2QRDB

Crystal structure of the adenylate sensor from amp-activated protein kinase in complex with adp and atp
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
93
structure length
91
Chain Sequence
SEQYSTEIPAFLTSNQELKLPKPPSLPPHLEKCILNSNTAYKEDQSVLPNPNHVLLNHLAAANTQLGVLALSATTRYHRKYVTTAMFKNFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords SNF1-like protein kinase ssp2
publication title Structural Insight into AMPK Regulation: ADP Comes into Play.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 6
structure length 91
sequence length 93
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04739 AMPKBI 5'-AMP-activated protein kinase beta subunit, interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.290 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2qrdB01
2QLVB 2OOYB 2OOXB 2QREB 3T4NB 2QRDB 2QRCB 3TE5B 3TDHB 2QR1B
chains in the Genus database with same CATH superfamily
1YUKA 4RVFA 3NDJA 3PO3S 1I50I 3S14I 2V3VA 1TWAI 3CXCY 3HOZI 1Z03A 3CCR1 3GTLI 1KQSZ 2P3YA 1VQO1 2R92I 3EEDA 4AYBA 2QLVB 1VQ6Z 2LIYA 1Q811 4NBAA 1YHQ1 1NUIA 2QKDA 1VQPZ 2QR1B 5AN9F 4NFRA 4A3II 1RQFA 1Q822 1USPA 3CCSZ 3CCVZ 3HOXI 1N8R1 4A3LI 3CMEZ 3OW2Y 1FDIA 3JAMf 3QWUA 3GCFA 2NVTI 1TWFI 3I4NI 3NFZA 4A3CI 1N2FA 4E2WA 4NBGA 3G711 2V8IA 3GTKI 1WW9A 2NVYI 3CCQZ 3MONA 4NB9A 4RVDA 1ZH1A 1AA6A 3U50C 4BY1I 3M3YI 4HGZA 3CC41 2NVQI 5IT9f 3CCE1 2EGTA 3CPWZ 4MRIA 4A3DI 1KD11 1JJ2Y 3GTGI 1I3QI 1YUAA 3NDIA 3HKZA 3S15I 2AYDA 1LQLA 3CC71 3I551 3K7AI 1YIJ1 3MZLB 1Z01A 5D1OB 3CCU1 4A3EI 4Y7NI 4E2ZA 2QA41 2JNYA 1Q862 3CCRZ 3GTQI 2RIQA 2RBLA 3VMHA 2JA7I 2JIPA 1VQOZ 1YIT1 2R6MA 2E7ZA 3J7A4 4MXUA 4BXXI 5FLXb 1I6HI 4NBBA 2QREB 1YHQZ 3S1NI 3JAMb 2W04A 4QTTA 4NBCA 1K8A1 1RLYA 3CD6Z 4DK1A 2YADA 2W03A 3S2HI 2Q51A 1W2BZ 2GTHA 1VQ91 1K731 1QVFY 2E2HI 2QEX1 4NBHA 2JIMA 2GU2A 1TWGI 1KC81 5IT9b 3H3VJ 5LL6f 1QVGZ 3G71Z 2V8JA 3M4OI 3G6E1 1WJ2A 3CCL1 2NAPA 1VQ71 1Y8CA 4HH4A 1VQL1 2HF1A 4RVHA 1KRLA 1NJI2 3CCJ1 3S17I 1YJN1 3CC4Z 1YJ91 3CCEZ 3IR7A 3HOWI 4E30A 2DE6A 2OTL1 1ZB8A 3FKII 2DE5A 4A3JI 4MONA 2VPWA 3CMA1 2E2II 2VPXA 3I4MI 4NH1C 4NBEA 3CC7Z 1DL6A 2VUMI 2JIOA 1N8R2 3LUSA 5FLXf 2JR6A 2NVXI 3I55Z 1ML8A 1YIJZ 3D2LA 2VPZA 1X0TA 3CCUZ 1Q7Y2 4A3FI 3FQQA 1YI21 2QA4Z 1VQ41 1S7MA 4DQYB 4A3KI 1Y1VI 5D1OA 1K9M1 3J81f 2Q4ZA 1YITZ 2OOYB 2RT9A 1VQ81 4TNUA 2WAQA 3I07A 1M1K1 4CL1A 5FLMI 1WCMI 3EERA 3VMGA 3P5JB 4E32A 1L1OC 2VUGA 4A3BI 2O53A 2M6NA 3CXCZ 1VQ9Z 4BBSI 2IZ3A 2QEXZ 2V45A 3IF8A 3G4S1 1VQN1 5A2Qf 2DE7A 4E2YA 1KQSY 3MZKB 2F4MA 3BG0B 3F3FC 2B63I 3GTMI 1S721 1Q16A 1M902 4E2XA 3S1MI 3G6EZ 3CCLZ 2H85A 3NH4A 1VQ7Z 1VQLZ 1R9TI 3D9XA 3I561 2RHBA 3CCJZ 1Y1VS 1YJNZ 2VF1A 1YJ9Z 2PK7A 3OW2Z 2J6AA 3PO2I 2OTLZ 2K3RA 4NBDA 1K8A2 4S1TA 3CMAZ 5D1PA 3HOVI 2E9HA 3RZDI 3J81b 2O4HA 5CM2M 2JMOA 2JIRA 4XX2A 4A93I 2P28A 3S2DI 1KC82 1ZB9A 4RV9A 4RVGA 1YI2Z 4X6AI 1VQ4Z 3CQZI 3CPWY 3CCM1 4MD7A 1JJ2Z 2BJOA 3GTMS 3RZOI 5T67A 2G2KA 3J80f 2Y0SA 4RS4A 1VQ8Z 1Q812 2R93I 3NH5A 5A2Qb 1YJW1 2GTIA 3GTPI 1VQ51 5C4XI 1P9NA 2RPRA 2YU9I 4E31A 4DGLA 4HGYA 3CC21 1WZNA 1NJI1 1RO2A 1K83I 2KPIA 3S1QI 2K5RA 3T4NB 1RO0A 3VMIA 2JA5I 3G4SZ 2QRCB 3IX0A 1VQNZ 3D6WA 1X3WA 3KIHA 2OOXB 3CD61 1TWCI 1Q821 2OTJ1 2JS4A 1S72Z 2IV2X 3F3PC 3TDHB 3Q87A 3IFUA 2OZKA 3FQMA 1VQK1 3VB9A 2QRDB 3S1RI 2VPYA 2V8KA 1VQM1 1Y1WI 1K9M2 2PMZA 3I56Z 5C4JI 1WIIA 1Q7Y1 1TWHI 1W2BY 1PFTA 1JWHC 1QVFZ 3GKQA 3TE5B 1X3ZA 1NP6A 1M1K2 4MD9A 1KD12 2JA6I 2JUBA 2F4OA 3HOYI 4Y52I 5T6BA 1VQ61 2LFUA 1QF8A 1USPB 4A3MI 1VQP1 1QVGY 2PM9A 2R7ZI 5C3EI 3J80b 2M48A 4BBRI 2ZAEB 2AKLA 4E33A 3CCS1 3CCV1 1FDOA 3VTNA 1RNIA 1QYPA 3PO3I 1RO4A 3CME1 3CCMZ 1Z02A 4NB8A 2HU9A 4NOZA 2JA8I 4A3GI 4NBFA 4MH4A 3H0GI 1M901 2I3CA 3GTOI 1Q861 3BG1B 1YJWZ 5IP9I 1VQ5Z 3NH8A 5IP7I 3CCQ1 1SIWA 1QXFA 2E2JI 2LEXA 3CC2Z 1K732 2JIQA 2WB1A 4MD8A 2KI7B 4QTUA 1TFIA 3GTJI 1VLAA 1SFOI 5C44I 2IZ4A 2OTJZ 5T64A 4EWCA 3ESWA 1VQKZ 3HOUI 4BY7I 3S16I 1VQMZ 3KIFA
chains in the Genus database with same CATH topology
1YUKA 4RVFA 3NDJA 3PO3S 1I50I 3S14I 1TWAI 3CXCY 3HOZI 1Z03A 3CCR1 3GTLI 1KQSZ 2P3YA 1VQO1 2R92I 3EEDA 4AYBA 2QLVB 1VQ6Z 2LIYA 1Q811 4NBAA 1YHQ1 1NUIA 2QKDA 1VQPZ 2QR1B 5AN9F 4NFRA 4A3II 1RQFA 1Q822 1USPA 3CCSZ 3CCVZ 3HOXI 1N8R1 4A3LI 3CMEZ 3OW2Y 3JAMf 3QWUA 3GCFA 2NVTI 1TWFI 3I4NI 3NFZA 4A3CI 1N2FA 4E2WA 4NBGA 3G711 2V8IA 3GTKI 1WW9A 2NVYI 3CCQZ 3MONA 4NB9A 4RVDA 1ZH1A 3U50C 4BY1I 3M3YI 4HGZA 3CC41 2NVQI 5IT9f 3CCE1 2EGTA 3CPWZ 4MRIA 4A3DI 1KD11 1JJ2Y 3GTGI 1I3QI 1YUAA 3NDIA 3HKZA 3S15I 3CC71 1LQLA 3I551 3K7AI 1YIJ1 3MZLB 1Z01A 5D1OB 3CCU1 4A3EI 4Y7NI 4E2ZA 2QA41 2JNYA 1Q862 3CCRZ 3GTQI 2RIQA 2RBLA 3VMHA 2JA7I 1VQOZ 1YIT1 2R6MA 3J7A4 4MXUA 4BXXI 5FLXb 1I6HI 4NBBA 2QREB 1YHQZ 3S1NI 3JAMb 2W04A 4QTTA 4NBCA 1K8A1 1RLYA 3CD6Z 4DK1A 2YADA 2W03A 3S2HI 2Q51A 1W2BZ 2GTHA 1VQ91 1K731 1QVFY 2E2HI 2QEX1 4NBHA 2GU2A 1TWGI 1KC81 5IT9b 3H3VJ 5LL6f 1QVGZ 3G71Z 2V8JA 3M4OI 3G6E1 3CCL1 1VQ71 1VQL1 4HH4A 2HF1A 4RVHA 1KRLA 1NJI2 3CCJ1 3S17I 1YJN1 3CC4Z 1YJ91 3CCEZ 3HOWI 4E30A 2DE6A 2OTL1 1ZB8A 3FKII 2DE5A 4A3JI 4MONA 3CMA1 2E2II 3I4MI 4NH1C 4NBEA 3CC7Z 1DL6A 2VUMI 1N8R2 3LUSA 5FLXf 2JR6A 2NVXI 3I55Z 1ML8A 1YIJZ 1X0TA 3CCUZ 1Q7Y2 4A3FI 3FQQA 1YI21 2QA4Z 1VQ41 1S7MA 4DQYB 4A3KI 1Y1VI 5D1OA 1K9M1 3J81f 2Q4ZA 1YITZ 2OOYB 2RT9A 1VQ81 4TNUA 2WAQA 3I07A 1M1K1 4CL1A 5FLMI 1WCMI 3EERA 3VMGA 3P5JB 4E32A 1L1OC 2VUGA 4A3BI 2O53A 2M6NA 3CXCZ 1VQ9Z 4BBSI 2IZ3A 2QEXZ 3IF8A 3G4S1 1VQN1 5A2Qf 2DE7A 4E2YA 1KQSY 3MZKB 2F4MA 3BG0B 3F3FC 2B63I 3GTMI 1S721 1M902 4E2XA 3S1MI 3G6EZ 3CCLZ 2H85A 3NH4A 1VQ7Z 1VQLZ 1R9TI 3D9XA 3I561 2RHBA 3CCJZ 1Y1VS 1YJNZ 2VF1A 1YJ9Z 2PK7A 3OW2Z 2J6AA 3PO2I 2OTLZ 2K3RA 4NBDA 1K8A2 4S1TA 3CMAZ 5D1PA 3HOVI 2E9HA 3RZDI 3J81b 2O4HA 5CM2M 2JMOA 4XX2A 4A93I 2P28A 3S2DI 1KC82 1ZB9A 4RV9A 4RVGA 1YI2Z 4X6AI 1VQ4Z 3CQZI 3CPWY 3CCM1 4MD7A 1JJ2Z 2BJOA 3GTMS 3RZOI 5T67A 2G2KA 3J80f 2Y0SA 4RS4A 1VQ8Z 1Q812 2R93I 3NH5A 5A2Qb 1YJW1 2GTIA 3GTPI 1VQ51 5C4XI 1P9NA 2RPRA 2YU9I 4E31A 4DGLA 4HGYA 3CC21 1NJI1 1RO2A 1K83I 2KPIA 3S1QI 2K5RA 3T4NB 1RO0A 3VMIA 2JA5I 3G4SZ 2QRCB 3IX0A 1VQNZ 3D6WA 1X3WA 3KIHA 2OOXB 3CD61 1TWCI 1Q821 2OTJ1 2JS4A 1S72Z 3F3PC 3TDHB 3Q87A 3IFUA 2OZKA 3FQMA 1VQK1 3VB9A 2QRDB 3S1RI 2V8KA 1VQM1 1Y1WI 1K9M2 2PMZA 3I56Z 5C4JI 1WIIA 1Q7Y1 1TWHI 1W2BY 1PFTA 1JWHC 1QVFZ 3GKQA 3TE5B 1X3ZA 1NP6A 1M1K2 4MD9A 1KD12 2JA6I 2JUBA 2F4OA 3HOYI 4Y52I 5T6BA 1VQ61 2LFUA 1QF8A 1USPB 4A3MI 1VQP1 1QVGY 2PM9A 2R7ZI 5C3EI 3J80b 2M48A 4BBRI 2ZAEB 2AKLA 4E33A 3CCS1 3CCV1 3VTNA 1RNIA 1QYPA 3PO3I 1RO4A 3CME1 3CCMZ 1Z02A 4NB8A 2HU9A 4NOZA 2JA8I 4A3GI 4NBFA 4MH4A 3H0GI 1M901 2I3CA 3GTOI 1Q861 3BG1B 1YJWZ 5IP9I 1VQ5Z 3NH8A 5IP7I 3CCQ1 2E2JI 3CC2Z 1K732 2WB1A 4MD8A 2KI7B 4QTUA 1TFIA 3GTJI 1VLAA 1SFOI 5C44I 2IZ4A 2OTJZ 5T64A 4EWCA 3ESWA 1VQKZ 3HOUI 4BY7I 3S16I 1VQMZ 3KIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QLV B;  2OOY B;  2OOX B;  2QRE B;  3T4N B;  2QRD B;  2QRC B;  3TE5 B;  3TDH B;  2QR1 B; 
#chains in the Genus database with same CATH topology
 1YUK A;  4RVF A;  3NDJ A;  3PO3 S;  1I50 I;  3S14 I;  2V3V A;  1TWA I;  3CXC Y;  3HOZ I;  1Z03 A;  3CCR 1;  3GTL I;  1KQS Z;  2P3Y A;  1VQO 1;  2R92 I;  3EED A;  4AYB A;  2QLV B;  1VQ6 Z;  2LIY A;  1Q81 1;  4NBA A;  1YHQ 1;  1NUI A;  2QKD A;  1VQP Z;  2QR1 B;  5AN9 F;  4NFR A;  4A3I I;  1RQF A;  1Q82 2;  1USP A;  3CCS Z;  3CCV Z;  3HOX I;  1N8R 1;  4A3L I;  3CME Z;  3OW2 Y;  1FDI A;  3JAM f;  3QWU A;  3GCF A;  2NVT I;  1TWF I;  3I4N I;  3NFZ A;  4A3C I;  1N2F A;  4E2W A;  4NBG A;  3G71 1;  2V8I A;  3GTK I;  1WW9 A;  2NVY I;  3CCQ Z;  3MON A;  4NB9 A;  4RVD A;  1ZH1 A;  1AA6 A;  3U50 C;  4BY1 I;  3M3Y I;  4HGZ A;  3CC4 1;  2NVQ I;  5IT9 f;  3CCE 1;  2EGT A;  3CPW Z;  4MRI A;  4A3D I;  1KD1 1;  1JJ2 Y;  3GTG I;  1I3Q I;  1YUA A;  3NDI A;  3HKZ A;  3S15 I;  2AYD A;  1LQL A;  3CC7 1;  3I55 1;  3K7A I;  1YIJ 1;  3MZL B;  1Z01 A;  5D1O B;  3CCU 1;  4A3E I;  4Y7N I;  4E2Z A;  2QA4 1;  2JNY A;  1Q86 2;  3CCR Z;  3GTQ I;  2RIQ A;  2RBL A;  3VMH A;  2JA7 I;  2JIP A;  1VQO Z;  1YIT 1;  2R6M A;  2E7Z A;  3J7A 4;  4MXU A;  4BXX I;  5FLX b;  1I6H I;  4NBB A;  2QRE B;  1YHQ Z;  3S1N I;  3JAM b;  2W04 A;  4QTT A;  4NBC A;  1K8A 1;  1RLY A;  3CD6 Z;  4DK1 A;  2YAD A;  2W03 A;  3S2H I;  2Q51 A;  1W2B Z;  2GTH A;  1VQ9 1;  1K73 1;  1QVF Y;  2E2H I;  2QEX 1;  4NBH A;  2JIM A;  2GU2 A;  1TWG I;  1KC8 1;  5IT9 b;  3H3V J;  5LL6 f;  1QVG Z;  3G71 Z;  2V8J A;  3M4O I;  3G6E 1;  1WJ2 A;  3CCL 1;  2NAP A;  1VQ7 1;  1Y8C A;  4HH4 A;  1VQL 1;  2HF1 A;  4RVH A;  1KRL A;  1NJI 2;  3CCJ 1;  3S17 I;  1YJN 1;  3CC4 Z;  1YJ9 1;  3CCE Z;  3IR7 A;  3HOW I;  4E30 A;  2DE6 A;  2OTL 1;  1ZB8 A;  3FKI I;  2DE5 A;  4A3J I;  4MON A;  2VPW A;  3CMA 1;  2E2I I;  2VPX A;  3I4M I;  4NH1 C;  4NBE A;  3CC7 Z;  1DL6 A;  2VUM I;  2JIO A;  1N8R 2;  3LUS A;  5FLX f;  2JR6 A;  2NVX I;  3I55 Z;  1ML8 A;  1YIJ Z;  3D2L A;  2VPZ A;  1X0T A;  3CCU Z;  1Q7Y 2;  4A3F I;  3FQQ A;  1YI2 1;  2QA4 Z;  1VQ4 1;  1S7M A;  4DQY B;  4A3K I;  1Y1V I;  5D1O A;  1K9M 1;  3J81 f;  2Q4Z A;  1YIT Z;  2OOY B;  2RT9 A;  1VQ8 1;  4TNU A;  2WAQ A;  3I07 A;  1M1K 1;  4CL1 A;  5FLM I;  1WCM I;  3EER A;  3VMG A;  3P5J B;  4E32 A;  1L1O C;  2VUG A;  4A3B I;  2O53 A;  2M6N A;  3CXC Z;  1VQ9 Z;  4BBS I;  2IZ3 A;  2QEX Z;  2V45 A;  3IF8 A;  3G4S 1;  1VQN 1;  5A2Q f;  2DE7 A;  4E2Y A;  1KQS Y;  3MZK B;  2F4M A;  3BG0 B;  3F3F C;  2B63 I;  3GTM I;  1S72 1;  1Q16 A;  1M90 2;  4E2X A;  3S1M I;  3G6E Z;  3CCL Z;  2H85 A;  3NH4 A;  1VQ7 Z;  1VQL Z;  1R9T I;  3D9X A;  3I56 1;  2RHB A;  3CCJ Z;  1Y1V S;  1YJN Z;  2VF1 A;  1YJ9 Z;  2PK7 A;  3OW2 Z;  2J6A A;  3PO2 I;  2OTL Z;  2K3R A;  4NBD A;  1K8A 2;  4S1T A;  3CMA Z;  5D1P A;  3HOV I;  2E9H A;  3RZD I;  3J81 b;  2O4H A;  5CM2 M;  2JMO A;  2JIR A;  4XX2 A;  4A93 I;  2P28 A;  3S2D I;  1KC8 2;  1ZB9 A;  4RV9 A;  4RVG A;  1YI2 Z;  4X6A I;  1VQ4 Z;  3CQZ I;  3CPW Y;  3CCM 1;  4MD7 A;  1JJ2 Z;  2BJO A;  3GTM S;  3RZO I;  5T67 A;  2G2K A;  3J80 f;  2Y0S A;  4RS4 A;  1VQ8 Z;  1Q81 2;  2R93 I;  3NH5 A;  5A2Q b;  1YJW 1;  2GTI A;  3GTP I;  1VQ5 1;  5C4X I;  1P9N A;  2RPR A;  2YU9 I;  4E31 A;  4DGL A;  4HGY A;  3CC2 1;  1WZN A;  1NJI 1;  1RO2 A;  1K83 I;  2KPI A;  3S1Q I;  2K5R A;  3T4N B;  1RO0 A;  3VMI A;  2JA5 I;  3G4S Z;  2QRC B;  3IX0 A;  1VQN Z;  3D6W A;  1X3W A;  3KIH A;  2OOX B;  3CD6 1;  1TWC I;  1Q82 1;  2OTJ 1;  2JS4 A;  1S72 Z;  2IV2 X;  3F3P C;  3TDH B;  3Q87 A;  3IFU A;  2OZK A;  3FQM A;  1VQK 1;  3VB9 A;  2QRD B;  3S1R I;  2VPY A;  2V8K A;  1VQM 1;  1Y1W I;  1K9M 2;  2PMZ A;  3I56 Z;  5C4J I;  1WII A;  1Q7Y 1;  1TWH I;  1W2B Y;  1PFT A;  1JWH C;  1QVF Z;  3GKQ A;  3TE5 B;  1X3Z A;  1NP6 A;  1M1K 2;  4MD9 A;  1KD1 2;  2JA6 I;  2JUB A;  2F4O A;  3HOY I;  4Y52 I;  5T6B A;  1VQ6 1;  2LFU A;  1QF8 A;  1USP B;  4A3M I;  1VQP 1;  1QVG Y;  2PM9 A;  2R7Z I;  5C3E I;  3J80 b;  2M48 A;  4BBR I;  2ZAE B;  2AKL A;  4E33 A;  3CCS 1;  3CCV 1;  1FDO A;  3VTN A;  1RNI A;  1QYP A;  3PO3 I;  1RO4 A;  3CME 1;  3CCM Z;  1Z02 A;  4NB8 A;  2HU9 A;  4NOZ A;  2JA8 I;  4A3G I;  4NBF A;  4MH4 A;  3H0G I;  1M90 1;  2I3C A;  3GTO I;  1Q86 1;  3BG1 B;  1YJW Z;  5IP9 I;  1VQ5 Z;  3NH8 A;  5IP7 I;  3CCQ 1;  1SIW A;  1QXF A;  2E2J I;  2LEX A;  3CC2 Z;  1K73 2;  2JIQ A;  2WB1 A;  4MD8 A;  2KI7 B;  4QTU A;  1TFI A;  3GTJ I;  1VLA A;  1SFO I;  5C44 I;  2IZ4 A;  2OTJ Z;  5T64 A;  4EWC A;  3ESW A;  1VQK Z;  3HOU I;  4BY7 I;  3S16 I;  1VQM Z;  3KIF A; 
#chains in the Genus database with same CATH homology
 1YUK A;  4RVF A;  3NDJ A;  3PO3 S;  1I50 I;  3S14 I;  1TWA I;  3CXC Y;  3HOZ I;  1Z03 A;  3CCR 1;  3GTL I;  1KQS Z;  2P3Y A;  1VQO 1;  2R92 I;  3EED A;  4AYB A;  2QLV B;  1VQ6 Z;  2LIY A;  1Q81 1;  4NBA A;  1YHQ 1;  1NUI A;  2QKD A;  1VQP Z;  2QR1 B;  5AN9 F;  4NFR A;  4A3I I;  1RQF A;  1Q82 2;  1USP A;  3CCS Z;  3CCV Z;  3HOX I;  1N8R 1;  4A3L I;  3CME Z;  3OW2 Y;  3JAM f;  3QWU A;  3GCF A;  2NVT I;  1TWF I;  3I4N I;  3NFZ A;  4A3C I;  1N2F A;  4E2W A;  4NBG A;  3G71 1;  2V8I A;  3GTK I;  1WW9 A;  2NVY I;  3CCQ Z;  3MON A;  4NB9 A;  4RVD A;  1ZH1 A;  3U50 C;  4BY1 I;  3M3Y I;  4HGZ A;  3CC4 1;  2NVQ I;  5IT9 f;  3CCE 1;  2EGT A;  3CPW Z;  4MRI A;  4A3D I;  1KD1 1;  1JJ2 Y;  3GTG I;  1I3Q I;  1YUA A;  3NDI A;  3HKZ A;  3S15 I;  3CC7 1;  1LQL A;  3I55 1;  3K7A I;  1YIJ 1;  3MZL B;  1Z01 A;  5D1O B;  3CCU 1;  4A3E I;  4Y7N I;  4E2Z A;  2QA4 1;  2JNY A;  1Q86 2;  3CCR Z;  3GTQ I;  2RIQ A;  2RBL A;  3VMH A;  2JA7 I;  1VQO Z;  1YIT 1;  2R6M A;  3J7A 4;  4MXU A;  4BXX I;  5FLX b;  1I6H I;  4NBB A;  2QRE B;  1YHQ Z;  3S1N I;  3JAM b;  2W04 A;  4QTT A;  4NBC A;  1K8A 1;  1RLY A;  3CD6 Z;  4DK1 A;  2YAD A;  2W03 A;  3S2H I;  2Q51 A;  1W2B Z;  2GTH A;  1VQ9 1;  1K73 1;  1QVF Y;  2E2H I;  2QEX 1;  4NBH A;  2GU2 A;  1TWG I;  1KC8 1;  5IT9 b;  3H3V J;  5LL6 f;  1QVG Z;  3G71 Z;  2V8J A;  3M4O I;  3G6E 1;  3CCL 1;  1VQ7 1;  1VQL 1;  4HH4 A;  2HF1 A;  4RVH A;  1KRL A;  1NJI 2;  3CCJ 1;  3S17 I;  1YJN 1;  3CC4 Z;  1YJ9 1;  3CCE Z;  3HOW I;  4E30 A;  2DE6 A;  2OTL 1;  1ZB8 A;  3FKI I;  2DE5 A;  4A3J I;  4MON A;  3CMA 1;  2E2I I;  3I4M I;  4NH1 C;  4NBE A;  3CC7 Z;  1DL6 A;  2VUM I;  1N8R 2;  3LUS A;  5FLX f;  2JR6 A;  2NVX I;  3I55 Z;  1ML8 A;  1YIJ Z;  1X0T A;  3CCU Z;  1Q7Y 2;  4A3F I;  3FQQ A;  1YI2 1;  2QA4 Z;  1VQ4 1;  1S7M A;  4DQY B;  4A3K I;  1Y1V I;  5D1O A;  1K9M 1;  3J81 f;  2Q4Z A;  1YIT Z;  2OOY B;  2RT9 A;  1VQ8 1;  4TNU A;  2WAQ A;  3I07 A;  1M1K 1;  4CL1 A;  5FLM I;  1WCM I;  3EER A;  3VMG A;  3P5J B;  4E32 A;  1L1O C;  2VUG A;  4A3B I;  2O53 A;  2M6N A;  3CXC Z;  1VQ9 Z;  4BBS I;  2IZ3 A;  2QEX Z;  3IF8 A;  3G4S 1;  1VQN 1;  5A2Q f;  2DE7 A;  4E2Y A;  1KQS Y;  3MZK B;  2F4M A;  3BG0 B;  3F3F C;  2B63 I;  3GTM I;  1S72 1;  1M90 2;  4E2X A;  3S1M I;  3G6E Z;  3CCL Z;  2H85 A;  3NH4 A;  1VQ7 Z;  1VQL Z;  1R9T I;  3D9X A;  3I56 1;  2RHB A;  3CCJ Z;  1Y1V S;  1YJN Z;  2VF1 A;  1YJ9 Z;  2PK7 A;  3OW2 Z;  2J6A A;  3PO2 I;  2OTL Z;  2K3R A;  4NBD A;  1K8A 2;  4S1T A;  3CMA Z;  5D1P A;  3HOV I;  2E9H A;  3RZD I;  3J81 b;  2O4H A;  5CM2 M;  2JMO A;  4XX2 A;  4A93 I;  2P28 A;  3S2D I;  1KC8 2;  1ZB9 A;  4RV9 A;  4RVG A;  1YI2 Z;  4X6A I;  1VQ4 Z;  3CQZ I;  3CPW Y;  3CCM 1;  4MD7 A;  1JJ2 Z;  2BJO A;  3GTM S;  3RZO I;  5T67 A;  2G2K A;  3J80 f;  2Y0S A;  4RS4 A;  1VQ8 Z;  1Q81 2;  2R93 I;  3NH5 A;  5A2Q b;  1YJW 1;  2GTI A;  3GTP I;  1VQ5 1;  5C4X I;  1P9N A;  2RPR A;  2YU9 I;  4E31 A;  4DGL A;  4HGY A;  3CC2 1;  1NJI 1;  1RO2 A;  1K83 I;  2KPI A;  3S1Q I;  2K5R A;  3T4N B;  1RO0 A;  3VMI A;  2JA5 I;  3G4S Z;  2QRC B;  3IX0 A;  1VQN Z;  3D6W A;  1X3W A;  3KIH A;  2OOX B;  3CD6 1;  1TWC I;  1Q82 1;  2OTJ 1;  2JS4 A;  1S72 Z;  3F3P C;  3TDH B;  3Q87 A;  3IFU A;  2OZK A;  3FQM A;  1VQK 1;  3VB9 A;  2QRD B;  3S1R I;  2V8K A;  1VQM 1;  1Y1W I;  1K9M 2;  2PMZ A;  3I56 Z;  5C4J I;  1WII A;  1Q7Y 1;  1TWH I;  1W2B Y;  1PFT A;  1JWH C;  1QVF Z;  3GKQ A;  3TE5 B;  1X3Z A;  1NP6 A;  1M1K 2;  4MD9 A;  1KD1 2;  2JA6 I;  2JUB A;  2F4O A;  3HOY I;  4Y52 I;  5T6B A;  1VQ6 1;  2LFU A;  1QF8 A;  1USP B;  4A3M I;  1VQP 1;  1QVG Y;  2PM9 A;  2R7Z I;  5C3E I;  3J80 b;  2M48 A;  4BBR I;  2ZAE B;  2AKL A;  4E33 A;  3CCS 1;  3CCV 1;  3VTN A;  1RNI A;  1QYP A;  3PO3 I;  1RO4 A;  3CME 1;  3CCM Z;  1Z02 A;  4NB8 A;  2HU9 A;  4NOZ A;  2JA8 I;  4A3G I;  4NBF A;  4MH4 A;  3H0G I;  1M90 1;  2I3C A;  3GTO I;  1Q86 1;  3BG1 B;  1YJW Z;  5IP9 I;  1VQ5 Z;  3NH8 A;  5IP7 I;  3CCQ 1;  2E2J I;  3CC2 Z;  1K73 2;  2WB1 A;  4MD8 A;  2KI7 B;  4QTU A;  1TFI A;  3GTJ I;  1VLA A;  1SFO I;  5C44 I;  2IZ4 A;  2OTJ Z;  5T64 A;  4EWC A;  3ESW A;  1VQK Z;  3HOU I;  4BY7 I;  3S16 I;  1VQM Z;  3KIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...