1SFOI

Rna polymerase ii strand separated elongation complex
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
119
structure length
119
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA STRAND
molecule tags Transcription/dna-rna hybrid
publication title Structural Basis of Transcription: Separation of RNA from DNA by RNA Polymerase II
pubmed doi rcsb
total genus 8
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1sfoI02
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1sfoI01
2NVQI 1I50I 4MH4A 4NB9A 2JA5I 3HOWI 4NBGA 2R92I 2YU9I 3VMHA 1Y1VS 1VLAA 2PK7A 4NBHA 3VMIA 1TWAI 2NVXI 1USPB 3S17I 3GTPI 1X3WA 2JA7I 4A3CI 5C3EI 4BY7I 2J6AA 2JR6A 3EERA 3S15I 3H0GI 2VUMI 2R7ZI 3PO3I 4QTTA 1K83I 3GTMS 1RO4A 5C4JI 3Q87A 4NB8A 3VB9A 3GTJI 4A93I 3LUSA 3S2HI 1YUAA 3GTLI 3S2DI 1TWFI 3S16I 3I07A 3I4MI 3K7AI 2DE6A 3S14I 4A3II 2K5RA 2E2HI 4A3EI 2E2II 3HOUI 1WCMI 3S1NI 1PFTA 3GCFA 3ESWA 3HOZI 5C44I 4A3MI 2F4MA 3S1QI 2JNYA 3PO3S 4Y52I 2JA6I 1L1OC 1TWGI 1DL6A 1N2FA 2B63I 3S1RI 1ML8A 3FKII 2AKLA 2NVTI 1WW9A 1QYPA 2DE5A 2F4OA 3GTMI 4NOZA 5C4XI 1I6HI 3GTGI 4A3BI 5IP7I 5FLMI 1USPA 3HOXI 4A3JI 4X6AI 3VMGA 2JA8I 3GTOI 3HOVI 2R93I 1TWHI 3H3VJ 2JS4A 1LQLA 1X3ZA 1R9TI 4A3KI 2HF1A 3I4NI 2DE7A 4XX2A 4NBBA 3HOYI 2P3YA 1I3QI 4A3FI 4A3DI 4BBSI 3M3YI 2KPIA 1TFIA 4A3LI 3RZDI 3D6WA 1ZB8A 4NBDA 3S1MI 3GTQI 3U50C 4BXXI 3GTKI 1RLYA 3RZOI 1Y1VI 2RBLA 1Y1WI 3M4OI 5IP9I 4BBRI 4NBAA 2BJOA 3CQZI 4A3GI 2NVYI 1NUIA 1TWCI 4NBEA 4QTUA 4Y7NI 3PO2I 1SFOI 5CM2M 4NBCA 1ZB9A 3GKQA 4NBFA 4BY1I 2E2JI
chains in the Genus database with same CATH superfamily
2JIRA 3HOWI 3CD61 4E2XA 4MONA 3MZKB 1NP6A 1USPB 3G71Z 1W2BZ 5A2Qf 4A3CI 5C3EI 1QVGY 3EERA 3H0GI 2OTLZ 4NB8A 3VB9A 1VQK1 1QXFA 3S2DI 1TWFI 3S16I 2WAQA 3I07A 3J81b 4MD7A 1VQO1 3S14I 2QLVB 1Q861 1VQ51 2K5RA 1Q16A 2E2II 1Q821 3F3FC 2QRCB 4RVFA 1VQ9Z 3CCE1 3GCFA 2QA4Z 2JIPA 1YJ91 4NH1C 5C44I 4A3MI 5IT9f 1S7MA 3CC21 3PO3S 1TWGI 1N2FA 1Q7Y2 3J7A4 3FKII 2RT9A 4DGLA 1Q7Y1 2ZAEB 2H85A 1QYPA 3I561 4NOZA 2K3RA 3CPWY 2RPRA 1Q811 4RVGA 1USPA 3CMA1 1YHQ1 2GTIA 1M902 3IR7A 2QR1B 1Y8CA 2OTL1 1X3ZA 1R9TI 1VQ7Z 4A3KI 2HF1A 1X0TA 4E2YA 1M1K1 1N8R1 3S1MI 3CCSZ 3QWUA 3CC41 3EEDA 4S1TA 3J80f 5T6BA 3FQQA 1VQ5Z 3CCJZ 2Q4ZA 1NJI2 3CXCZ 3M4OI 4E30A 1ZH1A 3CQZI 4A3GI 1JJ2Z 3CC2Z 1TWCI 4NBEA 3NDJA 1VQLZ 1SFOI 5CM2M 3BG1B 1KD11 4NB9A 4NBGA 2R92I 2G2KA 2YU9I 2PK7A 4NBHA 4NFRA 1TWAI 2IZ4A 1X3WA 1KQSZ 3NH5A 1VQ91 4BY7I 2J6AA 4DQYB 3S15I 3KIHA 3PO3I 4QTTA 3GTMS 3VTNA 1RO4A 3GTJI 4A93I 1YUAA 2AYDA 1VQMZ 1Q862 3I4MI 1VQP1 5FLXf 2E2HI 5AN9F 4A3EI 1YITZ 2OTJ1 3CXCY 1K8A2 4E2WA 3HOZI 4AYBA 2F4MA 1VQ4Z 1VQ71 1QVFZ 3D9XA 4MXUA 4E32A 3TE5B 1Z01A 2V8IA 5T67A 2DE5A 3I55Z 3CCJ1 2IZ3A 1FDOA 4E31A 1M901 3CMEZ 2LFUA 4A3JI 3HOXI 2LIYA 3IFUA 3CPWZ 3GTOI 3HOVI 3CCL1 3G4SZ 1QVFY 2DE7A 4NBBA 2OZKA 2P3YA 1I3QI 3CCM1 1VQ61 3M3YI 2KPIA 3IF8A 4NBDA 1YIJ1 3U50C 3KIFA 2JMOA 2PM9A 2RBLA 1JWHC 4E2ZA 3CCS1 2JIQA 5D1OB 1YIT1 2OTJZ 5IT9b 2R6MA 2YADA 1VQ41 2PMZA 1KD12 3PO2I 1YJWZ 2M48A 3GKQA 4MRIA 2Q51A 1VQM1 2RIQA 5D1PA 1KQSY 4MD9A 1VQPZ 3VMHA 4HH4A 1Y1VS 3FQMA 3VMIA 2NVXI 1QVGZ 2QA41 1W2BY 2JA7I 3MZLB 1VQNZ 3CCUZ 2VUMI 2R7ZI 3JAMb 1K83I 5A2Qb 2O4HA 3Q87A 3S2HI 3LUSA 1JJ2Y 3GTLI 2VPWA 5D1OA 2V3VA 2QEXZ 4TNUA 2V45A 3CCV1 3I551 4MD8A 2JUBA 4A3II 2W04A 3CMAZ 1K8A1 2JIMA 1WCMI 1Z03A 3MONA 1PFTA 2VUGA 3CME1 3D2LA 3CCR1 3TDHB 3ESWA 2RHBA 1KC81 2KI7B 1L1OC 1RO2A 5T64A 3P5JB 3BG0B 1KC82 1ML8A 4RV9A 4RS4A 2P28A 1VQKZ 1WW9A 2HU9A 2NAPA 2F4OA 2VPYA 2V8JA 3GTGI 4A3BI 3T4NB 2E9HA 5FLMI 2GTHA 1K9M1 1Z02A 3VMGA 2V8KA 2VPZA 1VQL1 1TWHI 3H3VJ 1S72Z 4RVHA 2WB1A 3IX0A 4HGZA 4A3DI 4A3LI 1YJN1 3CCLZ 1TFIA 1RQFA 2M6NA 1ZB8A 4CL1A 4BXXI 3GTKI 3G6E1 4DK1A 3CCMZ 1VQ6Z 2IV2X 1RLYA 3RZOI 1Y1VI 1Y1WI 4RVDA 1YI2Z 1YIJZ 3CCRZ 1VQ8Z 4NBAA 2QKDA 1AA6A 3CCU1 2LEXA 3CCQZ 1K731 4EWCA 2NVYI 1NUIA 1WJ2A 1RO0A 3CC71 1KRLA 1ZB9A 3NH4A 2NVQI 1I50I 3OW2Y 4E33A 4MH4A 2JA5I 3G711 2Y0SA 1VLAA 3S17I 3GTPI 2JIOA 2JR6A 3NFZA 1S721 2E7ZA 3F3PC 1SIWA 5C4JI 3OW2Z 2O53A 1WZNA 3J81f 3K7AI 2DE6A 1YI21 1YJ9Z 3HOUI 1VQ81 3CCVZ 3S1NI 1RNIA 3CCQ1 1YUKA 1Q822 1FDIA 3NH8A 3S1QI 2JNYA 4Y52I 2JA6I 1DL6A 2B63I 3S1RI 2I3CA 2W03A 4HGYA 2AKLA 2NVTI 2QREB 3GTMI 5C4XI 1VQOZ 3NDIA 1I6HI 3CD6Z 1YHQZ 2QRDB 1K9M2 3HKZA 5IP7I 3CCEZ 4X6AI 1Q812 2GU2A 2JA8I 2R93I 2JS4A 1LQLA 1YJW1 5FLXb 3CC7Z 3I4NI 4XX2A 3HOYI 3CC4Z 4A3FI 4BBSI 3RZDI 3D6WA 2VF1A 3GTQI 3J80b 1YJNZ 1M1K2 3I56Z 1N8R2 2OOYB 1QF8A 3JAMf 5IP9I 1VQN1 2OOXB 4BBRI 5LL6f 3G6EZ 1K732 1NJI1 2BJOA 1WIIA 2VPXA 4QTUA 2EGTA 4Y7NI 3G4S1 2QEX1 4NBCA 1P9NA 4NBFA 4BY1I 2E2JI
chains in the Genus database with same CATH topology
3HOWI 3CD61 4E2XA 4MONA 3MZKB 1NP6A 1USPB 3G71Z 1W2BZ 5A2Qf 4A3CI 5C3EI 1QVGY 3EERA 3H0GI 2OTLZ 4NB8A 3VB9A 1VQK1 3S2DI 1TWFI 3S16I 2WAQA 3I07A 3J81b 4MD7A 1VQO1 3S14I 2QLVB 1Q861 1VQ51 2K5RA 2E2II 1Q821 3F3FC 2QRCB 4RVFA 1VQ9Z 3CCE1 3GCFA 2QA4Z 1YJ91 4NH1C 5C44I 4A3MI 5IT9f 1S7MA 3CC21 3PO3S 1TWGI 1N2FA 1Q7Y2 3J7A4 3FKII 2RT9A 4DGLA 1Q7Y1 2ZAEB 2H85A 1QYPA 3I561 4NOZA 2K3RA 3CPWY 2RPRA 1Q811 4RVGA 1USPA 3CMA1 1YHQ1 2GTIA 1M902 2QR1B 2OTL1 1X3ZA 1R9TI 1VQ7Z 4A3KI 2HF1A 1X0TA 4E2YA 1M1K1 1N8R1 3S1MI 3CCSZ 3QWUA 3CC41 3EEDA 4S1TA 3J80f 5T6BA 3FQQA 1VQ5Z 3CCJZ 2Q4ZA 1NJI2 3CXCZ 3M4OI 4E30A 1ZH1A 3CQZI 4A3GI 1JJ2Z 3CC2Z 1TWCI 4NBEA 3NDJA 1VQLZ 1SFOI 5CM2M 3BG1B 1KD11 4NB9A 4NBGA 2R92I 2G2KA 2YU9I 2PK7A 4NBHA 4NFRA 1TWAI 2IZ4A 1X3WA 1KQSZ 3NH5A 1VQ91 4BY7I 2J6AA 4DQYB 3S15I 3KIHA 3PO3I 4QTTA 3GTMS 3VTNA 1RO4A 3GTJI 4A93I 1YUAA 1VQMZ 1Q862 3I4MI 1VQP1 5FLXf 2E2HI 5AN9F 4A3EI 1YITZ 2OTJ1 3CXCY 1K8A2 4E2WA 3HOZI 4AYBA 2F4MA 1VQ4Z 1VQ71 1QVFZ 3D9XA 4MXUA 4E32A 3TE5B 1Z01A 2V8IA 5T67A 2DE5A 3I55Z 3CCJ1 2IZ3A 4E31A 1M901 3CMEZ 2LFUA 4A3JI 3HOXI 2LIYA 3IFUA 3CPWZ 3GTOI 3HOVI 3CCL1 3G4SZ 1QVFY 2DE7A 4NBBA 2OZKA 2P3YA 1I3QI 3CCM1 1VQ61 3M3YI 2KPIA 3IF8A 4NBDA 1YIJ1 3U50C 3KIFA 2JMOA 2PM9A 2RBLA 1JWHC 4E2ZA 3CCS1 5D1OB 1YIT1 2OTJZ 5IT9b 2R6MA 2YADA 1VQ41 2PMZA 1KD12 3PO2I 1YJWZ 2M48A 3GKQA 4MRIA 2Q51A 1VQM1 2RIQA 5D1PA 1KQSY 4MD9A 1VQPZ 3VMHA 4HH4A 1Y1VS 3FQMA 3VMIA 2NVXI 1QVGZ 2QA41 1W2BY 2JA7I 3MZLB 1VQNZ 3CCUZ 2VUMI 2R7ZI 3JAMb 1K83I 5A2Qb 2O4HA 3Q87A 3S2HI 3LUSA 1JJ2Y 3GTLI 5D1OA 2QEXZ 4TNUA 3CCV1 3I551 4MD8A 2JUBA 4A3II 2W04A 3CMAZ 1K8A1 1WCMI 1Z03A 3MONA 1PFTA 2VUGA 3CME1 3CCR1 3TDHB 3ESWA 2RHBA 1KC81 2KI7B 1L1OC 1RO2A 5T64A 3P5JB 3BG0B 1KC82 1ML8A 4RV9A 4RS4A 2P28A 1VQKZ 1WW9A 2HU9A 2F4OA 2V8JA 3GTGI 4A3BI 3T4NB 2E9HA 5FLMI 2GTHA 1K9M1 1Z02A 3VMGA 2V8KA 1VQL1 1TWHI 3H3VJ 1S72Z 4RVHA 2WB1A 3IX0A 4HGZA 4A3DI 4A3LI 1YJN1 3CCLZ 1TFIA 1RQFA 2M6NA 1ZB8A 4CL1A 4BXXI 3GTKI 3G6E1 4DK1A 3CCMZ 1VQ6Z 1RLYA 3RZOI 1Y1VI 1Y1WI 4RVDA 1YI2Z 1YIJZ 3CCRZ 1VQ8Z 4NBAA 2QKDA 3CCU1 3CCQZ 1K731 4EWCA 2NVYI 1NUIA 1RO0A 3CC71 1KRLA 1ZB9A 3NH4A 2NVQI 1I50I 3OW2Y 4E33A 4MH4A 2JA5I 3G711 2Y0SA 1VLAA 3S17I 3GTPI 2JR6A 3NFZA 1S721 3F3PC 5C4JI 3OW2Z 2O53A 3J81f 3K7AI 2DE6A 1YI21 1YJ9Z 3HOUI 1VQ81 3CCVZ 3S1NI 1RNIA 3CCQ1 1YUKA 1Q822 3NH8A 3S1QI 2JNYA 4Y52I 2JA6I 1DL6A 2B63I 3S1RI 2I3CA 2W03A 4HGYA 2AKLA 2NVTI 2QREB 3GTMI 5C4XI 1VQOZ 3NDIA 1I6HI 3CD6Z 1YHQZ 2QRDB 1K9M2 3HKZA 5IP7I 3CCEZ 4X6AI 1Q812 2GU2A 2JA8I 2R93I 2JS4A 1LQLA 1YJW1 5FLXb 3CC7Z 3I4NI 4XX2A 3HOYI 3CC4Z 4A3FI 4BBSI 3RZDI 3D6WA 2VF1A 3GTQI 3J80b 1YJNZ 1M1K2 3I56Z 1N8R2 2OOYB 1QF8A 3JAMf 5IP9I 1VQN1 2OOXB 4BBRI 5LL6f 3G6EZ 1K732 1NJI1 2BJOA 1WIIA 4QTUA 2EGTA 4Y7NI 3G4S1 2QEX1 4NBCA 1P9NA 4NBFA 4BY1I 2E2JI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVQ I;  1I50 I;  4MH4 A;  4NB9 A;  2JA5 I;  3HOW I;  4NBG A;  2R92 I;  2YU9 I;  3VMH A;  1Y1V S;  1VLA A;  2PK7 A;  4NBH A;  3VMI A;  1TWA I;  2NVX I;  1USP B;  3S17 I;  3GTP I;  1X3W A;  2JA7 I;  4A3C I;  5C3E I;  4BY7 I;  2J6A A;  2JR6 A;  3EER A;  3S15 I;  3H0G I;  2VUM I;  2R7Z I;  3PO3 I;  4QTT A;  1K83 I;  3GTM S;  1RO4 A;  5C4J I;  3Q87 A;  4NB8 A;  3VB9 A;  3GTJ I;  4A93 I;  3LUS A;  3S2H I;  1YUA A;  3GTL I;  3S2D I;  1TWF I;  3S16 I;  3I07 A;  3I4M I;  3K7A I;  2DE6 A;  3S14 I;  4A3I I;  2K5R A;  2E2H I;  4A3E I;  2E2I I;  3HOU I;  1WCM I;  3S1N I;  1PFT A;  3GCF A;  3ESW A;  3HOZ I;  5C44 I;  4A3M I;  2F4M A;  3S1Q I;  2JNY A;  3PO3 S;  4Y52 I;  2JA6 I;  1L1O C;  1TWG I;  1DL6 A;  1N2F A;  2B63 I;  3S1R I;  1ML8 A;  3FKI I;  2AKL A;  2NVT I;  1WW9 A;  1QYP A;  2DE5 A;  2F4O A;  3GTM I;  4NOZ A;  5C4X I;  1I6H I;  3GTG I;  4A3B I;  5IP7 I;  5FLM I;  1USP A;  3HOX I;  4A3J I;  4X6A I;  3VMG A;  2JA8 I;  3GTO I;  3HOV I;  2R93 I;  1TWH I;  3H3V J;  2JS4 A;  1LQL A;  1X3Z A;  1R9T I;  4A3K I;  2HF1 A;  3I4N I;  2DE7 A;  4XX2 A;  4NBB A;  3HOY I;  2P3Y A;  1I3Q I;  4A3F I;  4A3D I;  4BBS I;  3M3Y I;  2KPI A;  1TFI A;  4A3L I;  3RZD I;  3D6W A;  1ZB8 A;  4NBD A;  3S1M I;  3GTQ I;  3U50 C;  4BXX I;  3GTK I;  1RLY A;  3RZO I;  1Y1V I;  2RBL A;  1Y1W I;  3M4O I;  5IP9 I;  4BBR I;  4NBA A;  2BJO A;  3CQZ I;  4A3G I;  2NVY I;  1NUI A;  1TWC I;  4NBE A;  4QTU A;  4Y7N I;  3PO2 I;  1SFO I;  5CM2 M;  4NBC A;  1ZB9 A;  3GKQ A;  4NBF A;  4BY1 I;  2E2J I; 
#chains in the Genus database with same CATH topology
 2JIR A;  3HOW I;  3CD6 1;  4E2X A;  4MON A;  3MZK B;  1NP6 A;  1USP B;  3G71 Z;  1W2B Z;  5A2Q f;  4A3C I;  5C3E I;  1QVG Y;  3EER A;  3H0G I;  2OTL Z;  4NB8 A;  3VB9 A;  1VQK 1;  1QXF A;  3S2D I;  1TWF I;  3S16 I;  2WAQ A;  3I07 A;  3J81 b;  4MD7 A;  1VQO 1;  3S14 I;  2QLV B;  1Q86 1;  1VQ5 1;  2K5R A;  1Q16 A;  2E2I I;  1Q82 1;  3F3F C;  2QRC B;  4RVF A;  1VQ9 Z;  3CCE 1;  3GCF A;  2QA4 Z;  2JIP A;  1YJ9 1;  4NH1 C;  5C44 I;  4A3M I;  5IT9 f;  1S7M A;  3CC2 1;  3PO3 S;  1TWG I;  1N2F A;  1Q7Y 2;  3J7A 4;  3FKI I;  2RT9 A;  4DGL A;  1Q7Y 1;  2ZAE B;  2H85 A;  1QYP A;  3I56 1;  4NOZ A;  2K3R A;  3CPW Y;  2RPR A;  1Q81 1;  4RVG A;  1USP A;  3CMA 1;  1YHQ 1;  2GTI A;  1M90 2;  3IR7 A;  2QR1 B;  1Y8C A;  2OTL 1;  1X3Z A;  1R9T I;  1VQ7 Z;  4A3K I;  2HF1 A;  1X0T A;  4E2Y A;  1M1K 1;  1N8R 1;  3S1M I;  3CCS Z;  3QWU A;  3CC4 1;  3EED A;  4S1T A;  3J80 f;  5T6B A;  3FQQ A;  1VQ5 Z;  3CCJ Z;  2Q4Z A;  1NJI 2;  3CXC Z;  3M4O I;  4E30 A;  1ZH1 A;  3CQZ I;  4A3G I;  1JJ2 Z;  3CC2 Z;  1TWC I;  4NBE A;  3NDJ A;  1VQL Z;  1SFO I;  5CM2 M;  3BG1 B;  1KD1 1;  4NB9 A;  4NBG A;  2R92 I;  2G2K A;  2YU9 I;  2PK7 A;  4NBH A;  4NFR A;  1TWA I;  2IZ4 A;  1X3W A;  1KQS Z;  3NH5 A;  1VQ9 1;  4BY7 I;  2J6A A;  4DQY B;  3S15 I;  3KIH A;  3PO3 I;  4QTT A;  3GTM S;  3VTN A;  1RO4 A;  3GTJ I;  4A93 I;  1YUA A;  2AYD A;  1VQM Z;  1Q86 2;  3I4M I;  1VQP 1;  5FLX f;  2E2H I;  5AN9 F;  4A3E I;  1YIT Z;  2OTJ 1;  3CXC Y;  1K8A 2;  4E2W A;  3HOZ I;  4AYB A;  2F4M A;  1VQ4 Z;  1VQ7 1;  1QVF Z;  3D9X A;  4MXU A;  4E32 A;  3TE5 B;  1Z01 A;  2V8I A;  5T67 A;  2DE5 A;  3I55 Z;  3CCJ 1;  2IZ3 A;  1FDO A;  4E31 A;  1M90 1;  3CME Z;  2LFU A;  4A3J I;  3HOX I;  2LIY A;  3IFU A;  3CPW Z;  3GTO I;  3HOV I;  3CCL 1;  3G4S Z;  1QVF Y;  2DE7 A;  4NBB A;  2OZK A;  2P3Y A;  1I3Q I;  3CCM 1;  1VQ6 1;  3M3Y I;  2KPI A;  3IF8 A;  4NBD A;  1YIJ 1;  3U50 C;  3KIF A;  2JMO A;  2PM9 A;  2RBL A;  1JWH C;  4E2Z A;  3CCS 1;  2JIQ A;  5D1O B;  1YIT 1;  2OTJ Z;  5IT9 b;  2R6M A;  2YAD A;  1VQ4 1;  2PMZ A;  1KD1 2;  3PO2 I;  1YJW Z;  2M48 A;  3GKQ A;  4MRI A;  2Q51 A;  1VQM 1;  2RIQ A;  5D1P A;  1KQS Y;  4MD9 A;  1VQP Z;  3VMH A;  4HH4 A;  1Y1V S;  3FQM A;  3VMI A;  2NVX I;  1QVG Z;  2QA4 1;  1W2B Y;  2JA7 I;  3MZL B;  1VQN Z;  3CCU Z;  2VUM I;  2R7Z I;  3JAM b;  1K83 I;  5A2Q b;  2O4H A;  3Q87 A;  3S2H I;  3LUS A;  1JJ2 Y;  3GTL I;  2VPW A;  5D1O A;  2V3V A;  2QEX Z;  4TNU A;  2V45 A;  3CCV 1;  3I55 1;  4MD8 A;  2JUB A;  4A3I I;  2W04 A;  3CMA Z;  1K8A 1;  2JIM A;  1WCM I;  1Z03 A;  3MON A;  1PFT A;  2VUG A;  3CME 1;  3D2L A;  3CCR 1;  3TDH B;  3ESW A;  2RHB A;  1KC8 1;  2KI7 B;  1L1O C;  1RO2 A;  5T64 A;  3P5J B;  3BG0 B;  1KC8 2;  1ML8 A;  4RV9 A;  4RS4 A;  2P28 A;  1VQK Z;  1WW9 A;  2HU9 A;  2NAP A;  2F4O A;  2VPY A;  2V8J A;  3GTG I;  4A3B I;  3T4N B;  2E9H A;  5FLM I;  2GTH A;  1K9M 1;  1Z02 A;  3VMG A;  2V8K A;  2VPZ A;  1VQL 1;  1TWH I;  3H3V J;  1S72 Z;  4RVH A;  2WB1 A;  3IX0 A;  4HGZ A;  4A3D I;  4A3L I;  1YJN 1;  3CCL Z;  1TFI A;  1RQF A;  2M6N A;  1ZB8 A;  4CL1 A;  4BXX I;  3GTK I;  3G6E 1;  4DK1 A;  3CCM Z;  1VQ6 Z;  2IV2 X;  1RLY A;  3RZO I;  1Y1V I;  1Y1W I;  4RVD A;  1YI2 Z;  1YIJ Z;  3CCR Z;  1VQ8 Z;  4NBA A;  2QKD A;  1AA6 A;  3CCU 1;  2LEX A;  3CCQ Z;  1K73 1;  4EWC A;  2NVY I;  1NUI A;  1WJ2 A;  1RO0 A;  3CC7 1;  1KRL A;  1ZB9 A;  3NH4 A;  2NVQ I;  1I50 I;  3OW2 Y;  4E33 A;  4MH4 A;  2JA5 I;  3G71 1;  2Y0S A;  1VLA A;  3S17 I;  3GTP I;  2JIO A;  2JR6 A;  3NFZ A;  1S72 1;  2E7Z A;  3F3P C;  1SIW A;  5C4J I;  3OW2 Z;  2O53 A;  1WZN A;  3J81 f;  3K7A I;  2DE6 A;  1YI2 1;  1YJ9 Z;  3HOU I;  1VQ8 1;  3CCV Z;  3S1N I;  1RNI A;  3CCQ 1;  1YUK A;  1Q82 2;  1FDI A;  3NH8 A;  3S1Q I;  2JNY A;  4Y52 I;  2JA6 I;  1DL6 A;  2B63 I;  3S1R I;  2I3C A;  2W03 A;  4HGY A;  2AKL A;  2NVT I;  2QRE B;  3GTM I;  5C4X I;  1VQO Z;  3NDI A;  1I6H I;  3CD6 Z;  1YHQ Z;  2QRD B;  1K9M 2;  3HKZ A;  5IP7 I;  3CCE Z;  4X6A I;  1Q81 2;  2GU2 A;  2JA8 I;  2R93 I;  2JS4 A;  1LQL A;  1YJW 1;  5FLX b;  3CC7 Z;  3I4N I;  4XX2 A;  3HOY I;  3CC4 Z;  4A3F I;  4BBS I;  3RZD I;  3D6W A;  2VF1 A;  3GTQ I;  3J80 b;  1YJN Z;  1M1K 2;  3I56 Z;  1N8R 2;  2OOY B;  1QF8 A;  3JAM f;  5IP9 I;  1VQN 1;  2OOX B;  4BBR I;  5LL6 f;  3G6E Z;  1K73 2;  1NJI 1;  2BJO A;  1WII A;  2VPX A;  4QTU A;  2EGT A;  4Y7N I;  3G4S 1;  2QEX 1;  4NBC A;  1P9N A;  4NBF A;  4BY1 I;  2E2J I; 
#chains in the Genus database with same CATH homology
 3HOW I;  3CD6 1;  4E2X A;  4MON A;  3MZK B;  1NP6 A;  1USP B;  3G71 Z;  1W2B Z;  5A2Q f;  4A3C I;  5C3E I;  1QVG Y;  3EER A;  3H0G I;  2OTL Z;  4NB8 A;  3VB9 A;  1VQK 1;  3S2D I;  1TWF I;  3S16 I;  2WAQ A;  3I07 A;  3J81 b;  4MD7 A;  1VQO 1;  3S14 I;  2QLV B;  1Q86 1;  1VQ5 1;  2K5R A;  2E2I I;  1Q82 1;  3F3F C;  2QRC B;  4RVF A;  1VQ9 Z;  3CCE 1;  3GCF A;  2QA4 Z;  1YJ9 1;  4NH1 C;  5C44 I;  4A3M I;  5IT9 f;  1S7M A;  3CC2 1;  3PO3 S;  1TWG I;  1N2F A;  1Q7Y 2;  3J7A 4;  3FKI I;  2RT9 A;  4DGL A;  1Q7Y 1;  2ZAE B;  2H85 A;  1QYP A;  3I56 1;  4NOZ A;  2K3R A;  3CPW Y;  2RPR A;  1Q81 1;  4RVG A;  1USP A;  3CMA 1;  1YHQ 1;  2GTI A;  1M90 2;  2QR1 B;  2OTL 1;  1X3Z A;  1R9T I;  1VQ7 Z;  4A3K I;  2HF1 A;  1X0T A;  4E2Y A;  1M1K 1;  1N8R 1;  3S1M I;  3CCS Z;  3QWU A;  3CC4 1;  3EED A;  4S1T A;  3J80 f;  5T6B A;  3FQQ A;  1VQ5 Z;  3CCJ Z;  2Q4Z A;  1NJI 2;  3CXC Z;  3M4O I;  4E30 A;  1ZH1 A;  3CQZ I;  4A3G I;  1JJ2 Z;  3CC2 Z;  1TWC I;  4NBE A;  3NDJ A;  1VQL Z;  1SFO I;  5CM2 M;  3BG1 B;  1KD1 1;  4NB9 A;  4NBG A;  2R92 I;  2G2K A;  2YU9 I;  2PK7 A;  4NBH A;  4NFR A;  1TWA I;  2IZ4 A;  1X3W A;  1KQS Z;  3NH5 A;  1VQ9 1;  4BY7 I;  2J6A A;  4DQY B;  3S15 I;  3KIH A;  3PO3 I;  4QTT A;  3GTM S;  3VTN A;  1RO4 A;  3GTJ I;  4A93 I;  1YUA A;  1VQM Z;  1Q86 2;  3I4M I;  1VQP 1;  5FLX f;  2E2H I;  5AN9 F;  4A3E I;  1YIT Z;  2OTJ 1;  3CXC Y;  1K8A 2;  4E2W A;  3HOZ I;  4AYB A;  2F4M A;  1VQ4 Z;  1VQ7 1;  1QVF Z;  3D9X A;  4MXU A;  4E32 A;  3TE5 B;  1Z01 A;  2V8I A;  5T67 A;  2DE5 A;  3I55 Z;  3CCJ 1;  2IZ3 A;  4E31 A;  1M90 1;  3CME Z;  2LFU A;  4A3J I;  3HOX I;  2LIY A;  3IFU A;  3CPW Z;  3GTO I;  3HOV I;  3CCL 1;  3G4S Z;  1QVF Y;  2DE7 A;  4NBB A;  2OZK A;  2P3Y A;  1I3Q I;  3CCM 1;  1VQ6 1;  3M3Y I;  2KPI A;  3IF8 A;  4NBD A;  1YIJ 1;  3U50 C;  3KIF A;  2JMO A;  2PM9 A;  2RBL A;  1JWH C;  4E2Z A;  3CCS 1;  5D1O B;  1YIT 1;  2OTJ Z;  5IT9 b;  2R6M A;  2YAD A;  1VQ4 1;  2PMZ A;  1KD1 2;  3PO2 I;  1YJW Z;  2M48 A;  3GKQ A;  4MRI A;  2Q51 A;  1VQM 1;  2RIQ A;  5D1P A;  1KQS Y;  4MD9 A;  1VQP Z;  3VMH A;  4HH4 A;  1Y1V S;  3FQM A;  3VMI A;  2NVX I;  1QVG Z;  2QA4 1;  1W2B Y;  2JA7 I;  3MZL B;  1VQN Z;  3CCU Z;  2VUM I;  2R7Z I;  3JAM b;  1K83 I;  5A2Q b;  2O4H A;  3Q87 A;  3S2H I;  3LUS A;  1JJ2 Y;  3GTL I;  5D1O A;  2QEX Z;  4TNU A;  3CCV 1;  3I55 1;  4MD8 A;  2JUB A;  4A3I I;  2W04 A;  3CMA Z;  1K8A 1;  1WCM I;  1Z03 A;  3MON A;  1PFT A;  2VUG A;  3CME 1;  3CCR 1;  3TDH B;  3ESW A;  2RHB A;  1KC8 1;  2KI7 B;  1L1O C;  1RO2 A;  5T64 A;  3P5J B;  3BG0 B;  1KC8 2;  1ML8 A;  4RV9 A;  4RS4 A;  2P28 A;  1VQK Z;  1WW9 A;  2HU9 A;  2F4O A;  2V8J A;  3GTG I;  4A3B I;  3T4N B;  2E9H A;  5FLM I;  2GTH A;  1K9M 1;  1Z02 A;  3VMG A;  2V8K A;  1VQL 1;  1TWH I;  3H3V J;  1S72 Z;  4RVH A;  2WB1 A;  3IX0 A;  4HGZ A;  4A3D I;  4A3L I;  1YJN 1;  3CCL Z;  1TFI A;  1RQF A;  2M6N A;  1ZB8 A;  4CL1 A;  4BXX I;  3GTK I;  3G6E 1;  4DK1 A;  3CCM Z;  1VQ6 Z;  1RLY A;  3RZO I;  1Y1V I;  1Y1W I;  4RVD A;  1YI2 Z;  1YIJ Z;  3CCR Z;  1VQ8 Z;  4NBA A;  2QKD A;  3CCU 1;  3CCQ Z;  1K73 1;  4EWC A;  2NVY I;  1NUI A;  1RO0 A;  3CC7 1;  1KRL A;  1ZB9 A;  3NH4 A;  2NVQ I;  1I50 I;  3OW2 Y;  4E33 A;  4MH4 A;  2JA5 I;  3G71 1;  2Y0S A;  1VLA A;  3S17 I;  3GTP I;  2JR6 A;  3NFZ A;  1S72 1;  3F3P C;  5C4J I;  3OW2 Z;  2O53 A;  3J81 f;  3K7A I;  2DE6 A;  1YI2 1;  1YJ9 Z;  3HOU I;  1VQ8 1;  3CCV Z;  3S1N I;  1RNI A;  3CCQ 1;  1YUK A;  1Q82 2;  3NH8 A;  3S1Q I;  2JNY A;  4Y52 I;  2JA6 I;  1DL6 A;  2B63 I;  3S1R I;  2I3C A;  2W03 A;  4HGY A;  2AKL A;  2NVT I;  2QRE B;  3GTM I;  5C4X I;  1VQO Z;  3NDI A;  1I6H I;  3CD6 Z;  1YHQ Z;  2QRD B;  1K9M 2;  3HKZ A;  5IP7 I;  3CCE Z;  4X6A I;  1Q81 2;  2GU2 A;  2JA8 I;  2R93 I;  2JS4 A;  1LQL A;  1YJW 1;  5FLX b;  3CC7 Z;  3I4N I;  4XX2 A;  3HOY I;  3CC4 Z;  4A3F I;  4BBS I;  3RZD I;  3D6W A;  2VF1 A;  3GTQ I;  3J80 b;  1YJN Z;  1M1K 2;  3I56 Z;  1N8R 2;  2OOY B;  1QF8 A;  3JAM f;  5IP9 I;  1VQN 1;  2OOX B;  4BBR I;  5LL6 f;  3G6E Z;  1K73 2;  1NJI 1;  2BJO A;  1WII A;  4QTU A;  2EGT A;  4Y7N I;  3G4S 1;  2QEX 1;  4NBC A;  1P9N A;  4NBF A;  4BY1 I;  2E2J I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...