3CPWY

The structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
72
structure length
72
Chain Sequence
SGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Crystal Structure of the Oxazolidinone Antibiotic Linezolid Bound to the 50S Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cpwY00
3CCR1 1W2BZ 1VQPZ 1K8A1 1YI2Z 1KC81 1NJI2 1Q7Y2 3CC7Z 1VQ51 1QVGZ 1YJWZ 1KD12 1QVFY 1YJN1 1Q822 1Q862 3OW2Y 3CCLZ 1VQK1 1VQ6Z 1VQ9Z 3G71Z 1Q811 3I551 1K9M1 1YJ91 3CCQ1 1N8R1 2QA41 1VQ41 1W2BY 3CMAZ 1M1K2 1VQN1 1YJ9Z 1QVGY 3CCRZ 1VQO1 1YIT1 3CCM1 1Q861 3CPWY 3CME1 3G6E1 1VQL1 1JJ2Z 1VQ5Z 1K732 1M902 1KQSZ 1VQ71 3CXCY 1YJNZ 3CC21 3I561 1VQKZ 3CCE1 3CD61 1KC82 3CC41 1VQLZ 3CCU1 1VQ81 1YIJ1 1YHQ1 3CCV1 3CCS1 2QEX1 3CCJ1 1QVFZ 1NJI1 1Q7Y1 3OW2Z 3I55Z 2OTL1 1VQ8Z 3CCQZ 3G4S1 2QA4Z 1VQ4Z 1KD11 1Q812 1Q821 1VQP1 1YI21 1JJ2Y 1S721 1VQNZ 1K9M2 3CC71 1K731 1VQOZ 1YITZ 3CCMZ 1N8R2 2OTJ1 3CMEZ 1K8A2 3G6EZ 3CCL1 1S72Z 1VQ61 1VQM1 1VQ7Z 1VQ91 3G711 2OTJZ 3I56Z 3CC2Z 1M1K1 3CCEZ 3CD6Z 3CPWZ 3CC4Z 3CCUZ 1YIJZ 1VQMZ 1YHQZ 3CCVZ 3CMA1 3CCSZ 2QEXZ 3CCJZ 3CXCZ 2OTLZ 3G4SZ 1M901 1KQSY 1YJW1
chains in the Genus database with same CATH superfamily
3EEDA 2K3RA 2RBLA 2V8JA 2HU9A 1YI2Z 1KC81 1NJI2 1Q7Y2 1X3ZA 3VMHA 5A2Qb 1QVGZ 3HOZI 2E2JI 1QVFY 2DE6A 1Q822 2PMZA 2J6AA 2V3VA 3Q87A 2VPZA 3J80b 2V45A 3IFUA 3I551 1YJ91 1TWFI 2QA41 3CMAZ 4A3II 4NBFA 4QTTA 1M1K2 4E2ZA 2G2KA 2R7ZI 3QWUA 2V8KA 4NBEA 5C44I 5A2Qf 1QVGY 1YUAA 4MD8A 3U50C 2OOXB 3VMGA 3M4OI 1M902 1VQ71 3GTOI 3CC21 3H0GI 4A3KI 5FLXf 2NVQI 2QKDA 1VQLZ 3S1MI 3NH8A 2JUBA 4Y7NI 1SFOI 5IT9b 3CCS1 2RIQA 3IX0A 1NJI1 1Q7Y1 3MZLB 1VQ8Z 1Y8CA 2VPWA 3HOYI 3BG1B 1Z02A 4RVFA 3BG0B 1Q812 1Q821 1RQFA 3RZDI 4A3BI 2YU9I 1JWHC 2RHBA 1VQNZ 3CC71 4TNUA 1K731 2W04A 4HH4A 2R6MA 4RVDA 4MH4A 1S72Z 5IP9I 3MZKB 4NH1C 4MD7A 3TE5B 3GCFA 1VQ91 3S1RI 2JIMA 2OOYB 2OTJZ 3I56Z 1M1K1 5IT9f 3CD6Z 3IR7A 2LEXA 2W03A 4NOZA 1YHQZ 1Y1WI 2RT9A 5LL6f 1LQLA 4E33A 2E9HA 3CXCZ 2VUMI 2OTLZ 1I3QI 1M901 1YJW1 3CCR1 3PO3I 3KIFA 1Y1VS 4XX2A 1VQPZ 2JA7I 1VQ51 1K83I 1KD12 2WAQA 2Q4ZA 1TWHI 2I3CA 2QLVB 4A3EI 1VQK1 2E7ZA 4MRIA 1N2FA 1VQ6Z 4X6AI 3G71Z 1Q811 1RLYA 1YUKA 3PO2I 2JIRA 3CCQ1 1VQ41 1RO2A 3GTMI 3HOWI 3F3FC 1S7MA 3NFZA 4MXUA 3F3PC 1YJ9Z 4RS4A 1YIT1 3CCM1 3MONA 2VUGA 3CPWY 3CME1 1NUIA 4RVGA 4E31A 3J81b 5D1OA 4NBGA 1K732 4BY7I 1KQSZ 2ZAEB 1YJNZ 5FLXb 4NBHA 2NAPA 3TDHB 2GTIA 3CCV1 3OW2Z 2VPXA 2AKLA 2P3YA 1KD11 2B63I 1NP6A 2QRCB 3J7A4 1YI21 2O4HA 2JA5I 2IZ3A 1TWGI 3J81f 4AYBA 1N8R2 1VQOZ 2Q51A 1QXFA 3G6EZ 2HF1A 1USPA 4E32A 5T6BA 4DQYB 3IF8A 5T64A 1Z01A 3CCEZ 3CC4Z 3CCUZ 3EERA 1YIJZ 4EWCA 3CMA1 2QEXZ 3CCJZ 2H85A 5T67A 4NBBA 3G4SZ 3S2HI 1ML8A 4A3CI 3H3VJ 3K7AI 2JA6I 2F4MA 3VMIA 3D9XA 1YJWZ 1WW9A 2P28A 3CQZI 2KPIA 2YADA 3CCLZ 1RO0A 2R92I 4DGLA 4E2WA 1PFTA 3P5JB 3I4MI 3S17I 1ZB8A 3ESWA 3HOXI 1I50I 3S16I 5CM2M 4S1TA 1N8R1 2RPRA 2KI7B 3GTJI 1FDIA 4BBRI 2JA8I 1VQN1 3FQMA 1TWAI 2F4OA 2E2HI 1WIIA 3NDIA 3HKZA 1Q861 2R93I 1JJ2Z 5IP7I 1Y1VI 2NVXI 4QTUA 3T4NB 1FDOA 3CXCY 2GU2A 3I561 3CD61 4DK1A 3I07A 5D1OB 1YHQ1 2M6NA 3VTNA 1QVFZ 1WCMI 3S14I 3I55Z 2OTL1 3RZOI 2QA4Z 2QR1B 2K5RA 5AN9F 1RNIA 4NB8A 2VPYA 1VQP1 1JJ2Y 2PM9A 2IZ4A 2NVTI 4A3DI 1K9M2 1RO4A 2LIYA 3HOVI 1DL6A 3GTQI 5C4JI 2BJOA 4A3GI 1QYPA 2DE7A 1VQ61 1VQM1 1VQ7Z 1X3WA 2EGTA 2QREB 3G711 3D2LA 3CC2Z 2M48A 1USPB 1Q16A 4BY1I 3FQQA 3S15I 1QF8A 3CCSZ 2JIOA 2GTHA 1WJ2A 4A3JI 5C3EI 1KQSY 2JNYA 3GTGI 1W2BZ 1X0TA 1R9TI 3HOUI 1K8A1 1ZB9A 2PK7A 2O53A 3FKII 1ZH1A 3CC7Z 3I4NI 3KIHA 3GKQA 2JIQA 3JAMb 1YJN1 1Q862 3NDJA 3OW2Y 5C4XI 4NB9A 2JR6A 1VQ9Z 1TWCI 3J80f 5D1PA 4MD9A 1K9M1 1VLAA 4CL1A 1W2BY 4A93I 4E2XA 2E2II 2OZKA 2DE5A 5FLMI 3GTLI 2WB1A 3S1NI 2V8IA 4E30A 1P9NA 3CCRZ 1VQO1 3JAMf 4RVHA 3G6E1 1VQL1 1VQ5Z 2LFUA 3VB9A 3D6WA 1VQKZ 1I6HI 3CCE1 2IV2X 1KC82 3CC41 3CCU1 3NH4A 1VQ81 1YIJ1 4A3MI 3GTPI 2QEX1 3CCJ1 4BXXI 2Y0SA 3PO3S 1SIWA 4NBCA 4Y52I 3CCQZ 3G4S1 3GTKI 1VQ4Z 4BBSI 1WZNA 1S721 2NVYI 2AYDA 3CCMZ 1YITZ 1Z03A 4MONA 3S2DI 2OTJ1 1L1OC 4HGYA 4NBAA 3CMEZ 1K8A2 3LUSA 3CCL1 4NFRA 1KRLA 2VF1A 1AA6A 4A3LI 2JMOA 3NH5A 2JIPA 2JS4A 3CPWZ 3GTMS 3M3YI 4A3FI 2QRDB 1VQMZ 3CCVZ 4E2YA 4RV9A 3S1QI 4NBDA 4HGZA 1TFIA
chains in the Genus database with same CATH topology
3EEDA 2K3RA 2RBLA 2V8JA 2HU9A 1YI2Z 1KC81 1NJI2 1Q7Y2 1X3ZA 3VMHA 5A2Qb 1QVGZ 3HOZI 2E2JI 1QVFY 2DE6A 1Q822 2PMZA 2J6AA 3Q87A 3J80b 3IFUA 3I551 1YJ91 1TWFI 2QA41 3CMAZ 4A3II 4NBFA 4QTTA 1M1K2 4E2ZA 2G2KA 2R7ZI 3QWUA 2V8KA 4NBEA 5C44I 5A2Qf 1QVGY 1YUAA 4MD8A 3U50C 2OOXB 3VMGA 3M4OI 1M902 1VQ71 3GTOI 3CC21 3H0GI 4A3KI 5FLXf 2NVQI 2QKDA 1VQLZ 3S1MI 3NH8A 2JUBA 4Y7NI 1SFOI 5IT9b 3CCS1 2RIQA 3IX0A 1NJI1 1Q7Y1 3MZLB 1VQ8Z 3HOYI 3BG1B 1Z02A 4RVFA 3BG0B 1Q812 1Q821 1RQFA 3RZDI 4A3BI 2YU9I 1JWHC 2RHBA 1VQNZ 3CC71 4TNUA 1K731 2W04A 4HH4A 2R6MA 4RVDA 4MH4A 1S72Z 5IP9I 3MZKB 4NH1C 4MD7A 1VQ91 3TE5B 3GCFA 3S1RI 2OOYB 2OTJZ 3I56Z 1M1K1 5IT9f 3CD6Z 2W03A 4NOZA 1YHQZ 1Y1WI 2RT9A 5LL6f 1LQLA 4E33A 2E9HA 3CXCZ 2VUMI 2OTLZ 1I3QI 1M901 1YJW1 3CCR1 3PO3I 3KIFA 1Y1VS 4XX2A 1VQPZ 2JA7I 1VQ51 1K83I 1KD12 2WAQA 2Q4ZA 1TWHI 2I3CA 2QLVB 4A3EI 1VQK1 4MRIA 1N2FA 1VQ6Z 4X6AI 3G71Z 1Q811 1RLYA 1YUKA 3PO2I 3CCQ1 1VQ41 1RO2A 3GTMI 3HOWI 3F3FC 1S7MA 3NFZA 4MXUA 3F3PC 1YJ9Z 4RS4A 1YIT1 3CCM1 3MONA 2VUGA 3CPWY 3CME1 1NUIA 4RVGA 4E31A 3J81b 5D1OA 4NBGA 1K732 4BY7I 1KQSZ 2ZAEB 1YJNZ 5FLXb 4NBHA 3TDHB 2GTIA 3CCV1 3OW2Z 2AKLA 2P3YA 1KD11 2B63I 1NP6A 2QRCB 3J7A4 1YI21 2O4HA 2JA5I 2IZ3A 1TWGI 3J81f 4AYBA 1N8R2 1VQOZ 2Q51A 3G6EZ 2HF1A 1USPA 4E32A 5T6BA 4DQYB 3IF8A 5T64A 1Z01A 3CCEZ 3CC4Z 3CCUZ 3EERA 1YIJZ 4EWCA 3CMA1 2QEXZ 3CCJZ 2H85A 5T67A 4NBBA 3G4SZ 3S2HI 1ML8A 4A3CI 3H3VJ 3K7AI 2JA6I 2F4MA 3VMIA 3D9XA 1YJWZ 1WW9A 2P28A 3CQZI 2KPIA 2YADA 3CCLZ 1RO0A 2R92I 4DGLA 4E2WA 1PFTA 3P5JB 3I4MI 3S17I 1ZB8A 3ESWA 3HOXI 1I50I 3S16I 5CM2M 4S1TA 1N8R1 2RPRA 2KI7B 3GTJI 4BBRI 2JA8I 1VQN1 3FQMA 1TWAI 2F4OA 2E2HI 1WIIA 3NDIA 3HKZA 1Q861 2R93I 1JJ2Z 5IP7I 1Y1VI 2NVXI 4QTUA 3T4NB 3CXCY 2GU2A 3I561 3CD61 4DK1A 3I07A 5D1OB 1YHQ1 2M6NA 3VTNA 1QVFZ 1WCMI 3S14I 3I55Z 2OTL1 3RZOI 2QA4Z 2QR1B 2K5RA 5AN9F 1RNIA 4NB8A 1VQP1 1JJ2Y 2PM9A 2IZ4A 2NVTI 4A3DI 1K9M2 1RO4A 2LIYA 3HOVI 1DL6A 3GTQI 5C4JI 2BJOA 4A3GI 1QYPA 2DE7A 1VQ61 1VQM1 1VQ7Z 1X3WA 2EGTA 2QREB 3G711 3CC2Z 2M48A 1USPB 4BY1I 3FQQA 3S15I 1QF8A 3CCSZ 2GTHA 4A3JI 5C3EI 1KQSY 2JNYA 3GTGI 1W2BZ 1X0TA 1R9TI 3HOUI 1K8A1 1ZB9A 2PK7A 2O53A 3FKII 1ZH1A 3CC7Z 3I4NI 3KIHA 3GKQA 3JAMb 1YJN1 1Q862 3NDJA 3OW2Y 5C4XI 4NB9A 2JR6A 1VQ9Z 1TWCI 3J80f 5D1PA 4MD9A 1K9M1 1VLAA 4CL1A 1W2BY 4A93I 4E2XA 2E2II 2OZKA 2DE5A 5FLMI 3GTLI 2WB1A 3S1NI 2V8IA 4E30A 1P9NA 3CCRZ 1VQO1 3JAMf 4RVHA 3G6E1 1VQL1 1VQ5Z 2LFUA 3VB9A 3D6WA 1VQKZ 1I6HI 3CCE1 1KC82 3CC41 3CCU1 3NH4A 1VQ81 1YIJ1 4A3MI 3GTPI 2QEX1 3CCJ1 4BXXI 2Y0SA 3PO3S 4NBCA 4Y52I 3CCQZ 3G4S1 3GTKI 1VQ4Z 4BBSI 1S721 2NVYI 1YITZ 3CCMZ 1Z03A 4MONA 3S2DI 2OTJ1 1L1OC 4HGYA 4NBAA 3CMEZ 1K8A2 3LUSA 3CCL1 4NFRA 1KRLA 2VF1A 4A3LI 2JMOA 3NH5A 2JS4A 3CPWZ 3GTMS 3M3YI 4A3FI 2QRDB 1VQMZ 3CCVZ 4E2YA 4RV9A 3S1QI 4NBDA 4HGZA 1TFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCR 1;  1W2B Z;  1VQP Z;  1K8A 1;  1YI2 Z;  1KC8 1;  1NJI 2;  1Q7Y 2;  3CC7 Z;  1VQ5 1;  1QVG Z;  1YJW Z;  1KD1 2;  1QVF Y;  1YJN 1;  1Q82 2;  1Q86 2;  3OW2 Y;  3CCL Z;  1VQK 1;  1VQ6 Z;  1VQ9 Z;  3G71 Z;  1Q81 1;  3I55 1;  1K9M 1;  1YJ9 1;  3CCQ 1;  1N8R 1;  2QA4 1;  1VQ4 1;  1W2B Y;  3CMA Z;  1M1K 2;  1VQN 1;  1YJ9 Z;  1QVG Y;  3CCR Z;  1VQO 1;  1YIT 1;  3CCM 1;  1Q86 1;  3CPW Y;  3CME 1;  3G6E 1;  1VQL 1;  1JJ2 Z;  1VQ5 Z;  1K73 2;  1M90 2;  1KQS Z;  1VQ7 1;  3CXC Y;  1YJN Z;  3CC2 1;  3I56 1;  1VQK Z;  3CCE 1;  3CD6 1;  1KC8 2;  3CC4 1;  1VQL Z;  3CCU 1;  1VQ8 1;  1YIJ 1;  1YHQ 1;  3CCV 1;  3CCS 1;  2QEX 1;  3CCJ 1;  1QVF Z;  1NJI 1;  1Q7Y 1;  3OW2 Z;  3I55 Z;  2OTL 1;  1VQ8 Z;  3CCQ Z;  3G4S 1;  2QA4 Z;  1VQ4 Z;  1KD1 1;  1Q81 2;  1Q82 1;  1VQP 1;  1YI2 1;  1JJ2 Y;  1S72 1;  1VQN Z;  1K9M 2;  3CC7 1;  1K73 1;  1VQO Z;  1YIT Z;  3CCM Z;  1N8R 2;  2OTJ 1;  3CME Z;  1K8A 2;  3G6E Z;  3CCL 1;  1S72 Z;  1VQ6 1;  1VQM 1;  1VQ7 Z;  1VQ9 1;  3G71 1;  2OTJ Z;  3I56 Z;  3CC2 Z;  1M1K 1;  3CCE Z;  3CD6 Z;  3CPW Z;  3CC4 Z;  3CCU Z;  1YIJ Z;  1VQM Z;  1YHQ Z;  3CCV Z;  3CMA 1;  3CCS Z;  2QEX Z;  3CCJ Z;  3CXC Z;  2OTL Z;  3G4S Z;  1M90 1;  1KQS Y;  1YJW 1; 
#chains in the Genus database with same CATH topology
 3EED A;  2K3R A;  2RBL A;  2V8J A;  2HU9 A;  1YI2 Z;  1KC8 1;  1NJI 2;  1Q7Y 2;  1X3Z A;  3VMH A;  5A2Q b;  1QVG Z;  3HOZ I;  2E2J I;  1QVF Y;  2DE6 A;  1Q82 2;  2PMZ A;  2J6A A;  2V3V A;  3Q87 A;  2VPZ A;  3J80 b;  2V45 A;  3IFU A;  3I55 1;  1YJ9 1;  1TWF I;  2QA4 1;  3CMA Z;  4A3I I;  4NBF A;  4QTT A;  1M1K 2;  4E2Z A;  2G2K A;  2R7Z I;  3QWU A;  2V8K A;  4NBE A;  5C44 I;  5A2Q f;  1QVG Y;  1YUA A;  4MD8 A;  3U50 C;  2OOX B;  3VMG A;  3M4O I;  1M90 2;  1VQ7 1;  3GTO I;  3CC2 1;  3H0G I;  4A3K I;  5FLX f;  2NVQ I;  2QKD A;  1VQL Z;  3S1M I;  3NH8 A;  2JUB A;  4Y7N I;  1SFO I;  5IT9 b;  3CCS 1;  2RIQ A;  3IX0 A;  1NJI 1;  1Q7Y 1;  3MZL B;  1VQ8 Z;  1Y8C A;  2VPW A;  3HOY I;  3BG1 B;  1Z02 A;  4RVF A;  3BG0 B;  1Q81 2;  1Q82 1;  1RQF A;  3RZD I;  4A3B I;  2YU9 I;  1JWH C;  2RHB A;  1VQN Z;  3CC7 1;  4TNU A;  1K73 1;  2W04 A;  4HH4 A;  2R6M A;  4RVD A;  4MH4 A;  1S72 Z;  5IP9 I;  3MZK B;  4NH1 C;  4MD7 A;  3TE5 B;  3GCF A;  1VQ9 1;  3S1R I;  2JIM A;  2OOY B;  2OTJ Z;  3I56 Z;  1M1K 1;  5IT9 f;  3CD6 Z;  3IR7 A;  2LEX A;  2W03 A;  4NOZ A;  1YHQ Z;  1Y1W I;  2RT9 A;  5LL6 f;  1LQL A;  4E33 A;  2E9H A;  3CXC Z;  2VUM I;  2OTL Z;  1I3Q I;  1M90 1;  1YJW 1;  3CCR 1;  3PO3 I;  3KIF A;  1Y1V S;  4XX2 A;  1VQP Z;  2JA7 I;  1VQ5 1;  1K83 I;  1KD1 2;  2WAQ A;  2Q4Z A;  1TWH I;  2I3C A;  2QLV B;  4A3E I;  1VQK 1;  2E7Z A;  4MRI A;  1N2F A;  1VQ6 Z;  4X6A I;  3G71 Z;  1Q81 1;  1RLY A;  1YUK A;  3PO2 I;  2JIR A;  3CCQ 1;  1VQ4 1;  1RO2 A;  3GTM I;  3HOW I;  3F3F C;  1S7M A;  3NFZ A;  4MXU A;  3F3P C;  1YJ9 Z;  4RS4 A;  1YIT 1;  3CCM 1;  3MON A;  2VUG A;  3CPW Y;  3CME 1;  1NUI A;  4RVG A;  4E31 A;  3J81 b;  5D1O A;  4NBG A;  1K73 2;  4BY7 I;  1KQS Z;  2ZAE B;  1YJN Z;  5FLX b;  4NBH A;  2NAP A;  3TDH B;  2GTI A;  3CCV 1;  3OW2 Z;  2VPX A;  2AKL A;  2P3Y A;  1KD1 1;  2B63 I;  1NP6 A;  2QRC B;  3J7A 4;  1YI2 1;  2O4H A;  2JA5 I;  2IZ3 A;  1TWG I;  3J81 f;  4AYB A;  1N8R 2;  1VQO Z;  2Q51 A;  1QXF A;  3G6E Z;  2HF1 A;  1USP A;  4E32 A;  5T6B A;  4DQY B;  3IF8 A;  5T64 A;  1Z01 A;  3CCE Z;  3CC4 Z;  3CCU Z;  3EER A;  1YIJ Z;  4EWC A;  3CMA 1;  2QEX Z;  3CCJ Z;  2H85 A;  5T67 A;  4NBB A;  3G4S Z;  3S2H I;  1ML8 A;  4A3C I;  3H3V J;  3K7A I;  2JA6 I;  2F4M A;  3VMI A;  3D9X A;  1YJW Z;  1WW9 A;  2P28 A;  3CQZ I;  2KPI A;  2YAD A;  3CCL Z;  1RO0 A;  2R92 I;  4DGL A;  4E2W A;  1PFT A;  3P5J B;  3I4M I;  3S17 I;  1ZB8 A;  3ESW A;  3HOX I;  1I50 I;  3S16 I;  5CM2 M;  4S1T A;  1N8R 1;  2RPR A;  2KI7 B;  3GTJ I;  1FDI A;  4BBR I;  2JA8 I;  1VQN 1;  3FQM A;  1TWA I;  2F4O A;  2E2H I;  1WII A;  3NDI A;  3HKZ A;  1Q86 1;  2R93 I;  1JJ2 Z;  5IP7 I;  1Y1V I;  2NVX I;  4QTU A;  3T4N B;  1FDO A;  3CXC Y;  2GU2 A;  3I56 1;  3CD6 1;  4DK1 A;  3I07 A;  5D1O B;  1YHQ 1;  2M6N A;  3VTN A;  1QVF Z;  1WCM I;  3S14 I;  3I55 Z;  2OTL 1;  3RZO I;  2QA4 Z;  2QR1 B;  2K5R A;  5AN9 F;  1RNI A;  4NB8 A;  2VPY A;  1VQP 1;  1JJ2 Y;  2PM9 A;  2IZ4 A;  2NVT I;  4A3D I;  1K9M 2;  1RO4 A;  2LIY A;  3HOV I;  1DL6 A;  3GTQ I;  5C4J I;  2BJO A;  4A3G I;  1QYP A;  2DE7 A;  1VQ6 1;  1VQM 1;  1VQ7 Z;  1X3W A;  2EGT A;  2QRE B;  3G71 1;  3D2L A;  3CC2 Z;  2M48 A;  1USP B;  1Q16 A;  4BY1 I;  3FQQ A;  3S15 I;  1QF8 A;  3CCS Z;  2JIO A;  2GTH A;  1WJ2 A;  4A3J I;  5C3E I;  1KQS Y;  2JNY A;  3GTG I;  1W2B Z;  1X0T A;  1R9T I;  3HOU I;  1K8A 1;  1ZB9 A;  2PK7 A;  2O53 A;  3FKI I;  1ZH1 A;  3CC7 Z;  3I4N I;  3KIH A;  3GKQ A;  2JIQ A;  3JAM b;  1YJN 1;  1Q86 2;  3NDJ A;  3OW2 Y;  5C4X I;  4NB9 A;  2JR6 A;  1VQ9 Z;  1TWC I;  3J80 f;  5D1P A;  4MD9 A;  1K9M 1;  1VLA A;  4CL1 A;  1W2B Y;  4A93 I;  4E2X A;  2E2I I;  2OZK A;  2DE5 A;  5FLM I;  3GTL I;  2WB1 A;  3S1N I;  2V8I A;  4E30 A;  1P9N A;  3CCR Z;  1VQO 1;  3JAM f;  4RVH A;  3G6E 1;  1VQL 1;  1VQ5 Z;  2LFU A;  3VB9 A;  3D6W A;  1VQK Z;  1I6H I;  3CCE 1;  2IV2 X;  1KC8 2;  3CC4 1;  3CCU 1;  3NH4 A;  1VQ8 1;  1YIJ 1;  4A3M I;  3GTP I;  2QEX 1;  3CCJ 1;  4BXX I;  2Y0S A;  3PO3 S;  1SIW A;  4NBC A;  4Y52 I;  3CCQ Z;  3G4S 1;  3GTK I;  1VQ4 Z;  4BBS I;  1WZN A;  1S72 1;  2NVY I;  2AYD A;  3CCM Z;  1YIT Z;  1Z03 A;  4MON A;  3S2D I;  2OTJ 1;  1L1O C;  4HGY A;  4NBA A;  3CME Z;  1K8A 2;  3LUS A;  3CCL 1;  4NFR A;  1KRL A;  2VF1 A;  1AA6 A;  4A3L I;  2JMO A;  3NH5 A;  2JIP A;  2JS4 A;  3CPW Z;  3GTM S;  3M3Y I;  4A3F I;  2QRD B;  1VQM Z;  3CCV Z;  4E2Y A;  4RV9 A;  3S1Q I;  4NBD A;  4HGZ A;  1TFI A; 
#chains in the Genus database with same CATH homology
 3EED A;  2K3R A;  2RBL A;  2V8J A;  2HU9 A;  1YI2 Z;  1KC8 1;  1NJI 2;  1Q7Y 2;  1X3Z A;  3VMH A;  5A2Q b;  1QVG Z;  3HOZ I;  2E2J I;  1QVF Y;  2DE6 A;  1Q82 2;  2PMZ A;  2J6A A;  3Q87 A;  3J80 b;  3IFU A;  3I55 1;  1YJ9 1;  1TWF I;  2QA4 1;  3CMA Z;  4A3I I;  4NBF A;  4QTT A;  1M1K 2;  4E2Z A;  2G2K A;  2R7Z I;  3QWU A;  2V8K A;  4NBE A;  5C44 I;  5A2Q f;  1QVG Y;  1YUA A;  4MD8 A;  3U50 C;  2OOX B;  3VMG A;  3M4O I;  1M90 2;  1VQ7 1;  3GTO I;  3CC2 1;  3H0G I;  4A3K I;  5FLX f;  2NVQ I;  2QKD A;  1VQL Z;  3S1M I;  3NH8 A;  2JUB A;  4Y7N I;  1SFO I;  5IT9 b;  3CCS 1;  2RIQ A;  3IX0 A;  1NJI 1;  1Q7Y 1;  3MZL B;  1VQ8 Z;  3HOY I;  3BG1 B;  1Z02 A;  4RVF A;  3BG0 B;  1Q81 2;  1Q82 1;  1RQF A;  3RZD I;  4A3B I;  2YU9 I;  1JWH C;  2RHB A;  1VQN Z;  3CC7 1;  4TNU A;  1K73 1;  2W04 A;  4HH4 A;  2R6M A;  4RVD A;  4MH4 A;  1S72 Z;  5IP9 I;  3MZK B;  4NH1 C;  4MD7 A;  1VQ9 1;  3TE5 B;  3GCF A;  3S1R I;  2OOY B;  2OTJ Z;  3I56 Z;  1M1K 1;  5IT9 f;  3CD6 Z;  2W03 A;  4NOZ A;  1YHQ Z;  1Y1W I;  2RT9 A;  5LL6 f;  1LQL A;  4E33 A;  2E9H A;  3CXC Z;  2VUM I;  2OTL Z;  1I3Q I;  1M90 1;  1YJW 1;  3CCR 1;  3PO3 I;  3KIF A;  1Y1V S;  4XX2 A;  1VQP Z;  2JA7 I;  1VQ5 1;  1K83 I;  1KD1 2;  2WAQ A;  2Q4Z A;  1TWH I;  2I3C A;  2QLV B;  4A3E I;  1VQK 1;  4MRI A;  1N2F A;  1VQ6 Z;  4X6A I;  3G71 Z;  1Q81 1;  1RLY A;  1YUK A;  3PO2 I;  3CCQ 1;  1VQ4 1;  1RO2 A;  3GTM I;  3HOW I;  3F3F C;  1S7M A;  3NFZ A;  4MXU A;  3F3P C;  1YJ9 Z;  4RS4 A;  1YIT 1;  3CCM 1;  3MON A;  2VUG A;  3CPW Y;  3CME 1;  1NUI A;  4RVG A;  4E31 A;  3J81 b;  5D1O A;  4NBG A;  1K73 2;  4BY7 I;  1KQS Z;  2ZAE B;  1YJN Z;  5FLX b;  4NBH A;  3TDH B;  2GTI A;  3CCV 1;  3OW2 Z;  2AKL A;  2P3Y A;  1KD1 1;  2B63 I;  1NP6 A;  2QRC B;  3J7A 4;  1YI2 1;  2O4H A;  2JA5 I;  2IZ3 A;  1TWG I;  3J81 f;  4AYB A;  1N8R 2;  1VQO Z;  2Q51 A;  3G6E Z;  2HF1 A;  1USP A;  4E32 A;  5T6B A;  4DQY B;  3IF8 A;  5T64 A;  1Z01 A;  3CCE Z;  3CC4 Z;  3CCU Z;  3EER A;  1YIJ Z;  4EWC A;  3CMA 1;  2QEX Z;  3CCJ Z;  2H85 A;  5T67 A;  4NBB A;  3G4S Z;  3S2H I;  1ML8 A;  4A3C I;  3H3V J;  3K7A I;  2JA6 I;  2F4M A;  3VMI A;  3D9X A;  1YJW Z;  1WW9 A;  2P28 A;  3CQZ I;  2KPI A;  2YAD A;  3CCL Z;  1RO0 A;  2R92 I;  4DGL A;  4E2W A;  1PFT A;  3P5J B;  3I4M I;  3S17 I;  1ZB8 A;  3ESW A;  3HOX I;  1I50 I;  3S16 I;  5CM2 M;  4S1T A;  1N8R 1;  2RPR A;  2KI7 B;  3GTJ I;  4BBR I;  2JA8 I;  1VQN 1;  3FQM A;  1TWA I;  2F4O A;  2E2H I;  1WII A;  3NDI A;  3HKZ A;  1Q86 1;  2R93 I;  1JJ2 Z;  5IP7 I;  1Y1V I;  2NVX I;  4QTU A;  3T4N B;  3CXC Y;  2GU2 A;  3I56 1;  3CD6 1;  4DK1 A;  3I07 A;  5D1O B;  1YHQ 1;  2M6N A;  3VTN A;  1QVF Z;  1WCM I;  3S14 I;  3I55 Z;  2OTL 1;  3RZO I;  2QA4 Z;  2QR1 B;  2K5R A;  5AN9 F;  1RNI A;  4NB8 A;  1VQP 1;  1JJ2 Y;  2PM9 A;  2IZ4 A;  2NVT I;  4A3D I;  1K9M 2;  1RO4 A;  2LIY A;  3HOV I;  1DL6 A;  3GTQ I;  5C4J I;  2BJO A;  4A3G I;  1QYP A;  2DE7 A;  1VQ6 1;  1VQM 1;  1VQ7 Z;  1X3W A;  2EGT A;  2QRE B;  3G71 1;  3CC2 Z;  2M48 A;  1USP B;  4BY1 I;  3FQQ A;  3S15 I;  1QF8 A;  3CCS Z;  2GTH A;  4A3J I;  5C3E I;  1KQS Y;  2JNY A;  3GTG I;  1W2B Z;  1X0T A;  1R9T I;  3HOU I;  1K8A 1;  1ZB9 A;  2PK7 A;  2O53 A;  3FKI I;  1ZH1 A;  3CC7 Z;  3I4N I;  3KIH A;  3GKQ A;  3JAM b;  1YJN 1;  1Q86 2;  3NDJ A;  3OW2 Y;  5C4X I;  4NB9 A;  2JR6 A;  1VQ9 Z;  1TWC I;  3J80 f;  5D1P A;  4MD9 A;  1K9M 1;  1VLA A;  4CL1 A;  1W2B Y;  4A93 I;  4E2X A;  2E2I I;  2OZK A;  2DE5 A;  5FLM I;  3GTL I;  2WB1 A;  3S1N I;  2V8I A;  4E30 A;  1P9N A;  3CCR Z;  1VQO 1;  3JAM f;  4RVH A;  3G6E 1;  1VQL 1;  1VQ5 Z;  2LFU A;  3VB9 A;  3D6W A;  1VQK Z;  1I6H I;  3CCE 1;  1KC8 2;  3CC4 1;  3CCU 1;  3NH4 A;  1VQ8 1;  1YIJ 1;  4A3M I;  3GTP I;  2QEX 1;  3CCJ 1;  4BXX I;  2Y0S A;  3PO3 S;  4NBC A;  4Y52 I;  3CCQ Z;  3G4S 1;  3GTK I;  1VQ4 Z;  4BBS I;  1S72 1;  2NVY I;  1YIT Z;  3CCM Z;  1Z03 A;  4MON A;  3S2D I;  2OTJ 1;  1L1O C;  4HGY A;  4NBA A;  3CME Z;  1K8A 2;  3LUS A;  3CCL 1;  4NFR A;  1KRL A;  2VF1 A;  4A3L I;  2JMO A;  3NH5 A;  2JS4 A;  3CPW Z;  3GTM S;  3M3Y I;  4A3F I;  2QRD B;  1VQM Z;  3CCV Z;  4E2Y A;  4RV9 A;  3S1Q I;  4NBD A;  4HGZ A;  1TFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...