3CPWY

The structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
72
structure length
72
Chain Sequence
SGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
publication title Crystal Structure of the Oxazolidinone Antibiotic Linezolid Bound to the 50S Ribosomal Subunit
pubmed doi rcsb
total genus 15
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cpwY00
1VQM1 1VQ51 1VQ7Z 3G4S1 2QEXZ 1YHQZ 1VQ4Z 1VQO1 1VQMZ 1KD12 1JJ2Y 3OW2Z 1VQ5Z 1VQ61 3G4SZ 1VQ81 1M1K1 1VQOZ 1VQL1 3CC71 1K731 1NJI1 1S721 1VQ6Z 3CXCY 1KC82 3OW2Y 1N8R2 1VQ8Z 1YI21 1VQLZ 1VQ91 1K9M1 1JJ2Z 1S72Z 1YI2Z 1YIJ1 1Q7Y1 3CMA1 3G711 1VQ9Z 1VQP1 1Q821 3CCV1 3CD61 1YJ9Z 3CXCZ 1YIJZ 1M1K2 3CMAZ 3CCE1 3G71Z 1VQPZ 3CPWY 3CCJ1 1K732 1NJI2 3CCVZ 1M901 3CD6Z 1KQSZ 1Q862 1Q812 3CCEZ 3CC41 3CCJZ 1K9M2 3CCU1 3G6E1 1KQSY 1YJ91 1QVFY 3CC4Z 3CC2Z 1Q822 3CPWZ 3CCUZ 2QA41 3G6EZ 3I561 3CCQ1 1K8A1 3CME1 1N8R1 2QA4Z 3I56Z 1QVFZ 3CC21 3CCQZ 1W2BZ 3CMEZ 1YJN1 1YJW1 3CCL1 1QVGZ 1VQN1 1Q7Y2 3CCS1 1W2BY 1KD11 1YJNZ 3CCM1 1YIT1 3CCLZ 1YJWZ 1VQK1 3CCR1 1QVGY 1VQNZ 3I551 2OTL1 2OTJ1 3CCSZ 1K8A2 3CCMZ 1YITZ 1VQKZ 1M902 1Q861 3CCRZ 1KC81 1VQ71 1Q811 2QEX1 3I55Z 1YHQ1 2OTLZ 2OTJZ 3CC7Z 1VQ41
chains in the Genus database with same CATH superfamily
1VQM1 1Z01A 3RZOI 3GTKI 2KPIA 2NVQI 1VQ51 4QTTA 1YHQZ 4MONA 1VQ4Z 3IFUA 3NH5A 3D2LA 2O4HA 5C4XI 2W03A 3NDIA 1RO2A 3CQZI 1VQOZ 3J80b 1K731 1X0TA 1VQ6Z 3GTJI 1TWGI 2JIRA 5FLMI 2P28A 2LEXA 1USPB 2M48A 3H3VJ 1YI2Z 3HOZI 3VTNA 3G711 1VQP1 1Z03A 1YJ9Z 4RS4A 1TWFI 5LL6f 1K732 4A3FI 2DE5A 3CD6Z 3NFZA 1DL6A 2JA7I 3U50C 3CC41 3S14I 3CCJZ 3FQMA 1QXFA 2IZ4A 2OZKA 1QVFY 2Q51A 2NAPA 2JIPA 4BY1I 3I561 1KRLA 3S1QI 2JA6I 2NVYI 4MH4A 1K8A1 2RIQA 3CME1 2QA4Z 2VPXA 2JMOA 3HOYI 2R6MA 1QVFZ 2NVTI 3VB9A 1FDIA 3TE5B 2JNYA 2R93I 1TWAI 2F4MA 3RZDI 4A3DI 1Y1VI 1YJNZ 2K3RA 4XX2A 1USPA 1YJWZ 3HOUI 1YUAA 3IX0A 2PMZA 3I551 3IF8A 3CCSZ 2M6NA 1K8A2 3CCMZ 3CCRZ 3FQQA 4NH1C 2QEX1 2E2HI 2V45A 2OTLZ 3I4MI 3NH8A 3S16I 4A3BI 2OTJZ 5FLXf 2KI7B 2QREB 3VMGA 4E30A 3GTPI 1QYPA 1WW9A 1VQ7Z 4MD7A 1AA6A 1ML8A 3M3YI 3LUSA 2VPYA 2RPRA 2LIYA 1JJ2Y 2DE6A 1Z02A 4X6AI 4E2WA 3OW2Z 3G4SZ 3S1MI 1K83I 1TWHI 1NJI1 3CXCY 2ZAEB 1N8R2 1L1OC 1VQ8Z 1JWHC 3QWUA 1VQLZ 3MONA 4NBAA 4S1TA 1K9M1 1JJ2Z 1S72Z 2IZ3A 1Q7Y1 1VQ9Z 1RQFA 4NB8A 2JIMA 3I07A 3CXCZ 1YIJZ 3EERA 1PFTA 3CMAZ 3HOVI 3NH4A 1NJI2 3CCVZ 1QF8A 4MRIA 1KQSZ 3FKII 4DQYB 1Q812 3CCEZ 2VPWA 1Y1VS 2JS4A 1K9M2 2AYDA 2PM9A 4QTUA 5IT9f 4E32A 1ZB9A 4A3CI 5C44I 4RVFA 1R9TI 3S1RI 2JUBA 2VUGA 3CCUZ 2YADA 4A3JI 3G6EZ 2HU9A 3D9XA 4RVHA 1RO4A 3J81f 3CCQ1 3GTQI 1NUIA 3KIFA 2V8JA 2QLVB 2GTIA 3CC21 4NB9A 1W2BZ 2B63I 1N2FA 4DK1A 3CCL1 1VQN1 3HOWI 2LFUA 4EWCA 1KD11 2WB1A 1ZB8A 5IP7I 5AN9F 1YIT1 5T6BA 2R7ZI 3S2HI 3GCFA 3F3FC 3K7AI 1VQKZ 1Q861 2JIQA 4AYBA 3HKZA 1YHQ1 5C3EI 1VQ41 4E2ZA 2VUMI 5IP9I 1WZNA 3PO2I 4A3KI 1VQO1 1VQMZ 1KD12 4NBEA 3JAMf 1Y1WI 1VQ5Z 1VQ61 1RO0A 1M1K1 3CC71 2QR1B 3OW2Y 3VMHA 1YI21 1YUKA 2F4OA 4RV9A 2H85A 4DGLA 1P9NA 4NOZA 4HGYA 4A3MI 1FDOA 1TWCI 2GU2A 3P5JB 5T67A 1Q821 2HF1A 3CD61 4BY7I 1M1K2 2DE7A 1SFOI 3G71Z 1VQPZ 3GTGI 3CCJ1 4NFRA 2WAQA 3S15I 1M901 4MD8A 2OOXB 2I3CA 4E2XA 2P3YA 1KQSY 2G2KA 2E2JI 3CC4Z 3CC2Z 3H0GI 2QRDB 1Q822 5D1PA 5IT9b 1Y8CA 1I3QI 2AKLA 2QA41 1ZH1A 2E9HA 4RVDA 5A2Qf 4Y7NI 3IR7A 1NP6A 3J81b 3M4OI 3I56Z 4NBCA 2BJOA 2RBLA 4BBRI 2RHBA 3CMEZ 1YJN1 1YJW1 2E7ZA 1QVGZ 3S2DI 2VF1A 1Q7Y2 3CCS1 1W2BY 3F3PC 2Y0SA 3CCM1 5D1OB 4NBGA 3CCR1 1I50I 1RLYA 2OTL1 2JR6A 2OTJ1 4NBHA 2JA8I 2EGTA 3VMIA 5C4JI 4A93I 4HGZA 1KC81 3GTMI 1VQ71 3I55Z 3KIHA 1Q16A 3CC7Z 4BBSI 2Q4ZA 3G4S1 3D6WA 2QEXZ 3J7A4 2GTHA 4MD9A 2IV2X 1WJ2A 4E2YA 2J6AA 4A3EI 3J80f 5T64A 1VQ81 2V8IA 3Q87A 3JAMb 1VQL1 1S721 3TDHB 1KC82 2YU9I 1LQLA 1VQ91 2PK7A 2W04A 5CM2M 4A3LI 3PO3I 1S7MA 3ESWA 5FLXb 1YIJ1 4A3GI 3CMA1 3GTLI 3CCV1 4E33A 2QRCB 1RNIA 3CCE1 3CPWY 3BG1B 5D1OA 1Q862 1X3ZA 2JA5I 1WIIA 2NVXI 3BG0B 2V3VA 3CCU1 2QKDA 4NBFA 3G6E1 3MZLB 4NBBA 1YJ91 4BXXI 3NDJA 3CPWZ 4A3II 3GTMS 1I6HI 3GKQA 4MXUA 2K5RA 3MZKB 4RVGA 4CL1A 3S1NI 1N8R1 3HOXI 1WCMI 4HH4A 5A2Qb 2JIOA 3EEDA 3CCQZ 4E31A 3T4NB 2OOYB 2R92I 2V8KA 2O53A 3S17I 4TNUA 3CCLZ 1VQK1 1QVGY 1VQNZ 1TFIA 3I4NI 1X3WA 2VPZA 3GTOI 4Y52I 3PO3S 2E2II 1YITZ 1VLAA 2RT9A 1M902 1SIWA 1Q811 4NBDA
chains in the Genus database with same CATH topology
1VQM1 1Z01A 3RZOI 3GTKI 2KPIA 2NVQI 1VQ51 4QTTA 1YHQZ 4MONA 1VQ4Z 3IFUA 3NH5A 2O4HA 5C4XI 2W03A 3NDIA 1RO2A 3CQZI 1VQOZ 3J80b 1K731 1X0TA 1VQ6Z 3GTJI 1TWGI 5FLMI 2P28A 1USPB 2M48A 3H3VJ 1YI2Z 3HOZI 3VTNA 3G711 1VQP1 1Z03A 1YJ9Z 4RS4A 1TWFI 5LL6f 1K732 4A3FI 2DE5A 3CD6Z 3NFZA 1DL6A 2JA7I 3U50C 3CC41 3S14I 3CCJZ 3FQMA 2IZ4A 2OZKA 1QVFY 2Q51A 4BY1I 3I561 1KRLA 3S1QI 2JA6I 2NVYI 4MH4A 1K8A1 2RIQA 3CME1 2QA4Z 2JMOA 3HOYI 2R6MA 1QVFZ 2NVTI 3TE5B 3VB9A 2R93I 2JNYA 1TWAI 2F4MA 3RZDI 4A3DI 1Y1VI 1YJNZ 2K3RA 4XX2A 1USPA 1YJWZ 3HOUI 1YUAA 3IX0A 2PMZA 3I551 3IF8A 3CCSZ 2M6NA 1K8A2 3CCMZ 3CCRZ 3FQQA 4NH1C 2QEX1 2E2HI 2OTLZ 3I4MI 3S16I 3NH8A 4A3BI 2OTJZ 5FLXf 2KI7B 2QREB 3VMGA 4E30A 3GTPI 1QYPA 1WW9A 1VQ7Z 4MD7A 1ML8A 3M3YI 3LUSA 2RPRA 2LIYA 1JJ2Y 2DE6A 1Z02A 4X6AI 4E2WA 3OW2Z 3G4SZ 3S1MI 1K83I 1TWHI 1NJI1 3CXCY 2ZAEB 1N8R2 1L1OC 1VQ8Z 1JWHC 3QWUA 1VQLZ 3MONA 4NBAA 4S1TA 1K9M1 1JJ2Z 1S72Z 2IZ3A 1Q7Y1 1VQ9Z 1RQFA 4NB8A 3I07A 3CXCZ 1YIJZ 3EERA 1PFTA 3CMAZ 3HOVI 3NH4A 1NJI2 3CCVZ 1QF8A 4MRIA 1KQSZ 3FKII 4DQYB 1Q812 3CCEZ 1Y1VS 2JS4A 1K9M2 2PM9A 4QTUA 5IT9f 4E32A 1ZB9A 4A3CI 5C44I 4RVFA 1R9TI 3S1RI 2JUBA 2VUGA 3CCUZ 2YADA 4A3JI 3G6EZ 2HU9A 3D9XA 4RVHA 1RO4A 3J81f 3CCQ1 3GTQI 1NUIA 3KIFA 2V8JA 2QLVB 2GTIA 3CC21 4NB9A 1W2BZ 2B63I 1N2FA 4DK1A 3CCL1 1VQN1 3HOWI 2LFUA 4EWCA 1KD11 2WB1A 1ZB8A 5IP7I 5AN9F 1YIT1 5T6BA 2R7ZI 3S2HI 3GCFA 3F3FC 3K7AI 1VQKZ 1Q861 4AYBA 3HKZA 1YHQ1 5C3EI 1VQ41 4E2ZA 2VUMI 5IP9I 3PO2I 4A3KI 1VQO1 1VQMZ 1KD12 4NBEA 3JAMf 1Y1WI 1VQ5Z 1VQ61 1RO0A 1M1K1 3CC71 2QR1B 3OW2Y 3VMHA 1YI21 1YUKA 2F4OA 4RV9A 2H85A 4DGLA 1P9NA 4NOZA 4HGYA 4A3MI 1TWCI 2GU2A 3P5JB 5T67A 1Q821 2HF1A 3CD61 4BY7I 1M1K2 2DE7A 1SFOI 3G71Z 1VQPZ 3GTGI 3CCJ1 4NFRA 2WAQA 3S15I 1M901 4MD8A 2OOXB 2I3CA 4E2XA 2P3YA 1KQSY 2G2KA 2E2JI 3CC4Z 3CC2Z 3H0GI 2QRDB 1Q822 5D1PA 5IT9b 1I3QI 2AKLA 2QA41 1ZH1A 2E9HA 4RVDA 5A2Qf 4Y7NI 1NP6A 3J81b 3M4OI 3I56Z 4NBCA 2BJOA 2RBLA 4BBRI 2RHBA 3CMEZ 1YJN1 1YJW1 1QVGZ 3S2DI 2VF1A 1Q7Y2 3CCS1 1W2BY 3F3PC 2Y0SA 3CCM1 5D1OB 4NBGA 3CCR1 1I50I 1RLYA 2OTL1 2JR6A 2OTJ1 4NBHA 2JA8I 2EGTA 3VMIA 5C4JI 4A93I 4HGZA 1KC81 3GTMI 1VQ71 3I55Z 3KIHA 3CC7Z 4BBSI 2Q4ZA 3G4S1 3D6WA 2QEXZ 3J7A4 2GTHA 4MD9A 4E2YA 2J6AA 4A3EI 3J80f 5T64A 1VQ81 2V8IA 3Q87A 3JAMb 1VQL1 1S721 3TDHB 1KC82 2YU9I 1LQLA 1VQ91 2PK7A 2W04A 5CM2M 4A3LI 3PO3I 1S7MA 3ESWA 5FLXb 1YIJ1 4A3GI 3CMA1 3GTLI 3CCV1 4E33A 2QRCB 1RNIA 3CCE1 3CPWY 3BG1B 5D1OA 1Q862 1X3ZA 2JA5I 1WIIA 2NVXI 3BG0B 3CCU1 2QKDA 4NBFA 3G6E1 3MZLB 4NBBA 1YJ91 4BXXI 3NDJA 3CPWZ 4A3II 3GTMS 1I6HI 3GKQA 4MXUA 2K5RA 3MZKB 4RVGA 4CL1A 3S1NI 1N8R1 1WCMI 4HH4A 5A2Qb 3HOXI 3EEDA 3CCQZ 4E31A 3T4NB 2OOYB 2R92I 2V8KA 2O53A 3S17I 4TNUA 3CCLZ 1VQK1 1QVGY 1VQNZ 1TFIA 3I4NI 1X3WA 3GTOI 4Y52I 3PO3S 2E2II 1YITZ 1VLAA 2RT9A 1M902 1Q811 4NBDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQM 1;  1VQ5 1;  1VQ7 Z;  3G4S 1;  2QEX Z;  1YHQ Z;  1VQ4 Z;  1VQO 1;  1VQM Z;  1KD1 2;  1JJ2 Y;  3OW2 Z;  1VQ5 Z;  1VQ6 1;  3G4S Z;  1VQ8 1;  1M1K 1;  1VQO Z;  1VQL 1;  3CC7 1;  1K73 1;  1NJI 1;  1S72 1;  1VQ6 Z;  3CXC Y;  1KC8 2;  3OW2 Y;  1N8R 2;  1VQ8 Z;  1YI2 1;  1VQL Z;  1VQ9 1;  1K9M 1;  1JJ2 Z;  1S72 Z;  1YI2 Z;  1YIJ 1;  1Q7Y 1;  3CMA 1;  3G71 1;  1VQ9 Z;  1VQP 1;  1Q82 1;  3CCV 1;  3CD6 1;  1YJ9 Z;  3CXC Z;  1YIJ Z;  1M1K 2;  3CMA Z;  3CCE 1;  3G71 Z;  1VQP Z;  3CPW Y;  3CCJ 1;  1K73 2;  1NJI 2;  3CCV Z;  1M90 1;  3CD6 Z;  1KQS Z;  1Q86 2;  1Q81 2;  3CCE Z;  3CC4 1;  3CCJ Z;  1K9M 2;  3CCU 1;  3G6E 1;  1KQS Y;  1YJ9 1;  1QVF Y;  3CC4 Z;  3CC2 Z;  1Q82 2;  3CPW Z;  3CCU Z;  2QA4 1;  3G6E Z;  3I56 1;  3CCQ 1;  1K8A 1;  3CME 1;  1N8R 1;  2QA4 Z;  3I56 Z;  1QVF Z;  3CC2 1;  3CCQ Z;  1W2B Z;  3CME Z;  1YJN 1;  1YJW 1;  3CCL 1;  1QVG Z;  1VQN 1;  1Q7Y 2;  3CCS 1;  1W2B Y;  1KD1 1;  1YJN Z;  3CCM 1;  1YIT 1;  3CCL Z;  1YJW Z;  1VQK 1;  3CCR 1;  1QVG Y;  1VQN Z;  3I55 1;  2OTL 1;  2OTJ 1;  3CCS Z;  1K8A 2;  3CCM Z;  1YIT Z;  1VQK Z;  1M90 2;  1Q86 1;  3CCR Z;  1KC8 1;  1VQ7 1;  1Q81 1;  2QEX 1;  3I55 Z;  1YHQ 1;  2OTL Z;  2OTJ Z;  3CC7 Z;  1VQ4 1; 
#chains in the Genus database with same CATH topology
 1VQM 1;  1Z01 A;  3RZO I;  3GTK I;  2KPI A;  2NVQ I;  1VQ5 1;  4QTT A;  1YHQ Z;  4MON A;  1VQ4 Z;  3IFU A;  3NH5 A;  3D2L A;  2O4H A;  5C4X I;  2W03 A;  3NDI A;  1RO2 A;  3CQZ I;  1VQO Z;  3J80 b;  1K73 1;  1X0T A;  1VQ6 Z;  3GTJ I;  1TWG I;  2JIR A;  5FLM I;  2P28 A;  2LEX A;  1USP B;  2M48 A;  3H3V J;  1YI2 Z;  3HOZ I;  3VTN A;  3G71 1;  1VQP 1;  1Z03 A;  1YJ9 Z;  4RS4 A;  1TWF I;  5LL6 f;  1K73 2;  4A3F I;  2DE5 A;  3CD6 Z;  3NFZ A;  1DL6 A;  2JA7 I;  3U50 C;  3CC4 1;  3S14 I;  3CCJ Z;  3FQM A;  1QXF A;  2IZ4 A;  2OZK A;  1QVF Y;  2Q51 A;  2NAP A;  2JIP A;  4BY1 I;  3I56 1;  1KRL A;  3S1Q I;  2JA6 I;  2NVY I;  4MH4 A;  1K8A 1;  2RIQ A;  3CME 1;  2QA4 Z;  2VPX A;  2JMO A;  3HOY I;  2R6M A;  1QVF Z;  2NVT I;  3VB9 A;  1FDI A;  3TE5 B;  2JNY A;  2R93 I;  1TWA I;  2F4M A;  3RZD I;  4A3D I;  1Y1V I;  1YJN Z;  2K3R A;  4XX2 A;  1USP A;  1YJW Z;  3HOU I;  1YUA A;  3IX0 A;  2PMZ A;  3I55 1;  3IF8 A;  3CCS Z;  2M6N A;  1K8A 2;  3CCM Z;  3CCR Z;  3FQQ A;  4NH1 C;  2QEX 1;  2E2H I;  2V45 A;  2OTL Z;  3I4M I;  3NH8 A;  3S16 I;  4A3B I;  2OTJ Z;  5FLX f;  2KI7 B;  2QRE B;  3VMG A;  4E30 A;  3GTP I;  1QYP A;  1WW9 A;  1VQ7 Z;  4MD7 A;  1AA6 A;  1ML8 A;  3M3Y I;  3LUS A;  2VPY A;  2RPR A;  2LIY A;  1JJ2 Y;  2DE6 A;  1Z02 A;  4X6A I;  4E2W A;  3OW2 Z;  3G4S Z;  3S1M I;  1K83 I;  1TWH I;  1NJI 1;  3CXC Y;  2ZAE B;  1N8R 2;  1L1O C;  1VQ8 Z;  1JWH C;  3QWU A;  1VQL Z;  3MON A;  4NBA A;  4S1T A;  1K9M 1;  1JJ2 Z;  1S72 Z;  2IZ3 A;  1Q7Y 1;  1VQ9 Z;  1RQF A;  4NB8 A;  2JIM A;  3I07 A;  3CXC Z;  1YIJ Z;  3EER A;  1PFT A;  3CMA Z;  3HOV I;  3NH4 A;  1NJI 2;  3CCV Z;  1QF8 A;  4MRI A;  1KQS Z;  3FKI I;  4DQY B;  1Q81 2;  3CCE Z;  2VPW A;  1Y1V S;  2JS4 A;  1K9M 2;  2AYD A;  2PM9 A;  4QTU A;  5IT9 f;  4E32 A;  1ZB9 A;  4A3C I;  5C44 I;  4RVF A;  1R9T I;  3S1R I;  2JUB A;  2VUG A;  3CCU Z;  2YAD A;  4A3J I;  3G6E Z;  2HU9 A;  3D9X A;  4RVH A;  1RO4 A;  3J81 f;  3CCQ 1;  3GTQ I;  1NUI A;  3KIF A;  2V8J A;  2QLV B;  2GTI A;  3CC2 1;  4NB9 A;  1W2B Z;  2B63 I;  1N2F A;  4DK1 A;  3CCL 1;  1VQN 1;  3HOW I;  2LFU A;  4EWC A;  1KD1 1;  2WB1 A;  1ZB8 A;  5IP7 I;  5AN9 F;  1YIT 1;  5T6B A;  2R7Z I;  3S2H I;  3GCF A;  3F3F C;  3K7A I;  1VQK Z;  1Q86 1;  2JIQ A;  4AYB A;  3HKZ A;  1YHQ 1;  5C3E I;  1VQ4 1;  4E2Z A;  2VUM I;  5IP9 I;  1WZN A;  3PO2 I;  4A3K I;  1VQO 1;  1VQM Z;  1KD1 2;  4NBE A;  3JAM f;  1Y1W I;  1VQ5 Z;  1VQ6 1;  1RO0 A;  1M1K 1;  3CC7 1;  2QR1 B;  3OW2 Y;  3VMH A;  1YI2 1;  1YUK A;  2F4O A;  4RV9 A;  2H85 A;  4DGL A;  1P9N A;  4NOZ A;  4HGY A;  4A3M I;  1FDO A;  1TWC I;  2GU2 A;  3P5J B;  5T67 A;  1Q82 1;  2HF1 A;  3CD6 1;  4BY7 I;  1M1K 2;  2DE7 A;  1SFO I;  3G71 Z;  1VQP Z;  3GTG I;  3CCJ 1;  4NFR A;  2WAQ A;  3S15 I;  1M90 1;  4MD8 A;  2OOX B;  2I3C A;  4E2X A;  2P3Y A;  1KQS Y;  2G2K A;  2E2J I;  3CC4 Z;  3CC2 Z;  3H0G I;  2QRD B;  1Q82 2;  5D1P A;  5IT9 b;  1Y8C A;  1I3Q I;  2AKL A;  2QA4 1;  1ZH1 A;  2E9H A;  4RVD A;  5A2Q f;  4Y7N I;  3IR7 A;  1NP6 A;  3J81 b;  3M4O I;  3I56 Z;  4NBC A;  2BJO A;  2RBL A;  4BBR I;  2RHB A;  3CME Z;  1YJN 1;  1YJW 1;  2E7Z A;  1QVG Z;  3S2D I;  2VF1 A;  1Q7Y 2;  3CCS 1;  1W2B Y;  3F3P C;  2Y0S A;  3CCM 1;  5D1O B;  4NBG A;  3CCR 1;  1I50 I;  1RLY A;  2OTL 1;  2JR6 A;  2OTJ 1;  4NBH A;  2JA8 I;  2EGT A;  3VMI A;  5C4J I;  4A93 I;  4HGZ A;  1KC8 1;  3GTM I;  1VQ7 1;  3I55 Z;  3KIH A;  1Q16 A;  3CC7 Z;  4BBS I;  2Q4Z A;  3G4S 1;  3D6W A;  2QEX Z;  3J7A 4;  2GTH A;  4MD9 A;  2IV2 X;  1WJ2 A;  4E2Y A;  2J6A A;  4A3E I;  3J80 f;  5T64 A;  1VQ8 1;  2V8I A;  3Q87 A;  3JAM b;  1VQL 1;  1S72 1;  3TDH B;  1KC8 2;  2YU9 I;  1LQL A;  1VQ9 1;  2PK7 A;  2W04 A;  5CM2 M;  4A3L I;  3PO3 I;  1S7M A;  3ESW A;  5FLX b;  1YIJ 1;  4A3G I;  3CMA 1;  3GTL I;  3CCV 1;  4E33 A;  2QRC B;  1RNI A;  3CCE 1;  3CPW Y;  3BG1 B;  5D1O A;  1Q86 2;  1X3Z A;  2JA5 I;  1WII A;  2NVX I;  3BG0 B;  2V3V A;  3CCU 1;  2QKD A;  4NBF A;  3G6E 1;  3MZL B;  4NBB A;  1YJ9 1;  4BXX I;  3NDJ A;  3CPW Z;  4A3I I;  3GTM S;  1I6H I;  3GKQ A;  4MXU A;  2K5R A;  3MZK B;  4RVG A;  4CL1 A;  3S1N I;  1N8R 1;  3HOX I;  1WCM I;  4HH4 A;  5A2Q b;  2JIO A;  3EED A;  3CCQ Z;  4E31 A;  3T4N B;  2OOY B;  2R92 I;  2V8K A;  2O53 A;  3S17 I;  4TNU A;  3CCL Z;  1VQK 1;  1QVG Y;  1VQN Z;  1TFI A;  3I4N I;  1X3W A;  2VPZ A;  3GTO I;  4Y52 I;  3PO3 S;  2E2I I;  1YIT Z;  1VLA A;  2RT9 A;  1M90 2;  1SIW A;  1Q81 1;  4NBD A; 
#chains in the Genus database with same CATH homology
 1VQM 1;  1Z01 A;  3RZO I;  3GTK I;  2KPI A;  2NVQ I;  1VQ5 1;  4QTT A;  1YHQ Z;  4MON A;  1VQ4 Z;  3IFU A;  3NH5 A;  2O4H A;  5C4X I;  2W03 A;  3NDI A;  1RO2 A;  3CQZ I;  1VQO Z;  3J80 b;  1K73 1;  1X0T A;  1VQ6 Z;  3GTJ I;  1TWG I;  5FLM I;  2P28 A;  1USP B;  2M48 A;  3H3V J;  1YI2 Z;  3HOZ I;  3VTN A;  3G71 1;  1VQP 1;  1Z03 A;  1YJ9 Z;  4RS4 A;  1TWF I;  5LL6 f;  1K73 2;  4A3F I;  2DE5 A;  3CD6 Z;  3NFZ A;  1DL6 A;  2JA7 I;  3U50 C;  3CC4 1;  3S14 I;  3CCJ Z;  3FQM A;  2IZ4 A;  2OZK A;  1QVF Y;  2Q51 A;  4BY1 I;  3I56 1;  1KRL A;  3S1Q I;  2JA6 I;  2NVY I;  4MH4 A;  1K8A 1;  2RIQ A;  3CME 1;  2QA4 Z;  2JMO A;  3HOY I;  2R6M A;  1QVF Z;  2NVT I;  3TE5 B;  3VB9 A;  2R93 I;  2JNY A;  1TWA I;  2F4M A;  3RZD I;  4A3D I;  1Y1V I;  1YJN Z;  2K3R A;  4XX2 A;  1USP A;  1YJW Z;  3HOU I;  1YUA A;  3IX0 A;  2PMZ A;  3I55 1;  3IF8 A;  3CCS Z;  2M6N A;  1K8A 2;  3CCM Z;  3CCR Z;  3FQQ A;  4NH1 C;  2QEX 1;  2E2H I;  2OTL Z;  3I4M I;  3S16 I;  3NH8 A;  4A3B I;  2OTJ Z;  5FLX f;  2KI7 B;  2QRE B;  3VMG A;  4E30 A;  3GTP I;  1QYP A;  1WW9 A;  1VQ7 Z;  4MD7 A;  1ML8 A;  3M3Y I;  3LUS A;  2RPR A;  2LIY A;  1JJ2 Y;  2DE6 A;  1Z02 A;  4X6A I;  4E2W A;  3OW2 Z;  3G4S Z;  3S1M I;  1K83 I;  1TWH I;  1NJI 1;  3CXC Y;  2ZAE B;  1N8R 2;  1L1O C;  1VQ8 Z;  1JWH C;  3QWU A;  1VQL Z;  3MON A;  4NBA A;  4S1T A;  1K9M 1;  1JJ2 Z;  1S72 Z;  2IZ3 A;  1Q7Y 1;  1VQ9 Z;  1RQF A;  4NB8 A;  3I07 A;  3CXC Z;  1YIJ Z;  3EER A;  1PFT A;  3CMA Z;  3HOV I;  3NH4 A;  1NJI 2;  3CCV Z;  1QF8 A;  4MRI A;  1KQS Z;  3FKI I;  4DQY B;  1Q81 2;  3CCE Z;  1Y1V S;  2JS4 A;  1K9M 2;  2PM9 A;  4QTU A;  5IT9 f;  4E32 A;  1ZB9 A;  4A3C I;  5C44 I;  4RVF A;  1R9T I;  3S1R I;  2JUB A;  2VUG A;  3CCU Z;  2YAD A;  4A3J I;  3G6E Z;  2HU9 A;  3D9X A;  4RVH A;  1RO4 A;  3J81 f;  3CCQ 1;  3GTQ I;  1NUI A;  3KIF A;  2V8J A;  2QLV B;  2GTI A;  3CC2 1;  4NB9 A;  1W2B Z;  2B63 I;  1N2F A;  4DK1 A;  3CCL 1;  1VQN 1;  3HOW I;  2LFU A;  4EWC A;  1KD1 1;  2WB1 A;  1ZB8 A;  5IP7 I;  5AN9 F;  1YIT 1;  5T6B A;  2R7Z I;  3S2H I;  3GCF A;  3F3F C;  3K7A I;  1VQK Z;  1Q86 1;  4AYB A;  3HKZ A;  1YHQ 1;  5C3E I;  1VQ4 1;  4E2Z A;  2VUM I;  5IP9 I;  3PO2 I;  4A3K I;  1VQO 1;  1VQM Z;  1KD1 2;  4NBE A;  3JAM f;  1Y1W I;  1VQ5 Z;  1VQ6 1;  1RO0 A;  1M1K 1;  3CC7 1;  2QR1 B;  3OW2 Y;  3VMH A;  1YI2 1;  1YUK A;  2F4O A;  4RV9 A;  2H85 A;  4DGL A;  1P9N A;  4NOZ A;  4HGY A;  4A3M I;  1TWC I;  2GU2 A;  3P5J B;  5T67 A;  1Q82 1;  2HF1 A;  3CD6 1;  4BY7 I;  1M1K 2;  2DE7 A;  1SFO I;  3G71 Z;  1VQP Z;  3GTG I;  3CCJ 1;  4NFR A;  2WAQ A;  3S15 I;  1M90 1;  4MD8 A;  2OOX B;  2I3C A;  4E2X A;  2P3Y A;  1KQS Y;  2G2K A;  2E2J I;  3CC4 Z;  3CC2 Z;  3H0G I;  2QRD B;  1Q82 2;  5D1P A;  5IT9 b;  1I3Q I;  2AKL A;  2QA4 1;  1ZH1 A;  2E9H A;  4RVD A;  5A2Q f;  4Y7N I;  1NP6 A;  3J81 b;  3M4O I;  3I56 Z;  4NBC A;  2BJO A;  2RBL A;  4BBR I;  2RHB A;  3CME Z;  1YJN 1;  1YJW 1;  1QVG Z;  3S2D I;  2VF1 A;  1Q7Y 2;  3CCS 1;  1W2B Y;  3F3P C;  2Y0S A;  3CCM 1;  5D1O B;  4NBG A;  3CCR 1;  1I50 I;  1RLY A;  2OTL 1;  2JR6 A;  2OTJ 1;  4NBH A;  2JA8 I;  2EGT A;  3VMI A;  5C4J I;  4A93 I;  4HGZ A;  1KC8 1;  3GTM I;  1VQ7 1;  3I55 Z;  3KIH A;  3CC7 Z;  4BBS I;  2Q4Z A;  3G4S 1;  3D6W A;  2QEX Z;  3J7A 4;  2GTH A;  4MD9 A;  4E2Y A;  2J6A A;  4A3E I;  3J80 f;  5T64 A;  1VQ8 1;  2V8I A;  3Q87 A;  3JAM b;  1VQL 1;  1S72 1;  3TDH B;  1KC8 2;  2YU9 I;  1LQL A;  1VQ9 1;  2PK7 A;  2W04 A;  5CM2 M;  4A3L I;  3PO3 I;  1S7M A;  3ESW A;  5FLX b;  1YIJ 1;  4A3G I;  3CMA 1;  3GTL I;  3CCV 1;  4E33 A;  2QRC B;  1RNI A;  3CCE 1;  3CPW Y;  3BG1 B;  5D1O A;  1Q86 2;  1X3Z A;  2JA5 I;  1WII A;  2NVX I;  3BG0 B;  3CCU 1;  2QKD A;  4NBF A;  3G6E 1;  3MZL B;  4NBB A;  1YJ9 1;  4BXX I;  3NDJ A;  3CPW Z;  4A3I I;  3GTM S;  1I6H I;  3GKQ A;  4MXU A;  2K5R A;  3MZK B;  4RVG A;  4CL1 A;  3S1N I;  1N8R 1;  1WCM I;  4HH4 A;  5A2Q b;  3HOX I;  3EED A;  3CCQ Z;  4E31 A;  3T4N B;  2OOY B;  2R92 I;  2V8K A;  2O53 A;  3S17 I;  4TNU A;  3CCL Z;  1VQK 1;  1QVG Y;  1VQN Z;  1TFI A;  3I4N I;  1X3W A;  3GTO I;  4Y52 I;  3PO3 S;  2E2I I;  1YIT Z;  1VLA A;  2RT9 A;  1M90 2;  1Q81 1;  4NBD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...