1KQSZ

The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title A pre-translocational intermediate in protein synthesis observed in crystals of enzymatically active 50S subunits.
pubmed rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2002-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1kqsZ00
3CCS1 1YIJZ 3CCJ1 1JJ2Z 3CCVZ 1Q861 1VQM1 3CCJZ 3CCQ1 1VQ5Z 1N8R2 3CC21 1VQMZ 3I551 3CCQZ 3CD61 1YJN1 1VQKZ 2OTL1 3CC2Z 3OW2Z 1K731 1S721 3CC71 1M1K1 3CCRZ 1YJNZ 1VQ41 2OTLZ 1Q862 1QVGZ 2QA41 1Q811 1S72Z 2OTJZ 1Q822 1VQ4Z 1YJ91 1W2BZ 3CMA1 1Q7Y1 1K9M1 3CCU1 1YJ9Z 3CMAZ 3CCSZ 1K732 1KD11 1VQP1 1KC81 1YJW1 1Q812 1VQPZ 1VQ91 1NJI1 1JJ2Y 1M901 1Q7Y2 1K9M2 3G4S1 1VQ9Z 3I55Z 3CD6Z 1KD12 3CC7Z 3CPWZ 1YHQ1 2QA4Z 3OW2Y 1VQ71 1YIT1 1NJI2 1M902 1QVFZ 1QVGY 1VQ7Z 1M1K2 3CCUZ 1VQ81 3CC41 1W2BY 1YI21 1KQSZ 3G711 1VQ8Z 3CC4Z 1VQN1 3CXCZ 1QVFY 3CCL1 1YJWZ 3G71Z 1N8R1 3CCE1 1K8A1 3CCV1 2QEX1 3G4SZ 3CCEZ 3CXCY 3I561 1KC82 1VQ51 2QEXZ 3G6E1 3CCM1 1YHQZ 3I56Z 1Q821 1VQK1 3CME1 3G6EZ 3CCMZ 1YITZ 1K8A2 3CPWY 3CCR1 3CMEZ 1VQO1 2OTJ1 1VQL1 1VQ61 1VQOZ 1YI2Z 1VQLZ 1VQ6Z 1VQNZ 1YIJ1 3CCLZ 1KQSY
chains in the Genus database with same CATH superfamily
3EERA 4E33A 3CCS1 2PK7A 2F4MA 3CCJ1 1JJ2Z 3CCVZ 3M4OI 1Q861 1DL6A 4XX2A 3LUSA 3FQMA 3CCQ1 2LEXA 4E2YA 3CC21 1ML8A 1RO4A 2E2II 1R9TI 3GTQI 4QTTA 3VMHA 4NBEA 3GTLI 4QTUA 1YJNZ 2RT9A 4NBGA 2DE6A 2OTJZ 4MRIA 3I07A 1VQ4Z 4A93I 1W2BZ 3CMA1 2V8IA 2QLVB 1K9M1 2R92I 1YJ9Z 2JA6I 1KD11 2V3VA 5IT9f 1TWGI 1Q812 1VQPZ 4BBSI 1WCMI 1AA6A 1VQ91 1Y1VI 5CM2M 1JJ2Y 1M901 1Q7Y2 3P5JB 2F4OA 5T64A 1ZB8A 1YHQ1 1PFTA 4A3CI 4HGYA 2EGTA 4E32A 1NJI2 3BG1B 2P28A 5FLMI 2QR1B 1M1K2 2ZAEB 3CQZI 3GTJI 3VTNA 4BY7I 1W2BY 2RBLA 1YI21 1KQSZ 3G711 2GTIA 2NAPA 2I3CA 3GTMI 1YJWZ 2IZ4A 1RO2A 3HOYI 1X3ZA 2Q4ZA 2R7ZI 3G4SZ 1I50I 4Y7NI 4E30A 3CXCY 1L1OC 2B63I 2JR6A 1LQLA 3IX0A 1Y8CA 1TWHI 1VQK1 1X3WA 3CME1 3G6EZ 3CCMZ 2AYDA 5T67A 1YITZ 4HGZA 3GTOI 1YUKA 2LFUA 1S7MA 3IF8A 3FQQA 1VQ61 3NH5A 4A3II 2E2JI 1VQNZ 1YUAA 1KQSY 1I3QI 4NBHA 2NVXI 2J6AA 2NVYI 1YIJZ 4NFRA 3KIHA 4A3FI 3CCJZ 3HOVI 1FDOA 2VPWA 1N8R2 2OOXB 2LIYA 3I551 3CCQZ 2WB1A 3CD61 2OTL1 3CC2Z 1K731 4RVGA 3VMGA 1M1K1 3EEDA 3H3VJ 1QVGZ 2QA41 4MD9A 3JAMb 1Z03A 2JIPA 3GKQA 1WIIA 1WZNA 5D1OB 4X6AI 1P9NA 2K5RA 3H0GI 3J7A4 3TDHB 3CMAZ 3IFUA 2YU9I 3MZKB 2K3RA 5C4JI 2JIQA 2VPZA 1VQ9Z 2WAQA 4BBRI 3S2DI 3CC7Z 1QXFA 3GTMS 1USPB 2JS4A 1VQ71 4RS4A 4DK1A 1QVGY 1ZH1A 3CCUZ 5AN9F 1VQ81 4MD7A 2R6MA 2PM9A 5C3EI 3CXCZ 1QVFY 3CCL1 2IV2X 3G71Z 1N8R1 2JIMA 4S1TA 3CCE1 3I4MI 3HOXI 1Q16A 3CCV1 1FDIA 3U50C 2V8KA 1KC82 1Z02A 4NB9A 4MH4A 5D1OA 2VPXA 1K8A2 4A3EI 2W04A 1Y1WI 2E2HI 3CMEZ 1VQO1 3S17I 3S1QI 2OTJ1 1Z01A 4NBBA 2VUMI 1RLYA 1QYPA 1VQ6Z 4EWCA 2HU9A 2GU2A 3M3YI 2JIOA 1USPA 2M6NA 4A3DI 3F3PC 1N2FA 2AKLA 1VQM1 3JAMf 2R93I 5LL6f 1VQ5Z 2DE7A 4MONA 5C4XI 1S721 3CCRZ 2E9HA 2OTLZ 1Q862 1RQFA 1Q811 1RNIA 4A3GI 1ZB9A 1Q7Y1 3NDJA 1NP6A 1WW9A 4NBAA 4NH1C 2YADA 1QF8A 3S1NI 3CCSZ 4HH4A 2V8JA 4A3KI 2QKDA 2W03A 1YJW1 1KC81 4DGLA 2O53A 2M48A 3GCFA 2O4HA 3NH8A 1NJI1 1K9M2 5T6BA 3PO3S 4A3LI 3G4S1 1KD12 3CPWZ 4NBCA 3HOUI 2JA8I 1YIT1 2NVTI 1M902 1QVFZ 4MD8A 3GTPI 2VPYA 1VQ7Z 1TFIA 3CC41 5A2Qb 3J80b 3HOZI 2JMOA 1VQ8Z 2NVQI 3VB9A 1VQN1 2HF1A 2RPRA 2JIRA 2QREB 3D9XA 2QEX1 5FLXb 3CCEZ 3HKZA 3QWUA 4NB8A 4CL1A 3I561 2BJOA 4NOZA 4E2ZA 1TWFI 1YHQZ 3PO3I 3CPWY 2P3YA 2RHBA 3FKII 3F3FC 2QRDB 4NBDA 3MZLB 4A3MI 1VQL1 1WJ2A 2GTHA 1VQOZ 1YI2Z 2H85A 4BXXI 3PO2I 2Y0SA 3S1RI 4AYBA 3NDIA 2VF1A 4Y52I 3ESWA 1SFOI 1VQMZ 2QRCB 3RZOI 4A3BI 1YJN1 1VQKZ 3D6WA 3OW2Z 3CC71 2RIQA 1VQ41 2OZKA 1K83I 1S72Z 3TE5B 2KPIA 1Q822 3GTKI 1YJ91 3HOWI 1VLAA 4RVHA 3CCU1 3S16I 1K732 3S14I 3S2HI 2E7ZA 2G2KA 1VQP1 1X0TA 5D1PA 1I6HI 3J81f 1JWHC 3S1MI 4TNUA 3I55Z 3CD6Z 1TWAI 3IR7A 5A2Qf 3J80f 2PMZA 5IT9b 2Q51A 1SIWA 3D2LA 2VUGA 3K7AI 2QA4Z 3OW2Y 3NFZA 2KI7B 1KRLA 4DQYB 5C44I 3Q87A 5FLXf 3NH4A 2JA7I 4RVDA 2JUBA 4E2XA 3CC4Z 3T4NB 2V45A 4E2WA 3BG0B 4NBFA 1K8A1 2IZ3A 1RO0A 1TWCI 4A3JI 1VQ51 2QEXZ 3G6E1 3CCM1 4RVFA 3J81b 3MONA 3I56Z 3VMIA 2JNYA 1Q821 3RZDI 3I4NI 1NUIA 2OOYB 5IP9I 4RV9A 3CCR1 3S15I 4MXUA 2JA5I 2DE5A 3KIFA 5IP7I 4E31A 1VQLZ 4BY1I 1Y1VS 3GTGI 1YIJ1 3CCLZ
chains in the Genus database with same CATH topology
3EERA 4E33A 3CCS1 2PK7A 2F4MA 3CCJ1 1JJ2Z 3CCVZ 3M4OI 1Q861 1DL6A 4XX2A 3LUSA 3FQMA 3CCQ1 4E2YA 3CC21 1ML8A 1RO4A 2E2II 1R9TI 3GTQI 4QTTA 3VMHA 4NBEA 3GTLI 4QTUA 1YJNZ 2RT9A 4NBGA 2DE6A 2OTJZ 4MRIA 3I07A 1VQ4Z 4A93I 1W2BZ 3CMA1 2V8IA 2QLVB 1K9M1 2R92I 1YJ9Z 2JA6I 1KD11 5IT9f 1TWGI 1Q812 1VQPZ 4BBSI 1WCMI 1VQ91 1Y1VI 5CM2M 1JJ2Y 1M901 1Q7Y2 3P5JB 2F4OA 5T64A 1ZB8A 1YHQ1 1PFTA 4A3CI 4HGYA 2EGTA 4E32A 1NJI2 3BG1B 2P28A 5FLMI 2QR1B 1M1K2 2ZAEB 3CQZI 3GTJI 3VTNA 4BY7I 1W2BY 2RBLA 1YI21 1KQSZ 3G711 2GTIA 2I3CA 3GTMI 1YJWZ 2IZ4A 1RO2A 3HOYI 1X3ZA 2Q4ZA 2R7ZI 3G4SZ 1I50I 4Y7NI 4E30A 3CXCY 1L1OC 2B63I 2JR6A 1LQLA 3IX0A 1TWHI 1VQK1 1X3WA 3CME1 3G6EZ 3CCMZ 5T67A 1YITZ 4HGZA 3GTOI 1YUKA 2LFUA 1S7MA 3IF8A 3FQQA 1VQ61 3NH5A 4A3II 2E2JI 1VQNZ 1YUAA 1KQSY 1I3QI 4NBHA 2NVXI 2J6AA 2NVYI 1YIJZ 4NFRA 3KIHA 4A3FI 3CCJZ 3HOVI 1N8R2 2OOXB 2LIYA 3I551 3CCQZ 2WB1A 3CD61 2OTL1 3CC2Z 1K731 4RVGA 3VMGA 1M1K1 3EEDA 3H3VJ 1QVGZ 2QA41 4MD9A 3JAMb 1Z03A 3GKQA 1WIIA 5D1OB 4X6AI 1P9NA 2K5RA 3H0GI 3J7A4 3TDHB 3CMAZ 3IFUA 2YU9I 3MZKB 2K3RA 5C4JI 1VQ9Z 2WAQA 4BBRI 3S2DI 3CC7Z 3GTMS 1USPB 2JS4A 1VQ71 4RS4A 4DK1A 1QVGY 1ZH1A 3CCUZ 5AN9F 1VQ81 4MD7A 2R6MA 2PM9A 5C3EI 3CXCZ 1QVFY 3CCL1 3G71Z 1N8R1 4S1TA 3CCE1 3I4MI 3HOXI 3CCV1 3U50C 2V8KA 1KC82 1Z02A 4NB9A 4MH4A 5D1OA 1K8A2 4A3EI 2W04A 1Y1WI 2E2HI 3CMEZ 1VQO1 3S17I 3S1QI 2OTJ1 1Z01A 4NBBA 2VUMI 1RLYA 1QYPA 1VQ6Z 4EWCA 2HU9A 2GU2A 3M3YI 1USPA 2M6NA 4A3DI 3F3PC 1N2FA 2AKLA 1VQM1 3JAMf 2R93I 5LL6f 1VQ5Z 2DE7A 4MONA 5C4XI 1S721 3CCRZ 2E9HA 2OTLZ 1Q862 1RQFA 1Q811 1RNIA 4A3GI 1ZB9A 1Q7Y1 3NDJA 1NP6A 1WW9A 4NBAA 4NH1C 2YADA 1QF8A 3S1NI 3CCSZ 4HH4A 2V8JA 4A3KI 2QKDA 2W03A 1YJW1 1KC81 4DGLA 2O53A 2M48A 3GCFA 2O4HA 3NH8A 1NJI1 1K9M2 5T6BA 3PO3S 4A3LI 3G4S1 1KD12 3CPWZ 4NBCA 3HOUI 2JA8I 1YIT1 2NVTI 1M902 1QVFZ 4MD8A 3GTPI 1VQ7Z 1TFIA 3CC41 5A2Qb 3J80b 3HOZI 2JMOA 1VQ8Z 2NVQI 3VB9A 1VQN1 2HF1A 2RPRA 2QREB 3D9XA 2QEX1 5FLXb 3CCEZ 3HKZA 3QWUA 4NB8A 4CL1A 3I561 2BJOA 4NOZA 4E2ZA 1TWFI 1YHQZ 3PO3I 3CPWY 2P3YA 2RHBA 3FKII 3F3FC 2QRDB 4NBDA 3MZLB 4A3MI 1VQL1 2GTHA 1VQOZ 1YI2Z 2H85A 4BXXI 3PO2I 2Y0SA 3S1RI 4AYBA 3NDIA 2VF1A 4Y52I 3ESWA 1SFOI 1VQMZ 2QRCB 3RZOI 4A3BI 1YJN1 1VQKZ 3D6WA 3OW2Z 3CC71 2RIQA 1VQ41 2OZKA 1K83I 1S72Z 3TE5B 2KPIA 1Q822 3GTKI 1YJ91 3HOWI 1VLAA 4RVHA 3CCU1 3S16I 1K732 3S14I 3S2HI 2G2KA 1VQP1 1X0TA 5D1PA 1I6HI 3J81f 1JWHC 3S1MI 4TNUA 3I55Z 3CD6Z 1TWAI 5A2Qf 3J80f 2PMZA 5IT9b 2Q51A 2VUGA 3K7AI 2QA4Z 3OW2Y 3NFZA 2KI7B 1KRLA 4DQYB 5C44I 3Q87A 5FLXf 3NH4A 2JA7I 4RVDA 2JUBA 4E2XA 3CC4Z 3T4NB 4E2WA 3BG0B 4NBFA 1K8A1 2IZ3A 1RO0A 1TWCI 4A3JI 1VQ51 2QEXZ 3G6E1 3CCM1 4RVFA 3J81b 3MONA 3I56Z 3VMIA 2JNYA 1Q821 3RZDI 3I4NI 1NUIA 2OOYB 5IP9I 4RV9A 3CCR1 3S15I 4MXUA 2JA5I 2DE5A 3KIFA 5IP7I 4E31A 1VQLZ 4BY1I 1Y1VS 3GTGI 1YIJ1 3CCLZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCS 1;  1YIJ Z;  3CCJ 1;  1JJ2 Z;  3CCV Z;  1Q86 1;  1VQM 1;  3CCJ Z;  3CCQ 1;  1VQ5 Z;  1N8R 2;  3CC2 1;  1VQM Z;  3I55 1;  3CCQ Z;  3CD6 1;  1YJN 1;  1VQK Z;  2OTL 1;  3CC2 Z;  3OW2 Z;  1K73 1;  1S72 1;  3CC7 1;  1M1K 1;  3CCR Z;  1YJN Z;  1VQ4 1;  2OTL Z;  1Q86 2;  1QVG Z;  2QA4 1;  1Q81 1;  1S72 Z;  2OTJ Z;  1Q82 2;  1VQ4 Z;  1YJ9 1;  1W2B Z;  3CMA 1;  1Q7Y 1;  1K9M 1;  3CCU 1;  1YJ9 Z;  3CMA Z;  3CCS Z;  1K73 2;  1KD1 1;  1VQP 1;  1KC8 1;  1YJW 1;  1Q81 2;  1VQP Z;  1VQ9 1;  1NJI 1;  1JJ2 Y;  1M90 1;  1Q7Y 2;  1K9M 2;  3G4S 1;  1VQ9 Z;  3I55 Z;  3CD6 Z;  1KD1 2;  3CC7 Z;  3CPW Z;  1YHQ 1;  2QA4 Z;  3OW2 Y;  1VQ7 1;  1YIT 1;  1NJI 2;  1M90 2;  1QVF Z;  1QVG Y;  1VQ7 Z;  1M1K 2;  3CCU Z;  1VQ8 1;  3CC4 1;  1W2B Y;  1YI2 1;  1KQS Z;  3G71 1;  1VQ8 Z;  3CC4 Z;  1VQN 1;  3CXC Z;  1QVF Y;  3CCL 1;  1YJW Z;  3G71 Z;  1N8R 1;  3CCE 1;  1K8A 1;  3CCV 1;  2QEX 1;  3G4S Z;  3CCE Z;  3CXC Y;  3I56 1;  1KC8 2;  1VQ5 1;  2QEX Z;  3G6E 1;  3CCM 1;  1YHQ Z;  3I56 Z;  1Q82 1;  1VQK 1;  3CME 1;  3G6E Z;  3CCM Z;  1YIT Z;  1K8A 2;  3CPW Y;  3CCR 1;  3CME Z;  1VQO 1;  2OTJ 1;  1VQL 1;  1VQ6 1;  1VQO Z;  1YI2 Z;  1VQL Z;  1VQ6 Z;  1VQN Z;  1YIJ 1;  3CCL Z;  1KQS Y; 
#chains in the Genus database with same CATH topology
 3EER A;  4E33 A;  3CCS 1;  2PK7 A;  2F4M A;  3CCJ 1;  1JJ2 Z;  3CCV Z;  3M4O I;  1Q86 1;  1DL6 A;  4XX2 A;  3LUS A;  3FQM A;  3CCQ 1;  2LEX A;  4E2Y A;  3CC2 1;  1ML8 A;  1RO4 A;  2E2I I;  1R9T I;  3GTQ I;  4QTT A;  3VMH A;  4NBE A;  3GTL I;  4QTU A;  1YJN Z;  2RT9 A;  4NBG A;  2DE6 A;  2OTJ Z;  4MRI A;  3I07 A;  1VQ4 Z;  4A93 I;  1W2B Z;  3CMA 1;  2V8I A;  2QLV B;  1K9M 1;  2R92 I;  1YJ9 Z;  2JA6 I;  1KD1 1;  2V3V A;  5IT9 f;  1TWG I;  1Q81 2;  1VQP Z;  4BBS I;  1WCM I;  1AA6 A;  1VQ9 1;  1Y1V I;  5CM2 M;  1JJ2 Y;  1M90 1;  1Q7Y 2;  3P5J B;  2F4O A;  5T64 A;  1ZB8 A;  1YHQ 1;  1PFT A;  4A3C I;  4HGY A;  2EGT A;  4E32 A;  1NJI 2;  3BG1 B;  2P28 A;  5FLM I;  2QR1 B;  1M1K 2;  2ZAE B;  3CQZ I;  3GTJ I;  3VTN A;  4BY7 I;  1W2B Y;  2RBL A;  1YI2 1;  1KQS Z;  3G71 1;  2GTI A;  2NAP A;  2I3C A;  3GTM I;  1YJW Z;  2IZ4 A;  1RO2 A;  3HOY I;  1X3Z A;  2Q4Z A;  2R7Z I;  3G4S Z;  1I50 I;  4Y7N I;  4E30 A;  3CXC Y;  1L1O C;  2B63 I;  2JR6 A;  1LQL A;  3IX0 A;  1Y8C A;  1TWH I;  1VQK 1;  1X3W A;  3CME 1;  3G6E Z;  3CCM Z;  2AYD A;  5T67 A;  1YIT Z;  4HGZ A;  3GTO I;  1YUK A;  2LFU A;  1S7M A;  3IF8 A;  3FQQ A;  1VQ6 1;  3NH5 A;  4A3I I;  2E2J I;  1VQN Z;  1YUA A;  1KQS Y;  1I3Q I;  4NBH A;  2NVX I;  2J6A A;  2NVY I;  1YIJ Z;  4NFR A;  3KIH A;  4A3F I;  3CCJ Z;  3HOV I;  1FDO A;  2VPW A;  1N8R 2;  2OOX B;  2LIY A;  3I55 1;  3CCQ Z;  2WB1 A;  3CD6 1;  2OTL 1;  3CC2 Z;  1K73 1;  4RVG A;  3VMG A;  1M1K 1;  3EED A;  3H3V J;  1QVG Z;  2QA4 1;  4MD9 A;  3JAM b;  1Z03 A;  2JIP A;  3GKQ A;  1WII A;  1WZN A;  5D1O B;  4X6A I;  1P9N A;  2K5R A;  3H0G I;  3J7A 4;  3TDH B;  3CMA Z;  3IFU A;  2YU9 I;  3MZK B;  2K3R A;  5C4J I;  2JIQ A;  2VPZ A;  1VQ9 Z;  2WAQ A;  4BBR I;  3S2D I;  3CC7 Z;  1QXF A;  3GTM S;  1USP B;  2JS4 A;  1VQ7 1;  4RS4 A;  4DK1 A;  1QVG Y;  1ZH1 A;  3CCU Z;  5AN9 F;  1VQ8 1;  4MD7 A;  2R6M A;  2PM9 A;  5C3E I;  3CXC Z;  1QVF Y;  3CCL 1;  2IV2 X;  3G71 Z;  1N8R 1;  2JIM A;  4S1T A;  3CCE 1;  3I4M I;  3HOX I;  1Q16 A;  3CCV 1;  1FDI A;  3U50 C;  2V8K A;  1KC8 2;  1Z02 A;  4NB9 A;  4MH4 A;  5D1O A;  2VPX A;  1K8A 2;  4A3E I;  2W04 A;  1Y1W I;  2E2H I;  3CME Z;  1VQO 1;  3S17 I;  3S1Q I;  2OTJ 1;  1Z01 A;  4NBB A;  2VUM I;  1RLY A;  1QYP A;  1VQ6 Z;  4EWC A;  2HU9 A;  2GU2 A;  3M3Y I;  2JIO A;  1USP A;  2M6N A;  4A3D I;  3F3P C;  1N2F A;  2AKL A;  1VQM 1;  3JAM f;  2R93 I;  5LL6 f;  1VQ5 Z;  2DE7 A;  4MON A;  5C4X I;  1S72 1;  3CCR Z;  2E9H A;  2OTL Z;  1Q86 2;  1RQF A;  1Q81 1;  1RNI A;  4A3G I;  1ZB9 A;  1Q7Y 1;  3NDJ A;  1NP6 A;  1WW9 A;  4NBA A;  4NH1 C;  2YAD A;  1QF8 A;  3S1N I;  3CCS Z;  4HH4 A;  2V8J A;  4A3K I;  2QKD A;  2W03 A;  1YJW 1;  1KC8 1;  4DGL A;  2O53 A;  2M48 A;  3GCF A;  2O4H A;  3NH8 A;  1NJI 1;  1K9M 2;  5T6B A;  3PO3 S;  4A3L I;  3G4S 1;  1KD1 2;  3CPW Z;  4NBC A;  3HOU I;  2JA8 I;  1YIT 1;  2NVT I;  1M90 2;  1QVF Z;  4MD8 A;  3GTP I;  2VPY A;  1VQ7 Z;  1TFI A;  3CC4 1;  5A2Q b;  3J80 b;  3HOZ I;  2JMO A;  1VQ8 Z;  2NVQ I;  3VB9 A;  1VQN 1;  2HF1 A;  2RPR A;  2JIR A;  2QRE B;  3D9X A;  2QEX 1;  5FLX b;  3CCE Z;  3HKZ A;  3QWU A;  4NB8 A;  4CL1 A;  3I56 1;  2BJO A;  4NOZ A;  4E2Z A;  1TWF I;  1YHQ Z;  3PO3 I;  3CPW Y;  2P3Y A;  2RHB A;  3FKI I;  3F3F C;  2QRD B;  4NBD A;  3MZL B;  4A3M I;  1VQL 1;  1WJ2 A;  2GTH A;  1VQO Z;  1YI2 Z;  2H85 A;  4BXX I;  3PO2 I;  2Y0S A;  3S1R I;  4AYB A;  3NDI A;  2VF1 A;  4Y52 I;  3ESW A;  1SFO I;  1VQM Z;  2QRC B;  3RZO I;  4A3B I;  1YJN 1;  1VQK Z;  3D6W A;  3OW2 Z;  3CC7 1;  2RIQ A;  1VQ4 1;  2OZK A;  1K83 I;  1S72 Z;  3TE5 B;  2KPI A;  1Q82 2;  3GTK I;  1YJ9 1;  3HOW I;  1VLA A;  4RVH A;  3CCU 1;  3S16 I;  1K73 2;  3S14 I;  3S2H I;  2E7Z A;  2G2K A;  1VQP 1;  1X0T A;  5D1P A;  1I6H I;  3J81 f;  1JWH C;  3S1M I;  4TNU A;  3I55 Z;  3CD6 Z;  1TWA I;  3IR7 A;  5A2Q f;  3J80 f;  2PMZ A;  5IT9 b;  2Q51 A;  1SIW A;  3D2L A;  2VUG A;  3K7A I;  2QA4 Z;  3OW2 Y;  3NFZ A;  2KI7 B;  1KRL A;  4DQY B;  5C44 I;  3Q87 A;  5FLX f;  3NH4 A;  2JA7 I;  4RVD A;  2JUB A;  4E2X A;  3CC4 Z;  3T4N B;  2V45 A;  4E2W A;  3BG0 B;  4NBF A;  1K8A 1;  2IZ3 A;  1RO0 A;  1TWC I;  4A3J I;  1VQ5 1;  2QEX Z;  3G6E 1;  3CCM 1;  4RVF A;  3J81 b;  3MON A;  3I56 Z;  3VMI A;  2JNY A;  1Q82 1;  3RZD I;  3I4N I;  1NUI A;  2OOY B;  5IP9 I;  4RV9 A;  3CCR 1;  3S15 I;  4MXU A;  2JA5 I;  2DE5 A;  3KIF A;  5IP7 I;  4E31 A;  1VQL Z;  4BY1 I;  1Y1V S;  3GTG I;  1YIJ 1;  3CCL Z; 
#chains in the Genus database with same CATH homology
 3EER A;  4E33 A;  3CCS 1;  2PK7 A;  2F4M A;  3CCJ 1;  1JJ2 Z;  3CCV Z;  3M4O I;  1Q86 1;  1DL6 A;  4XX2 A;  3LUS A;  3FQM A;  3CCQ 1;  4E2Y A;  3CC2 1;  1ML8 A;  1RO4 A;  2E2I I;  1R9T I;  3GTQ I;  4QTT A;  3VMH A;  4NBE A;  3GTL I;  4QTU A;  1YJN Z;  2RT9 A;  4NBG A;  2DE6 A;  2OTJ Z;  4MRI A;  3I07 A;  1VQ4 Z;  4A93 I;  1W2B Z;  3CMA 1;  2V8I A;  2QLV B;  1K9M 1;  2R92 I;  1YJ9 Z;  2JA6 I;  1KD1 1;  5IT9 f;  1TWG I;  1Q81 2;  1VQP Z;  4BBS I;  1WCM I;  1VQ9 1;  1Y1V I;  5CM2 M;  1JJ2 Y;  1M90 1;  1Q7Y 2;  3P5J B;  2F4O A;  5T64 A;  1ZB8 A;  1YHQ 1;  1PFT A;  4A3C I;  4HGY A;  2EGT A;  4E32 A;  1NJI 2;  3BG1 B;  2P28 A;  5FLM I;  2QR1 B;  1M1K 2;  2ZAE B;  3CQZ I;  3GTJ I;  3VTN A;  4BY7 I;  1W2B Y;  2RBL A;  1YI2 1;  1KQS Z;  3G71 1;  2GTI A;  2I3C A;  3GTM I;  1YJW Z;  2IZ4 A;  1RO2 A;  3HOY I;  1X3Z A;  2Q4Z A;  2R7Z I;  3G4S Z;  1I50 I;  4Y7N I;  4E30 A;  3CXC Y;  1L1O C;  2B63 I;  2JR6 A;  1LQL A;  3IX0 A;  1TWH I;  1VQK 1;  1X3W A;  3CME 1;  3G6E Z;  3CCM Z;  5T67 A;  1YIT Z;  4HGZ A;  3GTO I;  1YUK A;  2LFU A;  1S7M A;  3IF8 A;  3FQQ A;  1VQ6 1;  3NH5 A;  4A3I I;  2E2J I;  1VQN Z;  1YUA A;  1KQS Y;  1I3Q I;  4NBH A;  2NVX I;  2J6A A;  2NVY I;  1YIJ Z;  4NFR A;  3KIH A;  4A3F I;  3CCJ Z;  3HOV I;  1N8R 2;  2OOX B;  2LIY A;  3I55 1;  3CCQ Z;  2WB1 A;  3CD6 1;  2OTL 1;  3CC2 Z;  1K73 1;  4RVG A;  3VMG A;  1M1K 1;  3EED A;  3H3V J;  1QVG Z;  2QA4 1;  4MD9 A;  3JAM b;  1Z03 A;  3GKQ A;  1WII A;  5D1O B;  4X6A I;  1P9N A;  2K5R A;  3H0G I;  3J7A 4;  3TDH B;  3CMA Z;  3IFU A;  2YU9 I;  3MZK B;  2K3R A;  5C4J I;  1VQ9 Z;  2WAQ A;  4BBR I;  3S2D I;  3CC7 Z;  3GTM S;  1USP B;  2JS4 A;  1VQ7 1;  4RS4 A;  4DK1 A;  1QVG Y;  1ZH1 A;  3CCU Z;  5AN9 F;  1VQ8 1;  4MD7 A;  2R6M A;  2PM9 A;  5C3E I;  3CXC Z;  1QVF Y;  3CCL 1;  3G71 Z;  1N8R 1;  4S1T A;  3CCE 1;  3I4M I;  3HOX I;  3CCV 1;  3U50 C;  2V8K A;  1KC8 2;  1Z02 A;  4NB9 A;  4MH4 A;  5D1O A;  1K8A 2;  4A3E I;  2W04 A;  1Y1W I;  2E2H I;  3CME Z;  1VQO 1;  3S17 I;  3S1Q I;  2OTJ 1;  1Z01 A;  4NBB A;  2VUM I;  1RLY A;  1QYP A;  1VQ6 Z;  4EWC A;  2HU9 A;  2GU2 A;  3M3Y I;  1USP A;  2M6N A;  4A3D I;  3F3P C;  1N2F A;  2AKL A;  1VQM 1;  3JAM f;  2R93 I;  5LL6 f;  1VQ5 Z;  2DE7 A;  4MON A;  5C4X I;  1S72 1;  3CCR Z;  2E9H A;  2OTL Z;  1Q86 2;  1RQF A;  1Q81 1;  1RNI A;  4A3G I;  1ZB9 A;  1Q7Y 1;  3NDJ A;  1NP6 A;  1WW9 A;  4NBA A;  4NH1 C;  2YAD A;  1QF8 A;  3S1N I;  3CCS Z;  4HH4 A;  2V8J A;  4A3K I;  2QKD A;  2W03 A;  1YJW 1;  1KC8 1;  4DGL A;  2O53 A;  2M48 A;  3GCF A;  2O4H A;  3NH8 A;  1NJI 1;  1K9M 2;  5T6B A;  3PO3 S;  4A3L I;  3G4S 1;  1KD1 2;  3CPW Z;  4NBC A;  3HOU I;  2JA8 I;  1YIT 1;  2NVT I;  1M90 2;  1QVF Z;  4MD8 A;  3GTP I;  1VQ7 Z;  1TFI A;  3CC4 1;  5A2Q b;  3J80 b;  3HOZ I;  2JMO A;  1VQ8 Z;  2NVQ I;  3VB9 A;  1VQN 1;  2HF1 A;  2RPR A;  2QRE B;  3D9X A;  2QEX 1;  5FLX b;  3CCE Z;  3HKZ A;  3QWU A;  4NB8 A;  4CL1 A;  3I56 1;  2BJO A;  4NOZ A;  4E2Z A;  1TWF I;  1YHQ Z;  3PO3 I;  3CPW Y;  2P3Y A;  2RHB A;  3FKI I;  3F3F C;  2QRD B;  4NBD A;  3MZL B;  4A3M I;  1VQL 1;  2GTH A;  1VQO Z;  1YI2 Z;  2H85 A;  4BXX I;  3PO2 I;  2Y0S A;  3S1R I;  4AYB A;  3NDI A;  2VF1 A;  4Y52 I;  3ESW A;  1SFO I;  1VQM Z;  2QRC B;  3RZO I;  4A3B I;  1YJN 1;  1VQK Z;  3D6W A;  3OW2 Z;  3CC7 1;  2RIQ A;  1VQ4 1;  2OZK A;  1K83 I;  1S72 Z;  3TE5 B;  2KPI A;  1Q82 2;  3GTK I;  1YJ9 1;  3HOW I;  1VLA A;  4RVH A;  3CCU 1;  3S16 I;  1K73 2;  3S14 I;  3S2H I;  2G2K A;  1VQP 1;  1X0T A;  5D1P A;  1I6H I;  3J81 f;  1JWH C;  3S1M I;  4TNU A;  3I55 Z;  3CD6 Z;  1TWA I;  5A2Q f;  3J80 f;  2PMZ A;  5IT9 b;  2Q51 A;  2VUG A;  3K7A I;  2QA4 Z;  3OW2 Y;  3NFZ A;  2KI7 B;  1KRL A;  4DQY B;  5C44 I;  3Q87 A;  5FLX f;  3NH4 A;  2JA7 I;  4RVD A;  2JUB A;  4E2X A;  3CC4 Z;  3T4N B;  4E2W A;  3BG0 B;  4NBF A;  1K8A 1;  2IZ3 A;  1RO0 A;  1TWC I;  4A3J I;  1VQ5 1;  2QEX Z;  3G6E 1;  3CCM 1;  4RVF A;  3J81 b;  3MON A;  3I56 Z;  3VMI A;  2JNY A;  1Q82 1;  3RZD I;  3I4N I;  1NUI A;  2OOY B;  5IP9 I;  4RV9 A;  3CCR 1;  3S15 I;  4MXU A;  2JA5 I;  2DE5 A;  3KIF A;  5IP7 I;  4E31 A;  1VQL Z;  4BY1 I;  1Y1V S;  3GTG I;  1YIJ 1;  3CCL Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...