  1VQ8 1;  1W2B Z;  1VQK Z;  2G2K A;  4S1T A;  3CQZ I;  1VQ8 Z;  3GTP I;  1Q7Y 1;  2V8K A;  1N2F A;  2VPW A;  1VQL 1;  3CCR 1;  3CMA Z;  3G6E Z;  3CCL Z;  3IF8 A;  3CC4 Z;  1NP6 A;  3FQQ A;  3CD6 1;  3I56 Z;  3F3F C;  2W04 A;  4TNU A;  4EWC A;  2O53 A;  4CL1 A;  3KIF A;  2E7Z A;  5T6B A;  1ML8 A;  1RLY A;  1WZN A;  2JS4 A;  1KC8 1;  2PK7 A;  2JNY A;  2Q51 A;  2AKL A;  4BBS I;  1VQ4 1;  1I6H I;  1Z01 A;  4RV9 A;  3TDH B;  2WB1 A;  2PMZ A;  5T64 A;  3CC7 Z;  3EED A;  1Q81 1;  2M6N A;  2E2I I;  3GCF A;  2F4M A;  4A93 I;  4MD9 A;  2K3R A;  1M90 1;  3OW2 Y;  1RO0 A;  1M1K 2;  1JWH C;  2OOY B;  1DL6 A;  3NDI A;  3I4M I;  1VQP 1;  1Q82 2;  3VMG A;  3LUS A;  3JAM b;  3CCQ Z;  4MON A;  1X3Z A;  4XX2 A;  4E2X A;  2V8I A;  4Y7N I;  2GTI A;  2KPI A;  3D9X A;  1VQM 1;  3CCR Z;  1YIJ Z;  2VF1 A;  2VPY A;  3NDJ A;  1Z03 A;  1FDO A;  3VTN A;  2R6M A;  3CD6 Z;  1YJW 1;  2RIQ A;  3QWU A;  1M90 2;  2QRC B;  4A3I I;  3G6E 1;  1TWC I;  1ZB8 A;  2YU9 I;  1VQ5 Z;  4X6A I;  1YI2 Z;  1NJI 2;  2BJO A;  3I55 1;  3RZD I;  4QTU A;  2VUM I;  3J81 b;  1VQ7 Z;  2IZ4 A;  1Q82 1;  3CC2 1;  3G71 1;  1TWF I;  4MXU A;  1VQ9 1;  3HOY I;  4E32 A;  3S16 I;  2F4O A;  1X3W A;  1QVG Y;  3NH5 A;  5AN9 F;  3G4S Z;  2IZ3 A;  5C4X I;  1YJN Z;  2DE7 A;  2WAQ A;  3F3P C;  2NVX I;  3FQM A;  4NBA A;  5LL6 f;  2E2H I;  1QXF A;  3H0G I;  4A3D I;  2OOX B;  1VLA A;  3GTM I;  1JJ2 Y;  2JA8 I;  1WCM I;  2VPZ A;  4BY1 I;  1QVG Z;  2M48 A;  3CCJ 1;  1NJI 1;  2W03 A;  4A3J I;  1YUA A;  3M4O I;  3CCS Z;  1VQ6 Z;  3CCQ 1;  3T4N B;  4MD8 A;  1VQP Z;  3VB9 A;  2DE6 A;  3CXC Y;  1S7M A;  2QA4 Z;  3S2H I;  1P9N A;  3GKQ A;  1QYP A;  2R93 I;  2V45 A;  3J80 f;  1VQ4 Z;  1VQ7 1;  1WW9 A;  2R7Z I;  3EER A;  4MH4 A;  3CPW Y;  2JMO A;  3PO3 I;  3CCJ Z;  3K7A I;  1Q81 2;  2JA5 I;  3HOX I;  1QF8 A;  3HOV I;  2O4H A;  2EGT A;  1W2B Y;  5D1O B;  1S72 1;  1YI2 1;  2HU9 A;  1YHQ Z;  3S1R I;  1N8R 1;  2QEX 1;  4NBH A;  4NBB A;  1VQN Z;  1USP B;  2OTL Z;  1WII A;  2DE5 A;  5CM2 M;  1LQL A;  3CXC Z;  4NB9 A;  2OZK A;  3CCL 1;  2QRE B;  4BBR I;  1K9M 1;  3HOZ I;  3I07 A;  1VQL Z;  3GTQ I;  3GTO I;  4DK1 A;  1TFI A;  3CME Z;  2JA7 I;  4BXX I;  3PO2 I;  1YIT 1;  2Y0S A;  2NVY I;  4A3L I;  3TE5 B;  2LFU A;  3CC7 1;  3HOW I;  1KQS Z;  1N8R 2;  1FDI A;  2NVT I;  3PO3 S;  3NH4 A;  5C3E I;  3D2L A;  1TWH I;  4RVF A;  3CCE Z;  4RVD A;  2VPX A;  2JIP A;  2JA6 I;  5C44 I;  4A3F I;  3VMI A;  1Z02 A;  4HH4 A;  5FLM I;  3CCM Z;  3J81 f;  4MRI A;  2NAP A;  3CPW Z;  2AYD A;  3GTG I;  3M3Y I;  4NB8 A;  3S1N I;  2JUB A;  3S15 I;  2V3V A;  2P3Y A;  4MD7 A;  2QLV B;  3GTJ I;  3CME 1;  1YIT Z;  3S1M I;  5IP9 I;  1L1O C;  4A3C I;  2QRD B;  1YJN 1;  2JIR A;  2NVQ I;  3KIH A;  4A3B I;  1I3Q I;  5IP7 I;  2JIQ A;  1RQF A;  4DGL A;  2QEX Z;  2RHB A;  3Q87 A;  4NBF A;  3MZL B;  1VQO 1;  1K83 I;  1Q86 1;  3U50 C;  3CMA 1;  3ESW A;  2RT9 A;  5C4J I;  1S72 Z;  2KI7 B;  2ZAE B;  4A3E I;  3GTK I;  3BG0 B;  3NH8 A;  1NUI A;  1Q86 2;  3J80 b;  2PM9 A;  3MON A;  2R92 I;  3VMH A;  1RNI A;  2HF1 A;  2V8J A;  3MZK B;  4BY7 I;  5D1P A;  5IT9 b;  4HGY A;  4DQY B;  2JIM A;  2RPR A;  4Y52 I;  1Q7Y 2;  4NFR A;  2JR6 A;  3CCS 1;  1K8A 1;  2QA4 1;  4NOZ A;  5FLX b;  2RBL A;  3IX0 A;  2LEX A;  1SFO I;  4A3M I;  5FLX f;  4E2W A;  1Q16 A;  3D6W A;  2QKD A;  2VUG A;  2IV2 X;  3CCE 1;  1R9T I;  2GTH A;  3HOU I;  3IR7 A;  2JIO A;  4NBD A;  1KRL A;  4NBC A;  4NH1 C;  1ZB9 A;  3S1Q I;  1VQN 1;  5T67 A;  3CC2 Z;  1I50 I;  3CCU 1;  4RS4 A;  1QVF Y;  1Y8C A;  3OW2 Z;  1Y1V S;  3I55 Z;  4E30 A;  4A3K I;  2I3C A;  1YHQ 1;  1PFT A;  2QR1 B;  1X0T A;  3G71 Z;  1RO2 A;  1KQS Y;  2LIY A;  2OTL 1;  1SIW A;  1YIJ 1;  1M1K 1;  2Q4Z A;  3FKI I;  3BG1 B;  1VQ5 1;  2B63 I;  1YJW Z;  1VQO Z;  3GTL I;  3JAM f;  3CCV Z;  3S2D I;  4E31 A;  4AYB A;  4NBG A;  1JJ2 Z;  1VQK 1;  1VQM Z;  1Y1W I;  4E2Y A;  1K9M 2;  3S17 I;  3IFU A;  4A3G I;  4RVH A;  1Y1V I;  2GU2 A;  3J7A 4;  1ZH1 A;  3GTM S;  4QTT A;  1QVF Z;  3CCM 1;  3CCU Z;  5A2Q b;  2E2J I;  1YJ9 1;  5A2Q f;  4E2Z A;  1KC8 2;  3NFZ A;  5IT9 f;  2OTJ 1;  4NBE A;  1VQ6 1; 
#chains in the Genus database with same CATH homology
 1YUK A;  2OTJ Z;  3P5J B;  3G4S 1;  2E9H A;  2K5R A;  5D1O A;  1VQ9 Z;  4RVG A;  1TWG I;  4E33 A;  2H85 A;  1YJ9 Z;  3I4N I;  3RZO I;  3CC4 1;  3CCV 1;  2P28 A;  3S14 I;  3I56 1;  1USP A;  1K8A 2;  1KD1 1;  1K73 1;  4HGZ A;  3HKZ A;  3H3V J;  2J6A A;  1KD1 2;  1TWA I;  2YAD A;  1K73 2;  1RO4 A;  1VQ8 1;  1W2B Z;  1VQK Z;  2G2K A;  4S1T A;  3CQZ I;  1VQ8 Z;  3GTP I;  1Q7Y 1;  2V8K A;  1N2F A;  1VQL 1;  3CCR 1;  3CMA Z;  3G6E Z;  3CCL Z;  3IF8 A;  3CC4 Z;  1NP6 A;  3FQQ A;  3CD6 1;  3I56 Z;  3F3F C;  2W04 A;  4TNU A;  4EWC A;  2O53 A;  4CL1 A;  3KIF A;  5T6B A;  1ML8 A;  1RLY A;  2JS4 A;  1KC8 1;  2PK7 A;  2JNY A;  2Q51 A;  2AKL A;  4BBS I;  1VQ4 1;  1I6H I;  1Z01 A;  4RV9 A;  3TDH B;  2WB1 A;  2PMZ A;  5T64 A;  3CC7 Z;  3EED A;  1Q81 1;  2M6N A;  2E2I I;  3GCF A;  2F4M A;  4A93 I;  4MD9 A;  2K3R A;  1M90 1;  3OW2 Y;  1RO0 A;  1M1K 2;  1JWH C;  2OOY B;  1DL6 A;  3NDI A;  3I4M I;  1VQP 1;  1Q82 2;  3VMG A;  3LUS A;  3JAM b;  3CCQ Z;  4MON A;  1X3Z A;  4XX2 A;  4E2X A;  2V8I A;  4Y7N I;  2GTI A;  2KPI A;  3D9X A;  1VQM 1;  3CCR Z;  1YIJ Z;  2VF1 A;  3NDJ A;  1Z03 A;  3VTN A;  2R6M A;  3CD6 Z;  1YJW 1;  2RIQ A;  3QWU A;  1M90 2;  2QRC B;  4A3I I;  3G6E 1;  1TWC I;  1ZB8 A;  2YU9 I;  1VQ5 Z;  4X6A I;  1YI2 Z;  1NJI 2;  2BJO A;  3I55 1;  3RZD I;  4QTU A;  2VUM I;  3J81 b;  2IZ4 A;  1VQ7 Z;  1Q82 1;  3CC2 1;  3G71 1;  1TWF I;  4MXU A;  1VQ9 1;  3HOY I;  4E32 A;  3S16 I;  2F4O A;  1X3W A;  1QVG Y;  3NH5 A;  5AN9 F;  3G4S Z;  2IZ3 A;  5C4X I;  1YJN Z;  2DE7 A;  2WAQ A;  3F3P C;  2NVX I;  3FQM A;  4NBA A;  5LL6 f;  2E2H I;  3H0G I;  4A3D I;  2OOX B;  1VLA A;  3GTM I;  1JJ2 Y;  2JA8 I;  1WCM I;  4BY1 I;  1QVG Z;  2M48 A;  3CCJ 1;  1NJI 1;  2W03 A;  4A3J I;  1YUA A;  3M4O I;  3CCS Z;  1VQ6 Z;  3CCQ 1;  3T4N B;  4MD8 A;  1VQP Z;  3VB9 A;  2DE6 A;  3CXC Y;  1S7M A;  2QA4 Z;  3S2H I;  1P9N A;  3GKQ A;  1QYP A;  2R93 I;  3J80 f;  1VQ4 Z;  1VQ7 1;  1WW9 A;  2R7Z I;  3EER A;  4MH4 A;  3CPW Y;  2JMO A;  3PO3 I;  3CCJ Z;  3K7A I;  1Q81 2;  2JA5 I;  3HOX I;  1QF8 A;  3HOV I;  2O4H A;  2EGT A;  1W2B Y;  5D1O B;  1S72 1;  1YI2 1;  2HU9 A;  1YHQ Z;  3S1R I;  1N8R 1;  2QEX 1;  4NBH A;  4NBB A;  1VQN Z;  1USP B;  2OTL Z;  1WII A;  2DE5 A;  5CM2 M;  1LQL A;  3CXC Z;  4NB9 A;  2OZK A;  3CCL 1;  2QRE B;  4BBR I;  1K9M 1;  3HOZ I;  3I07 A;  1VQL Z;  3GTQ I;  3GTO I;  4DK1 A;  1TFI A;  3CME Z;  2JA7 I;  4BXX I;  3PO2 I;  1YIT 1;  2Y0S A;  2NVY I;  4A3L I;  3TE5 B;  2LFU A;  3CC7 1;  3HOW I;  1KQS Z;  1N8R 2;  2NVT I;  3PO3 S;  3NH4 A;  5C3E I;  1TWH I;  4RVF A;  3CCE Z;  4RVD A;  2JA6 I;  5C44 I;  4A3F I;  3VMI A;  1Z02 A;  4HH4 A;  5FLM I;  3CCM Z;  3J81 f;  4MRI A;  3CPW Z;  3GTG I;  3M3Y I;  4NB8 A;  3S1N I;  2JUB A;  3S15 I;  2P3Y A;  4MD7 A;  2QLV B;  3GTJ I;  3CME 1;  1YIT Z;  3S1M I;  5IP9 I;  1L1O C;  4A3C I;  2QRD B;  1YJN 1;  2NVQ I;  3KIH A;  4A3B I;  1I3Q I;  5IP7 I;  1RQF A;  4DGL A;  2QEX Z;  2RHB A;  3Q87 A;  4NBF A;  3MZL B;  1VQO 1;  1K83 I;  1Q86 1;  3U50 C;  3CMA 1;  3ESW A;  2RT9 A;  5C4J I;  1S72 Z;  2KI7 B;  2ZAE B;  4A3E I;  3GTK I;  3BG0 B;  3NH8 A;  1NUI A;  1Q86 2;  3J80 b;  2PM9 A;  3MON A;  2R92 I;  3VMH A;  1RNI A;  2HF1 A;  2V8J A;  3MZK B;  4BY7 I;  5D1P A;  5IT9 b;  4HGY A;  4DQY B;  2RPR A;  4Y52 I;  1Q7Y 2;  4NFR A;  2JR6 A;  3CCS 1;  1K8A 1;  2QA4 1;  4NOZ A;  5FLX b;  2RBL A;  3IX0 A;  1SFO I;  4A3M I;  5FLX f;  4E2W A;  3D6W A;  2QKD A;  2VUG A;  3CCE 1;  1R9T I;  2GTH A;  3HOU I;  4NBD A;  1KRL A;  4NBC A;  4NH1 C;  1ZB9 A;  3S1Q I;  1VQN 1;  5T67 A;  3CC2 Z;  1I50 I;  3CCU 1;  4RS4 A;  1QVF Y;  3OW2 Z;  1Y1V S;  3I55 Z;  4E30 A;  4A3K I;  2I3C A;  1YHQ 1;  1PFT A;  2QR1 B;  1X0T A;  3G71 Z;  1RO2 A;  1KQS Y;  2LIY A;  2OTL 1;  1YIJ 1;  1M1K 1;  2Q4Z A;  3FKI I;  3BG1 B;  1VQ5 1;  2B63 I;  1YJW Z;  1VQO Z;  3GTL I;  3JAM f;  3CCV Z;  3S2D I;  4E31 A;  4AYB A;  4NBG A;  1JJ2 Z;  1VQK 1;  1VQM Z;  1Y1W I;  4E2Y A;  1K9M 2;  3S17 I;  3IFU A;  4A3G I;  4RVH A;  1Y1V I;  2GU2 A;  3J7A 4;  1ZH1 A;  3GTM S;  4QTT A;  1QVF Z;  3CCM 1;  3CCU Z;  5A2Q b;  2E2J I;  1YJ9 1;  5A2Q f;  4E2Z A;  1KC8 2;  3NFZ A;  5IT9 f;  2OTJ 1;  4NBE A;  1VQ6 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...