1YIJZ

Crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
b'RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2005-01-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yijZ00
1VQLZ 3CMEZ 1N8R2 1KQSY 1VQ41 3I561 1S721 2QEX1 1YIJ1 1YITZ 1K732 3CPWZ 1YJ91 3CMA1 1VQM1 3CCJZ 3CCRZ 2QA41 1KD11 3G71Z 2OTJZ 1Q7Y1 3I551 3CCU1 3CXCZ 1JJ2Z 1M1K1 3CD61 1K9M1 1VQN1 1VQKZ 3CC41 3CCSZ 1VQ81 1YHQ1 1NJI2 3CPWY 3CCEZ 1YJWZ 3CC21 1M901 1KC82 3CCV1 3G4S1 1YI2Z 1YJN1 3CC7Z 1VQP1 1YIT1 1JJ2Y 1Q821 3CCL1 1Q862 3CCMZ 3CCQZ 1Q811 2OTLZ 1VQ5Z 1VQ9Z 1N8R1 3G6E1 1VQ61 1VQO1 1VQ71 3CCS1 1VQ4Z 3I56Z 3OW2Z 1K9M2 1S72Z 3CME1 1VQL1 2QEXZ 1W2BZ 1YJ9Z 3CMAZ 1VQMZ 2QA4Z 3CXCY 1M902 3CCJ1 3CCR1 3I55Z 1K8A1 3G711 3CCUZ 3CD6Z 2OTJ1 1NJI1 3OW2Y 1VQNZ 1KD12 3CC4Z 1QVFZ 1W2BY 1Q812 1VQ8Z 1YHQZ 1Q7Y2 1VQK1 3CC2Z 1M1K2 1K731 1QVGZ 3CCVZ 3G4SZ 3CCE1 1YJW1 1Q861 1YIJZ 1YJNZ 1VQPZ 3CCLZ 1YI21 1KQSZ 3CC71 1QVFY 3CCM1 3CCQ1 3G6EZ 1VQ6Z 2OTL1 1Q822 1VQ51 1VQOZ 1QVGY 1VQ91 1VQ7Z 1K8A2 1KC81
chains in the Genus database with same CATH superfamily
2NVTI 3T4NB 3MZKB 3IX0A 1I50I 1DL6A 2GU2A 1K732 3TE5B 2O4HA 1KD11 3G71Z 4NBDA 2LIYA 3GTKI 2JA5I 1RQFA 2OOXB 3CCU1 1JJ2Z 4MONA 1TWGI 3D9XA 2R92I 4A3GI 3S2HI 2YADA 3F3PC 3CC41 2EGTA 1YHQ1 3CCEZ 2Q51A 1QXFA 2JUBA 5T64A 1M901 4E32A 3H3VJ 3G4S1 3HOUI 1VQP1 1JJ2Y 2RPRA 1Q821 3JAMb 3NDIA 3P5JB 3CCMZ 2DE6A 2OTLZ 4BBRI 1VQ9Z 1N8R1 3NH5A 3I4MI 4A93I 4MH4A 5FLMI 1VQO1 4MRIA 1VQ71 1VQ4Z 2R7ZI 1LQLA 3S15I 5D1PA 3IR7A 3CMAZ 2QA4Z 2IZ3A 2IV2X 1ML8A 4A3BI 4NBEA 3HOWI 1K8A1 3IF8A 3JAMf 1NJI1 3H0GI 2PK7A 2LEXA 1KD12 1QYPA 1FDOA 2RBLA 1VQK1 2DE5A 3CC2Z 1JWHC 1K731 3M4OI 5CM2M 3FQMA 4NBAA 3VMHA 5C4XI 4E30A 4NB9A 1YJNZ 3HKZA 3D2LA 1TFIA 3HOYI 2W03A 4BY7I 3CC71 3F3FC 1SIWA 1PFTA 2QRDB 3CCQ1 4RVGA 3MONA 1Q822 1VQ6Z 2O53A 3GTMS 4EWCA 1WJ2A 3J80b 1N8R2 3EEDA 5IP7I 1S721 3BG1B 2V8JA 2QEX1 2I3CA 2RHBA 4A3FI 3CQZI 1WCMI 2GTHA 1Q7Y1 2JIPA 3CXCZ 1R9TI 1VQN1 2Y0SA 3GTOI 3BG0B 1NJI2 1YJWZ 2NVYI 4A3II 3J80f 4A3EI 1KC82 1ZB9A 5IP9I 1YI2Z 3NFZA 4RVFA 2HU9A 3CCL1 2QLVB 2JA7I 3PO3I 2VUGA 3VMGA 1VQ5Z 1USPB 2VPXA 4RVHA 4MD7A 4DK1A 1Y1VS 3GKQA 3G6E1 5C3EI 3NH8A 2G2KA 3KIFA 3I56Z 4E2WA 3K7AI 4NH1C 1YJ9Z 1VQMZ 4A3MI 1TWCI 4DQYB 1VLAA 5AN9F 3I55Z 4AYBA 3G711 1Y1WI 3CD6Z 1USPA 3FQQA 2AYDA 4HH4A 2DE7A 2JNYA 2PM9A 1Q812 1VQ8Z 1Q7Y2 3GTJI 1Q16A 3S1RI 2R93I 3CCVZ 3CCE1 1Q861 2RT9A 4A3JI 2VPYA 5C4JI 1S7MA 1KQSZ 3GTMI 3S2DI 2KPIA 4A3LI 2M6NA 4QTUA 3S16I 1Z03A 3CCM1 2VUMI 4NFRA 2F4OA 5D1OB 4Y7NI 1TWFI 2OTL1 4BBSI 3GTLI 1VQ91 1WIIA 2J6AA 1X3ZA 3NDJA 4MXUA 1KC81 1VQLZ 3CMEZ 1KQSY 1VQ41 4MD8A 2RIQA 1N2FA 3CMA1 3CCJZ 3CCRZ 2QA41 2JMOA 4E2ZA 2OTJZ 4QTTA 5D1OA 4XX2A 3NH4A 2AKLA 5A2Qb 3QWUA 3LUSA 4NOZA 2NVQI 2QREB 1ZB8A 1WZNA 2LFUA 4NBHA 1Z02A 3CCSZ 3VMIA 2H85A 3I07A 3CC21 2QR1B 2Q4ZA 5T67A 3HOZI 1P9NA 3S17I 4NBGA 2R6MA 2K5RA 1Y1VI 1YJN1 1RO2A 4S1TA 5FLXf 1Q862 1Q811 3MZLB 4RV9A 4RS4A 4RVDA 1YUKA 1VQ61 3KIHA 4BY1I 4A3CI 5A2Qf 4DGLA 3CCS1 4CL1A 1I6HI 4A3DI 1K9M2 1TWAI 2IZ4A 1ZH1A 3I4NI 4E31A 2BJOA 3CXCY 3RZDI 5LL6f 2VF1A 3PO2I 1RO4A 3CCUZ 1SFOI 1NP6A 2V45A 4HGYA 1WW9A 2P3YA 3CC4Z 1YHQZ 3HOVI 2JIMA 4BXXI 3G4SZ 1YJW1 2E2JI 1I3QI 1YIJZ 4HGZA 1VQPZ 2V3VA 2OOYB 1YUAA 3J81b 1YI21 2V8IA 3J7A4 4X6AI 3ESWA 2OZKA 2JIRA 3VB9A 3S14I 2V8KA 1RNIA 2W04A 1VQ51 4E33A 2PMZA 2VPWA 1VQOZ 1VQ7Z 5IT9b 3S1MI 4NBFA 2JA8I 3I561 1KRLA 1YIJ1 3TDHB 1TWHI 1YITZ 3CPWZ 1YJ91 1VQM1 3J81f 3RZOI 3I551 1L1OC 1RLYA 3GCFA 2JS4A 3FKII 3CD61 1M1K1 1Y8CA 1K9M1 3S1QI 2JR6A 3PO3S 1VQKZ 1VQ81 3D6WA 4NBCA 3CPWY 3EERA 2JA6I 5IT9f 2GTIA 1FDIA 3CCV1 1RO0A 4NB8A 5FLXb 3CC7Z 1YIT1 4A3KI 2HF1A 2QKDA 3CCQZ 2E2HI 5T6BA 1QF8A 2JIQA 3S1NI 2VPZA 3OW2Z 1S72Z 3CME1 1VQL1 2QEXZ 1W2BZ 3M3YI 3Q87A 1K83I 2WB1A 2M48A 4TNUA 2NAPA 1Z01A 1NUIA 2KI7B 2YU9I 1M902 3CCJ1 3CCR1 1AA6A 2WAQA 3VTNA 2NVXI 2E2II 2OTJ1 1X3WA 2F4MA 4E2XA 4NBBA 3OW2Y 1VQNZ 2E9HA 1QVFZ 1W2BY 5C44I 3GTGI 3GTPI 3IFUA 1M1K2 2K3RA 1QVGZ 2P28A 4E2YA 2JIOA 4MD9A 3CCLZ 2B63I 2E7ZA 1QVFY 1X0TA 4Y52I 2QRCB 3G6EZ 2ZAEB 1QVGY 3GTQI 3HOXI 3U50C 1K8A2
chains in the Genus database with same CATH topology
2NVTI 3T4NB 3MZKB 3IX0A 1I50I 1DL6A 2GU2A 1K732 3TE5B 2O4HA 1KD11 3G71Z 4NBDA 2LIYA 3GTKI 2JA5I 1RQFA 2OOXB 3CCU1 1JJ2Z 4MONA 1TWGI 3D9XA 2R92I 4A3GI 3S2HI 2YADA 3F3PC 3CC41 2EGTA 1YHQ1 3CCEZ 2Q51A 2JUBA 5T64A 1M901 4E32A 3H3VJ 3G4S1 3HOUI 1VQP1 1JJ2Y 2RPRA 1Q821 3JAMb 3NDIA 3P5JB 3CCMZ 2DE6A 2OTLZ 4BBRI 1VQ9Z 1N8R1 3NH5A 3I4MI 4A93I 4MH4A 5FLMI 1VQO1 4MRIA 1VQ71 1VQ4Z 2R7ZI 1LQLA 3S15I 5D1PA 3CMAZ 2QA4Z 2IZ3A 1ML8A 4A3BI 4NBEA 3HOWI 1K8A1 3IF8A 3JAMf 1NJI1 3H0GI 2PK7A 1KD12 1QYPA 2RBLA 1VQK1 2DE5A 3CC2Z 1JWHC 1K731 3M4OI 5CM2M 3FQMA 4NBAA 3VMHA 5C4XI 4E30A 4NB9A 1YJNZ 3HKZA 1TFIA 3HOYI 2W03A 4BY7I 3CC71 3F3FC 2QRDB 1PFTA 3CCQ1 4RVGA 3MONA 1Q822 1VQ6Z 2O53A 3GTMS 4EWCA 3J80b 1N8R2 3EEDA 5IP7I 1S721 3BG1B 2V8JA 2QEX1 2I3CA 2RHBA 4A3FI 3CQZI 1WCMI 2GTHA 1Q7Y1 3CXCZ 1R9TI 1VQN1 2Y0SA 3GTOI 3BG0B 1NJI2 1YJWZ 2NVYI 4A3II 3J80f 4A3EI 1KC82 1ZB9A 5IP9I 1YI2Z 3NFZA 4RVFA 2HU9A 3CCL1 2QLVB 2JA7I 3PO3I 2VUGA 3VMGA 1VQ5Z 1USPB 4RVHA 4MD7A 4DK1A 1Y1VS 3GKQA 3G6E1 5C3EI 3NH8A 2G2KA 3KIFA 3I56Z 4E2WA 3K7AI 4NH1C 1YJ9Z 1VQMZ 4A3MI 1TWCI 4DQYB 1VLAA 5AN9F 3I55Z 4AYBA 3G711 1Y1WI 3CD6Z 1USPA 3FQQA 4HH4A 2DE7A 2JNYA 2PM9A 1Q812 1VQ8Z 1Q7Y2 3GTJI 3S1RI 2R93I 3CCVZ 3CCE1 1Q861 2RT9A 4A3JI 5C4JI 1S7MA 1KQSZ 3GTMI 3S2DI 2KPIA 4A3LI 2M6NA 4QTUA 3S16I 1Z03A 3CCM1 2VUMI 4NFRA 2F4OA 5D1OB 4Y7NI 1TWFI 2OTL1 4BBSI 3GTLI 1VQ91 1WIIA 2J6AA 1X3ZA 3NDJA 4MXUA 1KC81 1VQLZ 3CMEZ 1KQSY 1VQ41 4MD8A 2RIQA 1N2FA 3CMA1 3CCJZ 3CCRZ 2QA41 2JMOA 4E2ZA 2OTJZ 4QTTA 5D1OA 4XX2A 3NH4A 2AKLA 5A2Qb 3QWUA 3LUSA 4NOZA 2NVQI 2QREB 1ZB8A 2LFUA 4NBHA 1Z02A 3CCSZ 3VMIA 2H85A 3I07A 3CC21 2QR1B 2Q4ZA 5T67A 3HOZI 1P9NA 3S17I 4NBGA 2R6MA 2K5RA 1Y1VI 1YJN1 1RO2A 4S1TA 5FLXf 1Q862 1Q811 3MZLB 4RV9A 4RS4A 4RVDA 1YUKA 1VQ61 3KIHA 4BY1I 4A3CI 5A2Qf 4DGLA 3CCS1 4CL1A 1I6HI 4A3DI 1K9M2 1TWAI 2IZ4A 1ZH1A 3I4NI 4E31A 2BJOA 3CXCY 3RZDI 5LL6f 2VF1A 3PO2I 1RO4A 3CCUZ 1SFOI 1NP6A 4HGYA 1WW9A 2P3YA 3CC4Z 1YHQZ 3HOVI 4BXXI 3G4SZ 1YJW1 2E2JI 1I3QI 1YIJZ 4HGZA 1VQPZ 2OOYB 1YUAA 3J81b 1YI21 2V8IA 3J7A4 4X6AI 3ESWA 2OZKA 3VB9A 3S14I 2V8KA 1RNIA 2W04A 1VQ51 4E33A 2PMZA 1VQOZ 1VQ7Z 5IT9b 3S1MI 4NBFA 2JA8I 3I561 1KRLA 1YIJ1 3TDHB 1TWHI 1YITZ 3CPWZ 1YJ91 1VQM1 3J81f 3RZOI 3I551 1L1OC 1RLYA 3GCFA 2JS4A 3FKII 3CD61 1M1K1 1K9M1 3S1QI 2JR6A 3PO3S 1VQKZ 1VQ81 3D6WA 4NBCA 3CPWY 3EERA 2JA6I 5IT9f 2GTIA 3CCV1 1RO0A 4NB8A 5FLXb 3CC7Z 1YIT1 4A3KI 2HF1A 2QKDA 3CCQZ 2E2HI 5T6BA 1QF8A 3S1NI 3OW2Z 1S72Z 3CME1 1VQL1 2QEXZ 1W2BZ 3M3YI 3Q87A 1K83I 2WB1A 2M48A 4TNUA 1Z01A 1NUIA 2KI7B 2YU9I 1M902 3CCJ1 3CCR1 2WAQA 3VTNA 2NVXI 2E2II 2OTJ1 1X3WA 2F4MA 4E2XA 4NBBA 3OW2Y 1VQNZ 2E9HA 1QVFZ 1W2BY 5C44I 3GTGI 3GTPI 3IFUA 1M1K2 2K3RA 1QVGZ 2P28A 4E2YA 4MD9A 3CCLZ 2B63I 1QVFY 1X0TA 4Y52I 2QRCB 3G6EZ 2ZAEB 1QVGY 3GTQI 3HOXI 3U50C 1K8A2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQL Z;  3CME Z;  1N8R 2;  1KQS Y;  1VQ4 1;  3I56 1;  1S72 1;  2QEX 1;  1YIJ 1;  1YIT Z;  1K73 2;  3CPW Z;  1YJ9 1;  3CMA 1;  1VQM 1;  3CCJ Z;  3CCR Z;  2QA4 1;  1KD1 1;  3G71 Z;  2OTJ Z;  1Q7Y 1;  3I55 1;  3CCU 1;  3CXC Z;  1JJ2 Z;  1M1K 1;  3CD6 1;  1K9M 1;  1VQN 1;  1VQK Z;  3CC4 1;  3CCS Z;  1VQ8 1;  1YHQ 1;  1NJI 2;  3CPW Y;  3CCE Z;  1YJW Z;  3CC2 1;  1M90 1;  1KC8 2;  3CCV 1;  3G4S 1;  1YI2 Z;  1YJN 1;  3CC7 Z;  1VQP 1;  1YIT 1;  1JJ2 Y;  1Q82 1;  3CCL 1;  1Q86 2;  3CCM Z;  3CCQ Z;  1Q81 1;  2OTL Z;  1VQ5 Z;  1VQ9 Z;  1N8R 1;  3G6E 1;  1VQ6 1;  1VQO 1;  1VQ7 1;  3CCS 1;  1VQ4 Z;  3I56 Z;  3OW2 Z;  1K9M 2;  1S72 Z;  3CME 1;  1VQL 1;  2QEX Z;  1W2B Z;  1YJ9 Z;  3CMA Z;  1VQM Z;  2QA4 Z;  3CXC Y;  1M90 2;  3CCJ 1;  3CCR 1;  3I55 Z;  1K8A 1;  3G71 1;  3CCU Z;  3CD6 Z;  2OTJ 1;  1NJI 1;  3OW2 Y;  1VQN Z;  1KD1 2;  3CC4 Z;  1QVF Z;  1W2B Y;  1Q81 2;  1VQ8 Z;  1YHQ Z;  1Q7Y 2;  1VQK 1;  3CC2 Z;  1M1K 2;  1K73 1;  1QVG Z;  3CCV Z;  3G4S Z;  3CCE 1;  1YJW 1;  1Q86 1;  1YIJ Z;  1YJN Z;  1VQP Z;  3CCL Z;  1YI2 1;  1KQS Z;  3CC7 1;  1QVF Y;  3CCM 1;  3CCQ 1;  3G6E Z;  1VQ6 Z;  2OTL 1;  1Q82 2;  1VQ5 1;  1VQO Z;  1QVG Y;  1VQ9 1;  1VQ7 Z;  1K8A 2;  1KC8 1; 
#chains in the Genus database with same CATH topology
 2NVT I;  3T4N B;  3MZK B;  3IX0 A;  1I50 I;  1DL6 A;  2GU2 A;  1K73 2;  3TE5 B;  2O4H A;  1KD1 1;  3G71 Z;  4NBD A;  2LIY A;  3GTK I;  2JA5 I;  1RQF A;  2OOX B;  3CCU 1;  1JJ2 Z;  4MON A;  1TWG I;  3D9X A;  2R92 I;  4A3G I;  3S2H I;  2YAD A;  3F3P C;  3CC4 1;  2EGT A;  1YHQ 1;  3CCE Z;  2Q51 A;  1QXF A;  2JUB A;  5T64 A;  1M90 1;  4E32 A;  3H3V J;  3G4S 1;  3HOU I;  1VQP 1;  1JJ2 Y;  2RPR A;  1Q82 1;  3JAM b;  3NDI A;  3P5J B;  3CCM Z;  2DE6 A;  2OTL Z;  4BBR I;  1VQ9 Z;  1N8R 1;  3NH5 A;  3I4M I;  4A93 I;  4MH4 A;  5FLM I;  1VQO 1;  4MRI A;  1VQ7 1;  1VQ4 Z;  2R7Z I;  1LQL A;  3S15 I;  5D1P A;  3IR7 A;  3CMA Z;  2QA4 Z;  2IZ3 A;  2IV2 X;  1ML8 A;  4A3B I;  4NBE A;  3HOW I;  1K8A 1;  3IF8 A;  3JAM f;  1NJI 1;  3H0G I;  2PK7 A;  2LEX A;  1KD1 2;  1QYP A;  1FDO A;  2RBL A;  1VQK 1;  2DE5 A;  3CC2 Z;  1JWH C;  1K73 1;  3M4O I;  5CM2 M;  3FQM A;  4NBA A;  3VMH A;  5C4X I;  4E30 A;  4NB9 A;  1YJN Z;  3HKZ A;  3D2L A;  1TFI A;  3HOY I;  2W03 A;  4BY7 I;  3CC7 1;  3F3F C;  1SIW A;  1PFT A;  2QRD B;  3CCQ 1;  4RVG A;  3MON A;  1Q82 2;  1VQ6 Z;  2O53 A;  3GTM S;  4EWC A;  1WJ2 A;  3J80 b;  1N8R 2;  3EED A;  5IP7 I;  1S72 1;  3BG1 B;  2V8J A;  2QEX 1;  2I3C A;  2RHB A;  4A3F I;  3CQZ I;  1WCM I;  2GTH A;  1Q7Y 1;  2JIP A;  3CXC Z;  1R9T I;  1VQN 1;  2Y0S A;  3GTO I;  3BG0 B;  1NJI 2;  1YJW Z;  2NVY I;  4A3I I;  3J80 f;  4A3E I;  1KC8 2;  1ZB9 A;  5IP9 I;  1YI2 Z;  3NFZ A;  4RVF A;  2HU9 A;  3CCL 1;  2QLV B;  2JA7 I;  3PO3 I;  2VUG A;  3VMG A;  1VQ5 Z;  1USP B;  2VPX A;  4RVH A;  4MD7 A;  4DK1 A;  1Y1V S;  3GKQ A;  3G6E 1;  5C3E I;  3NH8 A;  2G2K A;  3KIF A;  3I56 Z;  4E2W A;  3K7A I;  4NH1 C;  1YJ9 Z;  1VQM Z;  4A3M I;  1TWC I;  4DQY B;  1VLA A;  5AN9 F;  3I55 Z;  4AYB A;  3G71 1;  1Y1W I;  3CD6 Z;  1USP A;  3FQQ A;  2AYD A;  4HH4 A;  2DE7 A;  2JNY A;  2PM9 A;  1Q81 2;  1VQ8 Z;  1Q7Y 2;  3GTJ I;  1Q16 A;  3S1R I;  2R93 I;  3CCV Z;  3CCE 1;  1Q86 1;  2RT9 A;  4A3J I;  2VPY A;  5C4J I;  1S7M A;  1KQS Z;  3GTM I;  3S2D I;  2KPI A;  4A3L I;  2M6N A;  4QTU A;  3S16 I;  1Z03 A;  3CCM 1;  2VUM I;  4NFR A;  2F4O A;  5D1O B;  4Y7N I;  1TWF I;  2OTL 1;  4BBS I;  3GTL I;  1VQ9 1;  1WII A;  2J6A A;  1X3Z A;  3NDJ A;  4MXU A;  1KC8 1;  1VQL Z;  3CME Z;  1KQS Y;  1VQ4 1;  4MD8 A;  2RIQ A;  1N2F A;  3CMA 1;  3CCJ Z;  3CCR Z;  2QA4 1;  2JMO A;  4E2Z A;  2OTJ Z;  4QTT A;  5D1O A;  4XX2 A;  3NH4 A;  2AKL A;  5A2Q b;  3QWU A;  3LUS A;  4NOZ A;  2NVQ I;  2QRE B;  1ZB8 A;  1WZN A;  2LFU A;  4NBH A;  1Z02 A;  3CCS Z;  3VMI A;  2H85 A;  3I07 A;  3CC2 1;  2QR1 B;  2Q4Z A;  5T67 A;  3HOZ I;  1P9N A;  3S17 I;  4NBG A;  2R6M A;  2K5R A;  1Y1V I;  1YJN 1;  1RO2 A;  4S1T A;  5FLX f;  1Q86 2;  1Q81 1;  3MZL B;  4RV9 A;  4RS4 A;  4RVD A;  1YUK A;  1VQ6 1;  3KIH A;  4BY1 I;  4A3C I;  5A2Q f;  4DGL A;  3CCS 1;  4CL1 A;  1I6H I;  4A3D I;  1K9M 2;  1TWA I;  2IZ4 A;  1ZH1 A;  3I4N I;  4E31 A;  2BJO A;  3CXC Y;  3RZD I;  5LL6 f;  2VF1 A;  3PO2 I;  1RO4 A;  3CCU Z;  1SFO I;  1NP6 A;  2V45 A;  4HGY A;  1WW9 A;  2P3Y A;  3CC4 Z;  1YHQ Z;  3HOV I;  2JIM A;  4BXX I;  3G4S Z;  1YJW 1;  2E2J I;  1I3Q I;  1YIJ Z;  4HGZ A;  1VQP Z;  2V3V A;  2OOY B;  1YUA A;  3J81 b;  1YI2 1;  2V8I A;  3J7A 4;  4X6A I;  3ESW A;  2OZK A;  2JIR A;  3VB9 A;  3S14 I;  2V8K A;  1RNI A;  2W04 A;  1VQ5 1;  4E33 A;  2PMZ A;  2VPW A;  1VQO Z;  1VQ7 Z;  5IT9 b;  3S1M I;  4NBF A;  2JA8 I;  3I56 1;  1KRL A;  1YIJ 1;  3TDH B;  1TWH I;  1YIT Z;  3CPW Z;  1YJ9 1;  1VQM 1;  3J81 f;  3RZO I;  3I55 1;  1L1O C;  1RLY A;  3GCF A;  2JS4 A;  3FKI I;  3CD6 1;  1M1K 1;  1Y8C A;  1K9M 1;  3S1Q I;  2JR6 A;  3PO3 S;  1VQK Z;  1VQ8 1;  3D6W A;  4NBC A;  3CPW Y;  3EER A;  2JA6 I;  5IT9 f;  2GTI A;  1FDI A;  3CCV 1;  1RO0 A;  4NB8 A;  5FLX b;  3CC7 Z;  1YIT 1;  4A3K I;  2HF1 A;  2QKD A;  3CCQ Z;  2E2H I;  5T6B A;  1QF8 A;  2JIQ A;  3S1N I;  2VPZ A;  3OW2 Z;  1S72 Z;  3CME 1;  1VQL 1;  2QEX Z;  1W2B Z;  3M3Y I;  3Q87 A;  1K83 I;  2WB1 A;  2M48 A;  4TNU A;  2NAP A;  1Z01 A;  1NUI A;  2KI7 B;  2YU9 I;  1M90 2;  3CCJ 1;  3CCR 1;  1AA6 A;  2WAQ A;  3VTN A;  2NVX I;  2E2I I;  2OTJ 1;  1X3W A;  2F4M A;  4E2X A;  4NBB A;  3OW2 Y;  1VQN Z;  2E9H A;  1QVF Z;  1W2B Y;  5C44 I;  3GTG I;  3GTP I;  3IFU A;  1M1K 2;  2K3R A;  1QVG Z;  2P28 A;  4E2Y A;  2JIO A;  4MD9 A;  3CCL Z;  2B63 I;  2E7Z A;  1QVF Y;  1X0T A;  4Y52 I;  2QRC B;  3G6E Z;  2ZAE B;  1QVG Y;  3GTQ I;  3HOX I;  3U50 C;  1K8A 2; 
#chains in the Genus database with same CATH homology
 2NVT I;  3T4N B;  3MZK B;  3IX0 A;  1I50 I;  1DL6 A;  2GU2 A;  1K73 2;  3TE5 B;  2O4H A;  1KD1 1;  3G71 Z;  4NBD A;  2LIY A;  3GTK I;  2JA5 I;  1RQF A;  2OOX B;  3CCU 1;  1JJ2 Z;  4MON A;  1TWG I;  3D9X A;  2R92 I;  4A3G I;  3S2H I;  2YAD A;  3F3P C;  3CC4 1;  2EGT A;  1YHQ 1;  3CCE Z;  2Q51 A;  2JUB A;  5T64 A;  1M90 1;  4E32 A;  3H3V J;  3G4S 1;  3HOU I;  1VQP 1;  1JJ2 Y;  2RPR A;  1Q82 1;  3JAM b;  3NDI A;  3P5J B;  3CCM Z;  2DE6 A;  2OTL Z;  4BBR I;  1VQ9 Z;  1N8R 1;  3NH5 A;  3I4M I;  4A93 I;  4MH4 A;  5FLM I;  1VQO 1;  4MRI A;  1VQ7 1;  1VQ4 Z;  2R7Z I;  1LQL A;  3S15 I;  5D1P A;  3CMA Z;  2QA4 Z;  2IZ3 A;  1ML8 A;  4A3B I;  4NBE A;  3HOW I;  1K8A 1;  3IF8 A;  3JAM f;  1NJI 1;  3H0G I;  2PK7 A;  1KD1 2;  1QYP A;  2RBL A;  1VQK 1;  2DE5 A;  3CC2 Z;  1JWH C;  1K73 1;  3M4O I;  5CM2 M;  3FQM A;  4NBA A;  3VMH A;  5C4X I;  4E30 A;  4NB9 A;  1YJN Z;  3HKZ A;  1TFI A;  3HOY I;  2W03 A;  4BY7 I;  3CC7 1;  3F3F C;  2QRD B;  1PFT A;  3CCQ 1;  4RVG A;  3MON A;  1Q82 2;  1VQ6 Z;  2O53 A;  3GTM S;  4EWC A;  3J80 b;  1N8R 2;  3EED A;  5IP7 I;  1S72 1;  3BG1 B;  2V8J A;  2QEX 1;  2I3C A;  2RHB A;  4A3F I;  3CQZ I;  1WCM I;  2GTH A;  1Q7Y 1;  3CXC Z;  1R9T I;  1VQN 1;  2Y0S A;  3GTO I;  3BG0 B;  1NJI 2;  1YJW Z;  2NVY I;  4A3I I;  3J80 f;  4A3E I;  1KC8 2;  1ZB9 A;  5IP9 I;  1YI2 Z;  3NFZ A;  4RVF A;  2HU9 A;  3CCL 1;  2QLV B;  2JA7 I;  3PO3 I;  2VUG A;  3VMG A;  1VQ5 Z;  1USP B;  4RVH A;  4MD7 A;  4DK1 A;  1Y1V S;  3GKQ A;  3G6E 1;  5C3E I;  3NH8 A;  2G2K A;  3KIF A;  3I56 Z;  4E2W A;  3K7A I;  4NH1 C;  1YJ9 Z;  1VQM Z;  4A3M I;  1TWC I;  4DQY B;  1VLA A;  5AN9 F;  3I55 Z;  4AYB A;  3G71 1;  1Y1W I;  3CD6 Z;  1USP A;  3FQQ A;  4HH4 A;  2DE7 A;  2JNY A;  2PM9 A;  1Q81 2;  1VQ8 Z;  1Q7Y 2;  3GTJ I;  3S1R I;  2R93 I;  3CCV Z;  3CCE 1;  1Q86 1;  2RT9 A;  4A3J I;  5C4J I;  1S7M A;  1KQS Z;  3GTM I;  3S2D I;  2KPI A;  4A3L I;  2M6N A;  4QTU A;  3S16 I;  1Z03 A;  3CCM 1;  2VUM I;  4NFR A;  2F4O A;  5D1O B;  4Y7N I;  1TWF I;  2OTL 1;  4BBS I;  3GTL I;  1VQ9 1;  1WII A;  2J6A A;  1X3Z A;  3NDJ A;  4MXU A;  1KC8 1;  1VQL Z;  3CME Z;  1KQS Y;  1VQ4 1;  4MD8 A;  2RIQ A;  1N2F A;  3CMA 1;  3CCJ Z;  3CCR Z;  2QA4 1;  2JMO A;  4E2Z A;  2OTJ Z;  4QTT A;  5D1O A;  4XX2 A;  3NH4 A;  2AKL A;  5A2Q b;  3QWU A;  3LUS A;  4NOZ A;  2NVQ I;  2QRE B;  1ZB8 A;  2LFU A;  4NBH A;  1Z02 A;  3CCS Z;  3VMI A;  2H85 A;  3I07 A;  3CC2 1;  2QR1 B;  2Q4Z A;  5T67 A;  3HOZ I;  1P9N A;  3S17 I;  4NBG A;  2R6M A;  2K5R A;  1Y1V I;  1YJN 1;  1RO2 A;  4S1T A;  5FLX f;  1Q86 2;  1Q81 1;  3MZL B;  4RV9 A;  4RS4 A;  4RVD A;  1YUK A;  1VQ6 1;  3KIH A;  4BY1 I;  4A3C I;  5A2Q f;  4DGL A;  3CCS 1;  4CL1 A;  1I6H I;  4A3D I;  1K9M 2;  1TWA I;  2IZ4 A;  1ZH1 A;  3I4N I;  4E31 A;  2BJO A;  3CXC Y;  3RZD I;  5LL6 f;  2VF1 A;  3PO2 I;  1RO4 A;  3CCU Z;  1SFO I;  1NP6 A;  4HGY A;  1WW9 A;  2P3Y A;  3CC4 Z;  1YHQ Z;  3HOV I;  4BXX I;  3G4S Z;  1YJW 1;  2E2J I;  1I3Q I;  1YIJ Z;  4HGZ A;  1VQP Z;  2OOY B;  1YUA A;  3J81 b;  1YI2 1;  2V8I A;  3J7A 4;  4X6A I;  3ESW A;  2OZK A;  3VB9 A;  3S14 I;  2V8K A;  1RNI A;  2W04 A;  1VQ5 1;  4E33 A;  2PMZ A;  1VQO Z;  1VQ7 Z;  5IT9 b;  3S1M I;  4NBF A;  2JA8 I;  3I56 1;  1KRL A;  1YIJ 1;  3TDH B;  1TWH I;  1YIT Z;  3CPW Z;  1YJ9 1;  1VQM 1;  3J81 f;  3RZO I;  3I55 1;  1L1O C;  1RLY A;  3GCF A;  2JS4 A;  3FKI I;  3CD6 1;  1M1K 1;  1K9M 1;  3S1Q I;  2JR6 A;  3PO3 S;  1VQK Z;  1VQ8 1;  3D6W A;  4NBC A;  3CPW Y;  3EER A;  2JA6 I;  5IT9 f;  2GTI A;  3CCV 1;  1RO0 A;  4NB8 A;  5FLX b;  3CC7 Z;  1YIT 1;  4A3K I;  2HF1 A;  2QKD A;  3CCQ Z;  2E2H I;  5T6B A;  1QF8 A;  3S1N I;  3OW2 Z;  1S72 Z;  3CME 1;  1VQL 1;  2QEX Z;  1W2B Z;  3M3Y I;  3Q87 A;  1K83 I;  2WB1 A;  2M48 A;  4TNU A;  1Z01 A;  1NUI A;  2KI7 B;  2YU9 I;  1M90 2;  3CCJ 1;  3CCR 1;  2WAQ A;  3VTN A;  2NVX I;  2E2I I;  2OTJ 1;  1X3W A;  2F4M A;  4E2X A;  4NBB A;  3OW2 Y;  1VQN Z;  2E9H A;  1QVF Z;  1W2B Y;  5C44 I;  3GTG I;  3GTP I;  3IFU A;  1M1K 2;  2K3R A;  1QVG Z;  2P28 A;  4E2Y A;  4MD9 A;  3CCL Z;  2B63 I;  1QVF Y;  1X0T A;  4Y52 I;  2QRC B;  3G6E Z;  2ZAE B;  1QVG Y;  3GTQ I;  3HOX I;  3U50 C;  1K8A 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...