1YIJZ

Crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
b'RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2005-01-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yijZ00
3I55Z 1M902 3OW2Z 1Q821 1VQ41 1YHQ1 2QEXZ 1QVGZ 3CXCZ 3CCQ1 3CCEZ 3CC21 1VQOZ 1M1K1 3OW2Y 2QA41 3G6E1 1QVFZ 1QVGY 1YJ91 1YJN1 3G711 3CXCY 3CCE1 1KD12 1N8R1 1QVFY 1S721 1NJI1 1KQSZ 1VQ4Z 1K9M2 1YHQZ 3CC71 1KQSY 3CCQZ 3CC2Z 1Q822 1K731 2QA4Z 3G6EZ 1VQN1 1KC81 1VQ51 1YIJ1 1YJ9Z 1YJNZ 3G71Z 1VQ71 1VQK1 3CMA1 1Q861 3I561 1S72Z 1W2BZ 1VQM1 3CC41 3CPWZ 3CCU1 1N8R2 1YI21 3CC7Z 3G4S1 1VQ91 1K8A1 3CPWY 1Q7Y1 1VQNZ 1VQ5Z 1YIJZ 1VQ7Z 2OTJ1 1VQP1 1VQKZ 3CMAZ 1KC82 3I56Z 1M901 3CME1 1VQMZ 1M1K2 3CC4Z 3CCUZ 2OTL1 1YJW1 3CCR1 1YI2Z 3CCJ1 3G4SZ 1VQ9Z 1VQ81 1KD11 1NJI2 1Q811 2OTJZ 1W2BY 1K8A2 1VQPZ 3CCSZ 1VQL1 1VQ61 3CMEZ 1JJ2Z 3CCS1 1K732 3CCV1 2OTLZ 3CD61 1YJWZ 3CCRZ 1YIT1 3CCJZ 3CCL1 1JJ2Y 3I551 1Q862 1VQ8Z 2QEX1 1VQLZ 1VQO1 1Q812 1VQ6Z 3CCMZ 1K9M1 1Q7Y2 3CCVZ 3CD6Z 1YITZ 3CCLZ 3CCM1
chains in the Genus database with same CATH superfamily
5IT9b 1Q821 1VQ41 4A93I 4NBBA 4E2WA 1QVGZ 3CCQ1 2JMOA 2JUBA 1M1K1 3OW2Y 2QA41 3G711 1YUAA 2NVXI 1RO0A 3S17I 3P5JB 1QVFY 2P3YA 2NVYI 4A3GI 1LQLA 4BXXI 4RVDA 1KQSY 1X3WA 4HH4A 1Y8CA 3T4NB 4NBEA 3G6EZ 2JA6I 3HOYI 1L1OC 3VMHA 1YIJ1 1VQ71 1VQK1 5FLMI 1S72Z 5A2Qb 2LIYA 4DK1A 1TWHI 1N8R2 2R92I 2K5RA 2JA8I 2DE5A 1RO4A 4NBFA 2E2HI 3VMIA 2QKDA 4MD7A 1Q7Y1 2V8KA 1ZB9A 2RT9A 1VQNZ 3S1RI 2OTJ1 1NP6A 2JA7I 4A3JI 3HOXI 1KC82 3I56Z 1ML8A 1FDOA 1VQMZ 1WZNA 1M1K2 3CC4Z 2O4HA 1VQ9Z 5CM2M 2OOYB 1VQL1 1DL6A 1VQ61 4E32A 2VPXA 2GTHA 1YJWZ 3CCRZ 3CCJZ 4NBAA 1FDIA 2HF1A 1TWAI 2O53A 1USPA 4NB8A 3RZOI 3GTKI 2V3VA 3D2LA 1RQFA 2QR1B 2JIQA 4NOZA 1Q7Y2 3ESWA 1YITZ 1VLAA 2W04A 1N2FA 4RS4A 3I55Z 3KIFA 5FLXf 2F4MA 3CCEZ 1VQOZ 1ZH1A 3J80f 1USPB 1QVGY 3JAMb 5C3EI 3I4NI 2V8JA 3CCE1 1N8R1 1NJI1 2I3CA 3VMGA 1VQ4Z 3HKZA 3Q87A 2RHBA 3CCQZ 3S16I 3MZLB 4A3MI 2QA4Z 1KC81 1VQ51 3G71Z 2W03A 3FKII 4NBGA 4MONA 2P28A 1AA6A 1W2BZ 2B63I 1RNIA 3CCU1 1WW9A 1YI21 2AYDA 3HOUI 3G4S1 2GU2A 3S1QI 3MONA 3S2HI 1YIJZ 1VQ7Z 2NVQI 4MXUA 1VQKZ 5FLXb 2QRDB 1M901 3D6WA 3CME1 3MZKB 4NFRA 3J80b 4Y7NI 5LL6f 3HOWI 3K7AI 2DE6A 4E33A 4TNUA 1ZB8A 4NB9A 1NJI2 3EEDA 2OTJZ 4QTUA 3CCSZ 4E2YA 2KI7B 1JWHC 5T6BA 1Z02A 1NUIA 2M48A 1TWCI 2JS4A 1JJ2Z 3RZDI 3CCS1 3CCV1 3CD61 3PO3S 2QLVB 2QEX1 1X0TA 3GTLI 1R9TI 1VQLZ 3NDIA 2IZ3A 1Q812 1VQ6Z 3I4MI 4RVFA 2F4OA 3CCMZ 1K9M1 2QRCB 2JIOA 3S1MI 3CCM1 1M902 5T64A 1YHQ1 3BG0B 3CXCZ 2RBLA 3CC21 4NBCA 4E31A 2J6AA 1YJ91 1YJN1 4RVHA 5IP9I 4RV9A 2GTIA 2WB1A 2DE7A 2Y0SA 1I3QI 1Q16A 4AYBA 2BJOA 4NBDA 3CC71 3NFZA 1I50I 1K731 1Y1VI 3GTJI 4S1TA 3PO2I 4MRIA 1RLYA 3CMA1 1Q861 3GTGI 3CPWZ 3M4OI 3IF8A 1X3ZA 4A3KI 5C4JI 3H0GI 2R7ZI 4XX2A 5C44I 1VQ5Z 2E2JI 1VQP1 2EGTA 4BY1I 2RPRA 3PO3I 2Q51A 3CCUZ 3NDJA 2OTL1 4A3CI 1YI2Z 3S14I 5A2Qf 3J81f 3G4SZ 2E7ZA 1VQ81 1S7MA 2K3RA 5D1OA 1KD11 2RIQA 1Q811 4HGZA 1K8A2 2JA5I 1QXFA 5T67A 2AKLA 3CMEZ 2V45A 2WAQA 1K732 2G2KA 5IP7I 3CCL1 4X6AI 2HU9A 3F3PC 1Y1VS 1JJ2Y 1Q862 2V8IA 2LEXA 5AN9F 3NH4A 1KRLA 5D1OB 3VB9A 2NVTI 3GTMI 1Z01A 2YADA 3CQZI 4DQYB 1Z03A 3CCVZ 1Y1WI 3CD6Z 3FQQA 2VUMI 2E2II 3OW2Z 2QEXZ 3G6E1 1I6HI 4BBSI 1QVFZ 3J81b 3CXCY 3BG1B 3GTOI 3HOVI 4MD9A 4QTTA 4MD8A 1SFOI 1KD12 1S721 3S15I 3IFUA 1KQSZ 2IV2X 4A3LI 1TFIA 4BBRI 4A3EI 3IR7A 4E2ZA 4CL1A 4A3FI 1QF8A 3FQMA 1YHQZ 2PK7A 1K9M2 3S2DI 2PMZA 2JIPA 3F3FC 3QWUA 4NBHA 3GTPI 3CC2Z 1Q822 2LFUA 1VQN1 1YJ9Z 1YJNZ 1WCMI 4Y52I 3I561 3TE5B 3JAMf 1VQM1 2JIRA 2VPZA 3CC41 1K83I 3U50C 2VPYA 2VF1A 3CC7Z 4A3DI 4RVGA 1VQ91 2VPWA 1K8A1 3CPWY 3GTMS 3TDHB 2QREB 3GKQA 4A3II 2R93I 2JNYA 3I07A 4HGYA 1WJ2A 1TWFI 3CMAZ 2KPIA 4MH4A 3HOZI 2YU9I 5IT9f 2JIMA 2OOXB 1YJW1 3CCR1 3H3VJ 3CCJ1 4E2XA 2PM9A 3GCFA 1RO2A 2M6NA 2ZAEB 5D1PA 1W2BY 1VQPZ 3VTNA 4EWCA 4DGLA 4NH1C 1SIWA 3EERA 2R6MA 3D9XA 2OZKA 3LUSA 3J7A4 2OTLZ 1YIT1 3KIHA 4E30A 4A3BI 1TWGI 3I551 4BY7I 1YUKA 3NH5A 3GTQI 1VQ8Z 3NH8A 5C4XI 2JR6A 2Q4ZA 2VUGA 3IX0A 2NAPA 3M3YI 1WIIA 1VQO1 1P9NA 3S1NI 2E9HA 2IZ4A 2H85A 3CCLZ 1PFTA 1QYPA
chains in the Genus database with same CATH topology
5IT9b 1Q821 1VQ41 4A93I 4NBBA 4E2WA 1QVGZ 3CCQ1 2JMOA 2JUBA 1M1K1 3OW2Y 2QA41 3G711 1YUAA 2NVXI 1RO0A 3S17I 3P5JB 1QVFY 2P3YA 2NVYI 4A3GI 1LQLA 4BXXI 4RVDA 1KQSY 1X3WA 4HH4A 3T4NB 4NBEA 3G6EZ 2JA6I 3HOYI 1L1OC 3VMHA 1YIJ1 1VQ71 1VQK1 5FLMI 1S72Z 5A2Qb 2LIYA 4DK1A 1TWHI 1N8R2 2R92I 2K5RA 2JA8I 2DE5A 1RO4A 4NBFA 2E2HI 3VMIA 2QKDA 4MD7A 1Q7Y1 2V8KA 1ZB9A 2RT9A 1VQNZ 3S1RI 2OTJ1 1NP6A 2JA7I 4A3JI 3HOXI 1KC82 3I56Z 1ML8A 1VQMZ 1M1K2 3CC4Z 2O4HA 1VQ9Z 5CM2M 2OOYB 1VQL1 1DL6A 1VQ61 4E32A 2GTHA 1YJWZ 3CCRZ 3CCJZ 4NBAA 2HF1A 1TWAI 2O53A 1USPA 4NB8A 3RZOI 3GTKI 1RQFA 2QR1B 4NOZA 1Q7Y2 3ESWA 1YITZ 1VLAA 2W04A 1N2FA 4RS4A 3I55Z 3KIFA 5FLXf 2F4MA 3CCEZ 1VQOZ 1ZH1A 3J80f 1USPB 1QVGY 3JAMb 5C3EI 3I4NI 2V8JA 3CCE1 1N8R1 1NJI1 2I3CA 3VMGA 1VQ4Z 3HKZA 3Q87A 2RHBA 3CCQZ 3S16I 3MZLB 4A3MI 2QA4Z 1KC81 1VQ51 3G71Z 2W03A 3FKII 4NBGA 4MONA 2P28A 1W2BZ 2B63I 1RNIA 3CCU1 1WW9A 1YI21 3HOUI 3G4S1 2GU2A 3S1QI 3MONA 3S2HI 1YIJZ 1VQ7Z 2NVQI 4MXUA 1VQKZ 5FLXb 2QRDB 1M901 3D6WA 3CME1 3MZKB 4NFRA 3J80b 4Y7NI 5LL6f 3HOWI 3K7AI 2DE6A 4E33A 4TNUA 1ZB8A 4NB9A 1NJI2 3EEDA 2OTJZ 4QTUA 3CCSZ 4E2YA 2KI7B 1JWHC 5T6BA 1Z02A 1NUIA 2M48A 1TWCI 2JS4A 1JJ2Z 3RZDI 3CCS1 3CCV1 3CD61 3PO3S 2QLVB 2QEX1 1X0TA 3GTLI 1R9TI 1VQLZ 3NDIA 2IZ3A 1Q812 1VQ6Z 3I4MI 4RVFA 2F4OA 3CCMZ 1K9M1 2QRCB 3S1MI 3CCM1 1M902 5T64A 1YHQ1 3BG0B 3CXCZ 2RBLA 3CC21 4NBCA 4E31A 2J6AA 1YJ91 1YJN1 4RVHA 5IP9I 4RV9A 2GTIA 2WB1A 2DE7A 2Y0SA 1I3QI 4AYBA 2BJOA 4NBDA 3CC71 3NFZA 1I50I 1K731 1Y1VI 3GTJI 4S1TA 3PO2I 4MRIA 1RLYA 3CMA1 1Q861 3GTGI 3CPWZ 3M4OI 3IF8A 1X3ZA 4A3KI 5C4JI 3H0GI 2R7ZI 4XX2A 5C44I 1VQ5Z 2E2JI 1VQP1 2EGTA 4BY1I 2RPRA 3PO3I 2Q51A 3CCUZ 3NDJA 2OTL1 4A3CI 1YI2Z 3S14I 5A2Qf 3J81f 3G4SZ 1VQ81 1S7MA 2K3RA 5D1OA 1KD11 2RIQA 1Q811 4HGZA 1K8A2 2JA5I 5T67A 2AKLA 3CMEZ 2WAQA 1K732 2G2KA 5IP7I 3CCL1 4X6AI 2HU9A 3F3PC 1Y1VS 1JJ2Y 1Q862 2V8IA 5AN9F 3NH4A 1KRLA 5D1OB 3VB9A 2NVTI 3GTMI 1Z01A 2YADA 3CQZI 4DQYB 1Z03A 3CCVZ 1Y1WI 3CD6Z 3FQQA 2VUMI 2E2II 3OW2Z 2QEXZ 3G6E1 1I6HI 4BBSI 1QVFZ 3J81b 3CXCY 3BG1B 3GTOI 3HOVI 4MD9A 4QTTA 4MD8A 1SFOI 1KD12 1S721 3S15I 3IFUA 1KQSZ 4A3LI 1TFIA 4BBRI 4A3EI 4E2ZA 4CL1A 4A3FI 1QF8A 1YHQZ 3FQMA 2PK7A 1K9M2 3S2DI 2PMZA 3F3FC 3QWUA 4NBHA 3GTPI 3CC2Z 1Q822 2LFUA 1VQN1 1YJ9Z 1YJNZ 1WCMI 4Y52I 3I561 3TE5B 3JAMf 1VQM1 3CC41 1K83I 3U50C 2VF1A 3CC7Z 4A3DI 4RVGA 1VQ91 1K8A1 3CPWY 3GTMS 3TDHB 2QREB 3GKQA 4A3II 2R93I 2JNYA 3I07A 4HGYA 1TWFI 3CMAZ 2KPIA 4MH4A 3HOZI 2YU9I 5IT9f 2OOXB 1YJW1 3CCR1 3H3VJ 3CCJ1 4E2XA 2PM9A 3GCFA 1RO2A 2M6NA 2ZAEB 5D1PA 1W2BY 1VQPZ 3VTNA 4EWCA 4DGLA 4NH1C 3EERA 2R6MA 3D9XA 2OZKA 3LUSA 3J7A4 2OTLZ 1YIT1 3KIHA 4E30A 4A3BI 1TWGI 3I551 4BY7I 1YUKA 3NH5A 3GTQI 1VQ8Z 3NH8A 5C4XI 2JR6A 2Q4ZA 2VUGA 3IX0A 3M3YI 1WIIA 1VQO1 1P9NA 3S1NI 2E9HA 2IZ4A 2H85A 3CCLZ 1PFTA 1QYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I55 Z;  1M90 2;  3OW2 Z;  1Q82 1;  1VQ4 1;  1YHQ 1;  2QEX Z;  1QVG Z;  3CXC Z;  3CCQ 1;  3CCE Z;  3CC2 1;  1VQO Z;  1M1K 1;  3OW2 Y;  2QA4 1;  3G6E 1;  1QVF Z;  1QVG Y;  1YJ9 1;  1YJN 1;  3G71 1;  3CXC Y;  3CCE 1;  1KD1 2;  1N8R 1;  1QVF Y;  1S72 1;  1NJI 1;  1KQS Z;  1VQ4 Z;  1K9M 2;  1YHQ Z;  3CC7 1;  1KQS Y;  3CCQ Z;  3CC2 Z;  1Q82 2;  1K73 1;  2QA4 Z;  3G6E Z;  1VQN 1;  1KC8 1;  1VQ5 1;  1YIJ 1;  1YJ9 Z;  1YJN Z;  3G71 Z;  1VQ7 1;  1VQK 1;  3CMA 1;  1Q86 1;  3I56 1;  1S72 Z;  1W2B Z;  1VQM 1;  3CC4 1;  3CPW Z;  3CCU 1;  1N8R 2;  1YI2 1;  3CC7 Z;  3G4S 1;  1VQ9 1;  1K8A 1;  3CPW Y;  1Q7Y 1;  1VQN Z;  1VQ5 Z;  1YIJ Z;  1VQ7 Z;  2OTJ 1;  1VQP 1;  1VQK Z;  3CMA Z;  1KC8 2;  3I56 Z;  1M90 1;  3CME 1;  1VQM Z;  1M1K 2;  3CC4 Z;  3CCU Z;  2OTL 1;  1YJW 1;  3CCR 1;  1YI2 Z;  3CCJ 1;  3G4S Z;  1VQ9 Z;  1VQ8 1;  1KD1 1;  1NJI 2;  1Q81 1;  2OTJ Z;  1W2B Y;  1K8A 2;  1VQP Z;  3CCS Z;  1VQL 1;  1VQ6 1;  3CME Z;  1JJ2 Z;  3CCS 1;  1K73 2;  3CCV 1;  2OTL Z;  3CD6 1;  1YJW Z;  3CCR Z;  1YIT 1;  3CCJ Z;  3CCL 1;  1JJ2 Y;  3I55 1;  1Q86 2;  1VQ8 Z;  2QEX 1;  1VQL Z;  1VQO 1;  1Q81 2;  1VQ6 Z;  3CCM Z;  1K9M 1;  1Q7Y 2;  3CCV Z;  3CD6 Z;  1YIT Z;  3CCL Z;  3CCM 1; 
#chains in the Genus database with same CATH topology
 5IT9 b;  1Q82 1;  1VQ4 1;  4A93 I;  4NBB A;  4E2W A;  1QVG Z;  3CCQ 1;  2JMO A;  2JUB A;  1M1K 1;  3OW2 Y;  2QA4 1;  3G71 1;  1YUA A;  2NVX I;  1RO0 A;  3S17 I;  3P5J B;  1QVF Y;  2P3Y A;  2NVY I;  4A3G I;  1LQL A;  4BXX I;  4RVD A;  1KQS Y;  1X3W A;  4HH4 A;  1Y8C A;  3T4N B;  4NBE A;  3G6E Z;  2JA6 I;  3HOY I;  1L1O C;  3VMH A;  1YIJ 1;  1VQ7 1;  1VQK 1;  5FLM I;  1S72 Z;  5A2Q b;  2LIY A;  4DK1 A;  1TWH I;  1N8R 2;  2R92 I;  2K5R A;  2JA8 I;  2DE5 A;  1RO4 A;  4NBF A;  2E2H I;  3VMI A;  2QKD A;  4MD7 A;  1Q7Y 1;  2V8K A;  1ZB9 A;  2RT9 A;  1VQN Z;  3S1R I;  2OTJ 1;  1NP6 A;  2JA7 I;  4A3J I;  3HOX I;  1KC8 2;  3I56 Z;  1ML8 A;  1FDO A;  1VQM Z;  1WZN A;  1M1K 2;  3CC4 Z;  2O4H A;  1VQ9 Z;  5CM2 M;  2OOY B;  1VQL 1;  1DL6 A;  1VQ6 1;  4E32 A;  2VPX A;  2GTH A;  1YJW Z;  3CCR Z;  3CCJ Z;  4NBA A;  1FDI A;  2HF1 A;  1TWA I;  2O53 A;  1USP A;  4NB8 A;  3RZO I;  3GTK I;  2V3V A;  3D2L A;  1RQF A;  2QR1 B;  2JIQ A;  4NOZ A;  1Q7Y 2;  3ESW A;  1YIT Z;  1VLA A;  2W04 A;  1N2F A;  4RS4 A;  3I55 Z;  3KIF A;  5FLX f;  2F4M A;  3CCE Z;  1VQO Z;  1ZH1 A;  3J80 f;  1USP B;  1QVG Y;  3JAM b;  5C3E I;  3I4N I;  2V8J A;  3CCE 1;  1N8R 1;  1NJI 1;  2I3C A;  3VMG A;  1VQ4 Z;  3HKZ A;  3Q87 A;  2RHB A;  3CCQ Z;  3S16 I;  3MZL B;  4A3M I;  2QA4 Z;  1KC8 1;  1VQ5 1;  3G71 Z;  2W03 A;  3FKI I;  4NBG A;  4MON A;  2P28 A;  1AA6 A;  1W2B Z;  2B63 I;  1RNI A;  3CCU 1;  1WW9 A;  1YI2 1;  2AYD A;  3HOU I;  3G4S 1;  2GU2 A;  3S1Q I;  3MON A;  3S2H I;  1YIJ Z;  1VQ7 Z;  2NVQ I;  4MXU A;  1VQK Z;  5FLX b;  2QRD B;  1M90 1;  3D6W A;  3CME 1;  3MZK B;  4NFR A;  3J80 b;  4Y7N I;  5LL6 f;  3HOW I;  3K7A I;  2DE6 A;  4E33 A;  4TNU A;  1ZB8 A;  4NB9 A;  1NJI 2;  3EED A;  2OTJ Z;  4QTU A;  3CCS Z;  4E2Y A;  2KI7 B;  1JWH C;  5T6B A;  1Z02 A;  1NUI A;  2M48 A;  1TWC I;  2JS4 A;  1JJ2 Z;  3RZD I;  3CCS 1;  3CCV 1;  3CD6 1;  3PO3 S;  2QLV B;  2QEX 1;  1X0T A;  3GTL I;  1R9T I;  1VQL Z;  3NDI A;  2IZ3 A;  1Q81 2;  1VQ6 Z;  3I4M I;  4RVF A;  2F4O A;  3CCM Z;  1K9M 1;  2QRC B;  2JIO A;  3S1M I;  3CCM 1;  1M90 2;  5T64 A;  1YHQ 1;  3BG0 B;  3CXC Z;  2RBL A;  3CC2 1;  4NBC A;  4E31 A;  2J6A A;  1YJ9 1;  1YJN 1;  4RVH A;  5IP9 I;  4RV9 A;  2GTI A;  2WB1 A;  2DE7 A;  2Y0S A;  1I3Q I;  1Q16 A;  4AYB A;  2BJO A;  4NBD A;  3CC7 1;  3NFZ A;  1I50 I;  1K73 1;  1Y1V I;  3GTJ I;  4S1T A;  3PO2 I;  4MRI A;  1RLY A;  3CMA 1;  1Q86 1;  3GTG I;  3CPW Z;  3M4O I;  3IF8 A;  1X3Z A;  4A3K I;  5C4J I;  3H0G I;  2R7Z I;  4XX2 A;  5C44 I;  1VQ5 Z;  2E2J I;  1VQP 1;  2EGT A;  4BY1 I;  2RPR A;  3PO3 I;  2Q51 A;  3CCU Z;  3NDJ A;  2OTL 1;  4A3C I;  1YI2 Z;  3S14 I;  5A2Q f;  3J81 f;  3G4S Z;  2E7Z A;  1VQ8 1;  1S7M A;  2K3R A;  5D1O A;  1KD1 1;  2RIQ A;  1Q81 1;  4HGZ A;  1K8A 2;  2JA5 I;  1QXF A;  5T67 A;  2AKL A;  3CME Z;  2V45 A;  2WAQ A;  1K73 2;  2G2K A;  5IP7 I;  3CCL 1;  4X6A I;  2HU9 A;  3F3P C;  1Y1V S;  1JJ2 Y;  1Q86 2;  2V8I A;  2LEX A;  5AN9 F;  3NH4 A;  1KRL A;  5D1O B;  3VB9 A;  2NVT I;  3GTM I;  1Z01 A;  2YAD A;  3CQZ I;  4DQY B;  1Z03 A;  3CCV Z;  1Y1W I;  3CD6 Z;  3FQQ A;  2VUM I;  2E2I I;  3OW2 Z;  2QEX Z;  3G6E 1;  1I6H I;  4BBS I;  1QVF Z;  3J81 b;  3CXC Y;  3BG1 B;  3GTO I;  3HOV I;  4MD9 A;  4QTT A;  4MD8 A;  1SFO I;  1KD1 2;  1S72 1;  3S15 I;  3IFU A;  1KQS Z;  2IV2 X;  4A3L I;  1TFI A;  4BBR I;  4A3E I;  3IR7 A;  4E2Z A;  4CL1 A;  4A3F I;  1QF8 A;  3FQM A;  1YHQ Z;  2PK7 A;  1K9M 2;  3S2D I;  2PMZ A;  2JIP A;  3F3F C;  3QWU A;  4NBH A;  3GTP I;  3CC2 Z;  1Q82 2;  2LFU A;  1VQN 1;  1YJ9 Z;  1YJN Z;  1WCM I;  4Y52 I;  3I56 1;  3TE5 B;  3JAM f;  1VQM 1;  2JIR A;  2VPZ A;  3CC4 1;  1K83 I;  3U50 C;  2VPY A;  2VF1 A;  3CC7 Z;  4A3D I;  4RVG A;  1VQ9 1;  2VPW A;  1K8A 1;  3CPW Y;  3GTM S;  3TDH B;  2QRE B;  3GKQ A;  4A3I I;  2R93 I;  2JNY A;  3I07 A;  4HGY A;  1WJ2 A;  1TWF I;  3CMA Z;  2KPI A;  4MH4 A;  3HOZ I;  2YU9 I;  5IT9 f;  2JIM A;  2OOX B;  1YJW 1;  3CCR 1;  3H3V J;  3CCJ 1;  4E2X A;  2PM9 A;  3GCF A;  1RO2 A;  2M6N A;  2ZAE B;  5D1P A;  1W2B Y;  1VQP Z;  3VTN A;  4EWC A;  4DGL A;  4NH1 C;  1SIW A;  3EER A;  2R6M A;  3D9X A;  2OZK A;  3LUS A;  3J7A 4;  2OTL Z;  1YIT 1;  3KIH A;  4E30 A;  4A3B I;  1TWG I;  3I55 1;  4BY7 I;  1YUK A;  3NH5 A;  3GTQ I;  1VQ8 Z;  3NH8 A;  5C4X I;  2JR6 A;  2Q4Z A;  2VUG A;  3IX0 A;  2NAP A;  3M3Y I;  1WII A;  1VQO 1;  1P9N A;  3S1N I;  2E9H A;  2IZ4 A;  2H85 A;  3CCL Z;  1PFT A;  1QYP A; 
#chains in the Genus database with same CATH homology
 5IT9 b;  1Q82 1;  1VQ4 1;  4A93 I;  4NBB A;  4E2W A;  1QVG Z;  3CCQ 1;  2JMO A;  2JUB A;  1M1K 1;  3OW2 Y;  2QA4 1;  3G71 1;  1YUA A;  2NVX I;  1RO0 A;  3S17 I;  3P5J B;  1QVF Y;  2P3Y A;  2NVY I;  4A3G I;  1LQL A;  4BXX I;  4RVD A;  1KQS Y;  1X3W A;  4HH4 A;  3T4N B;  4NBE A;  3G6E Z;  2JA6 I;  3HOY I;  1L1O C;  3VMH A;  1YIJ 1;  1VQ7 1;  1VQK 1;  5FLM I;  1S72 Z;  5A2Q b;  2LIY A;  4DK1 A;  1TWH I;  1N8R 2;  2R92 I;  2K5R A;  2JA8 I;  2DE5 A;  1RO4 A;  4NBF A;  2E2H I;  3VMI A;  2QKD A;  4MD7 A;  1Q7Y 1;  2V8K A;  1ZB9 A;  2RT9 A;  1VQN Z;  3S1R I;  2OTJ 1;  1NP6 A;  2JA7 I;  4A3J I;  3HOX I;  1KC8 2;  3I56 Z;  1ML8 A;  1VQM Z;  1M1K 2;  3CC4 Z;  2O4H A;  1VQ9 Z;  5CM2 M;  2OOY B;  1VQL 1;  1DL6 A;  1VQ6 1;  4E32 A;  2GTH A;  1YJW Z;  3CCR Z;  3CCJ Z;  4NBA A;  2HF1 A;  1TWA I;  2O53 A;  1USP A;  4NB8 A;  3RZO I;  3GTK I;  1RQF A;  2QR1 B;  4NOZ A;  1Q7Y 2;  3ESW A;  1YIT Z;  1VLA A;  2W04 A;  1N2F A;  4RS4 A;  3I55 Z;  3KIF A;  5FLX f;  2F4M A;  3CCE Z;  1VQO Z;  1ZH1 A;  3J80 f;  1USP B;  1QVG Y;  3JAM b;  5C3E I;  3I4N I;  2V8J A;  3CCE 1;  1N8R 1;  1NJI 1;  2I3C A;  3VMG A;  1VQ4 Z;  3HKZ A;  3Q87 A;  2RHB A;  3CCQ Z;  3S16 I;  3MZL B;  4A3M I;  2QA4 Z;  1KC8 1;  1VQ5 1;  3G71 Z;  2W03 A;  3FKI I;  4NBG A;  4MON A;  2P28 A;  1W2B Z;  2B63 I;  1RNI A;  3CCU 1;  1WW9 A;  1YI2 1;  3HOU I;  3G4S 1;  2GU2 A;  3S1Q I;  3MON A;  3S2H I;  1YIJ Z;  1VQ7 Z;  2NVQ I;  4MXU A;  1VQK Z;  5FLX b;  2QRD B;  1M90 1;  3D6W A;  3CME 1;  3MZK B;  4NFR A;  3J80 b;  4Y7N I;  5LL6 f;  3HOW I;  3K7A I;  2DE6 A;  4E33 A;  4TNU A;  1ZB8 A;  4NB9 A;  1NJI 2;  3EED A;  2OTJ Z;  4QTU A;  3CCS Z;  4E2Y A;  2KI7 B;  1JWH C;  5T6B A;  1Z02 A;  1NUI A;  2M48 A;  1TWC I;  2JS4 A;  1JJ2 Z;  3RZD I;  3CCS 1;  3CCV 1;  3CD6 1;  3PO3 S;  2QLV B;  2QEX 1;  1X0T A;  3GTL I;  1R9T I;  1VQL Z;  3NDI A;  2IZ3 A;  1Q81 2;  1VQ6 Z;  3I4M I;  4RVF A;  2F4O A;  3CCM Z;  1K9M 1;  2QRC B;  3S1M I;  3CCM 1;  1M90 2;  5T64 A;  1YHQ 1;  3BG0 B;  3CXC Z;  2RBL A;  3CC2 1;  4NBC A;  4E31 A;  2J6A A;  1YJ9 1;  1YJN 1;  4RVH A;  5IP9 I;  4RV9 A;  2GTI A;  2WB1 A;  2DE7 A;  2Y0S A;  1I3Q I;  4AYB A;  2BJO A;  4NBD A;  3CC7 1;  3NFZ A;  1I50 I;  1K73 1;  1Y1V I;  3GTJ I;  4S1T A;  3PO2 I;  4MRI A;  1RLY A;  3CMA 1;  1Q86 1;  3GTG I;  3CPW Z;  3M4O I;  3IF8 A;  1X3Z A;  4A3K I;  5C4J I;  3H0G I;  2R7Z I;  4XX2 A;  5C44 I;  1VQ5 Z;  2E2J I;  1VQP 1;  2EGT A;  4BY1 I;  2RPR A;  3PO3 I;  2Q51 A;  3CCU Z;  3NDJ A;  2OTL 1;  4A3C I;  1YI2 Z;  3S14 I;  5A2Q f;  3J81 f;  3G4S Z;  1VQ8 1;  1S7M A;  2K3R A;  5D1O A;  1KD1 1;  2RIQ A;  1Q81 1;  4HGZ A;  1K8A 2;  2JA5 I;  5T67 A;  2AKL A;  3CME Z;  2WAQ A;  1K73 2;  2G2K A;  5IP7 I;  3CCL 1;  4X6A I;  2HU9 A;  3F3P C;  1Y1V S;  1JJ2 Y;  1Q86 2;  2V8I A;  5AN9 F;  3NH4 A;  1KRL A;  5D1O B;  3VB9 A;  2NVT I;  3GTM I;  1Z01 A;  2YAD A;  3CQZ I;  4DQY B;  1Z03 A;  3CCV Z;  1Y1W I;  3CD6 Z;  3FQQ A;  2VUM I;  2E2I I;  3OW2 Z;  2QEX Z;  3G6E 1;  1I6H I;  4BBS I;  1QVF Z;  3J81 b;  3CXC Y;  3BG1 B;  3GTO I;  3HOV I;  4MD9 A;  4QTT A;  4MD8 A;  1SFO I;  1KD1 2;  1S72 1;  3S15 I;  3IFU A;  1KQS Z;  4A3L I;  1TFI A;  4BBR I;  4A3E I;  4E2Z A;  4CL1 A;  4A3F I;  1QF8 A;  1YHQ Z;  3FQM A;  2PK7 A;  1K9M 2;  3S2D I;  2PMZ A;  3F3F C;  3QWU A;  4NBH A;  3GTP I;  3CC2 Z;  1Q82 2;  2LFU A;  1VQN 1;  1YJ9 Z;  1YJN Z;  1WCM I;  4Y52 I;  3I56 1;  3TE5 B;  3JAM f;  1VQM 1;  3CC4 1;  1K83 I;  3U50 C;  2VF1 A;  3CC7 Z;  4A3D I;  4RVG A;  1VQ9 1;  1K8A 1;  3CPW Y;  3GTM S;  3TDH B;  2QRE B;  3GKQ A;  4A3I I;  2R93 I;  2JNY A;  3I07 A;  4HGY A;  1TWF I;  3CMA Z;  2KPI A;  4MH4 A;  3HOZ I;  2YU9 I;  5IT9 f;  2OOX B;  1YJW 1;  3CCR 1;  3H3V J;  3CCJ 1;  4E2X A;  2PM9 A;  3GCF A;  1RO2 A;  2M6N A;  2ZAE B;  5D1P A;  1W2B Y;  1VQP Z;  3VTN A;  4EWC A;  4DGL A;  4NH1 C;  3EER A;  2R6M A;  3D9X A;  2OZK A;  3LUS A;  3J7A 4;  2OTL Z;  1YIT 1;  3KIH A;  4E30 A;  4A3B I;  1TWG I;  3I55 1;  4BY7 I;  1YUK A;  3NH5 A;  3GTQ I;  1VQ8 Z;  3NH8 A;  5C4X I;  2JR6 A;  2Q4Z A;  2VUG A;  3IX0 A;  3M3Y I;  1WII A;  1VQO 1;  1P9N A;  3S1N I;  2E9H A;  2IZ4 A;  2H85 A;  3CCL Z;  1PFT A;  1QYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...