1SFOI

Rna polymerase ii strand separated elongation complex
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA STRAND
publication title Structural Basis of Transcription: Separation of RNA from DNA by RNA Polymerase II
pubmed doi rcsb
molecule tags Transcription/dna-rna hybrid
total genus 8
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1sfoI02
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1sfoI01
2KPIA 1SFOI 4NBCA 4NBAA 1VLAA 4X6AI 4NB9A 3S1MI 2RBLA 1PFTA 1ML8A 5FLMI 1TWGI 3GKQA 3H3VJ 1Y1VS 4A3DI 4NBGA 4A3JI 3S1NI 2DE5A 3HOXI 4Y7NI 4A3II 4A3BI 1I3QI 2JS4A 1I6HI 3S15I 4QTUA 1LQLA 1YUAA 3S2DI 1L1OC 2HF1A 1USPB 2K5RA 3I4NI 2YU9I 2JNYA 3GTOI 5C4JI 3I07A 2E2JI 4NBFA 1R9TI 2JA7I 1WCMI 4A3MI 4BBSI 4NOZA 5C44I 1USPA 2JA8I 1X3WA 3HOVI 3M3YI 1K83I 4A3EI 3PO2I 3ESWA 1WW9A 3GTQI 2NVYI 3GTJI 2JA6I 4A3KI 3S1RI 2NVXI 1RLYA 3K7AI 1TWAI 4BBRI 3H0GI 3GTPI 2VUMI 3EERA 4A93I 1NUIA 4MH4A 3PO3I 3HOYI 3GTLI 1I50I 3GTKI 3GTMI 1ZB9A 5CM2M 4QTTA 1Y1WI 4NBBA 3VMIA 1TWCI 2B63I 3RZDI 4A3CI 3HOZI 3I4MI 3S17I 1N2FA 2DE6A 3LUSA 4NB8A 4A3LI 2NVQI 4BY7I 3HOUI 2P3YA 1X3ZA 4A3FI 1TWHI 3D6WA 1TWFI 3FKII 1DL6A 3S2HI 2R7ZI 3PO3S 2F4MA 3GTMS 2PK7A 4Y52I 2JR6A 4XX2A 2E2II 2AKLA 3VMGA 3U50C 2NVTI 1TFIA 2J6AA 3VB9A 3VMHA 1QYPA 5C3EI 2F4OA 5IP9I 3GTGI 4BY1I 2BJOA 3GCFA 1Y1VI 2JA5I 2R92I 4BXXI 3S1QI 2R93I 3CQZI 3Q87A 2E2HI 1ZB8A 5C4XI 1RO4A 3HOWI 2DE7A 3S16I 4NBDA 4NBHA 3M4OI 4NBEA 4A3GI 5IP7I 3RZOI 3S14I
chains in the Genus database with same CATH superfamily
2E7ZA 1VLAA 1QF8A 2HU9A 1TWGI 3CC41 3IF8A 1Q16A 2ZAEB 3H3VJ 2RPRA 3OW2Y 4A3II 4HGYA 2YADA 4E2XA 2JS4A 1K8A2 1LQLA 2W04A 1YUAA 2HF1A 3JAMf 3I4NI 1NJI1 1Q822 2Q51A 5C4JI 2E2JI 5T64A 3FQQA 4E33A 3CCV1 3PO2I 3ESWA 1WW9A 4HGZA 5FLXf 4EWCA 1VQ7Z 1M902 1JJ2Y 1YIJ1 1VQ51 3IFUA 4MH4A 3CCVZ 1VQN1 3F3FC 2WAQA 1YJ91 3GTKI 1QVFZ 1YJWZ 4DQYB 1YIJZ 1Y1WI 5IT9b 2EGTA 1TWCI 2B63I 3RZDI 4E32A 3S17I 1VQNZ 1YJ9Z 3LUSA 4NB8A 2P28A 3HOUI 2V3VA 2W03A 2P3YA 1VQP1 1RNIA 3NFZA 1VQ41 1KRLA 3D6WA 3FKII 1KQSZ 3MZKB 1QVGZ 4MD8A 1VQPZ 1KD12 2AKLA 3VMGA 1VQ4Z 1M1K2 2NVTI 2RIQA 2QEX1 3KIFA 5IP9I 1YI2Z 3GCFA 1Q812 1Y1VI 3S1QI 1YHQ1 3CQZI 2E2HI 3HOWI 3G6EZ 2DE7A 3FQMA 1YIT1 2JIRA 3S14I 3RZOI 4HH4A 1SFOI 5T6BA 2V8JA 4NBCA 3CPWY 3CCS1 1ML8A 5FLMI 2IZ3A 4CL1A 1YITZ 1SIWA 4A3DI 3J81f 4MRIA 4A3JI 3S1NI 1QXFA 3CCJ1 3CCL1 3J80f 1I6HI 4RVDA 3CCU1 3NDIA 2E9HA 3CCJZ 1USPB 2K5RA 1W2BZ 3CCLZ 2JA7I 1WCMI 4A3MI 1USPA 3CCUZ 1X0TA 1VQ91 2JIMA 1AA6A 3GTJI 2QKDA 4A3KI 3CCR1 3S1RI 3K7AI 4BBRI 2RHBA 3GTPI 3EERA 1VQ9Z 1K8A1 3JAMb 3PO3I 3HOYI 1I50I 3GTMI 1ZB9A 3TDHB 1Y8CA 3CCRZ 1K732 3TE5B 1VQ71 1RO0A 2V45A 3D2LA 3I4MI 1RQFA 2NAPA 5FLXb 2NVQI 4BY7I 2WB1A 1Q861 1TWHI 1JJ2Z 1M901 1YJW1 1S7MA 2PMZA 3CCQ1 2VPWA 4MD9A 1Z03A 1N8R2 4Y52I 3CD61 3VMHA 5C3EI 3CCQZ 1Q7Y2 3GTGI 2GTHA 2VUGA 4E2YA 2R93I 2OOXB 2VPYA 1ZB8A 3CD6Z 2V8IA 1VQK1 2LFUA 3MONA 1YI21 2QLVB 2KPIA 1QVFY 4NBAA 4E2WA 4NB9A 4RS4A 1KD11 5IT9f 1VQKZ 2VPZA 3G6E1 1M1K1 2OTJ1 1JWHC 1Y1VS 2QA4Z 2PM9A 1KQSY 2OTL1 4A3BI 1I3QI 1QVGY 3S15I 3QWUA 2OTJZ 5A2Qb 1VQO1 3NH4A 3I561 2YU9I 2OTLZ 3CC71 2OOYB 4RV9A 1KC82 1R9TI 4BBSI 5C44I 3J81b 3EEDA 2M6NA 1VQOZ 3M3YI 1K83I 2JIOA 3NH5A 4TNUA 4E2ZA 3I56Z 4NH1C 3CC7Z 1P9NA 3CXCZ 3J80b 3CCM1 3G4S1 2LEXA 2NVXI 2QRDB 1TWAI 5LL6f 2GTIA 3H0GI 4E30A 5D1OB 2VUMI 4A93I 3HKZA 1K9M1 2VPXA 1Z02A 3GTLI 1VQ8Z 1FDIA 5D1OA 3CCMZ 3G4SZ 2JIQA 4MONA 4QTTA 1WJ2A 4E31A 3CMA1 3BG0B 4A3CI 3HOZI 1ZH1A 3J7A4 3I551 4A3FI 3NDJA 1TWFI 2JUBA 1VQM1 3CMAZ 3OW2Z 1W2BY 3PO3S 5AN9F 2F4MA 3I55Z 1VQ6Z 2PK7A 3GTMS 4XX2A 2E2II 2M48A 1VQMZ 2J6AA 1K731 4DGLA 1Q821 1QYPA 4BY1I 2BJOA 2G2KA 2Q4ZA 2IV2X 4NFRA 3VTNA 3G711 3CME1 3CC4Z 2JIPA 4NBHA 1S721 4A3GI 5IP7I 2RT9A 1NJI2 4X6AI 1N8R1 1Z01A 3S1MI 2O4HA 2RBLA 3CC21 1PFTA 3G71Z 3CMEZ 2OZKA 4MD7A 1S72Z 3GKQA 4DK1A 1Q7Y1 1Q862 4NBGA 2DE5A 3HOXI 3IR7A 3CC2Z 4Y7NI 3T4NB 1YUKA 5T67A 4QTUA 3S2DI 1L1OC 4AYBA 1WZNA 2JNYA 3GTOI 2O53A 2QA41 3CCE1 2AYDA 1VQ5Z 3I07A 4NBFA 1YJN1 4NOZA 2JA8I 1X3WA 3HOVI 4A3EI 2GU2A 3GTQI 2NVYI 2R6MA 4S1TA 2JA6I 2LIYA 1Q811 3CCEZ 1RLYA 1YJNZ 3NH8A 1NUIA 2QR1B 2I3CA 2Y0SA 1RO2A 5CM2M 3CPWZ 4NBBA 3VMIA 1KC81 2QREB 4MXUA 1N2FA 2DE6A 4A3LI 1NP6A 4RVGA 1VQL1 4RVHA 1X3ZA 1VQ81 2QEXZ 3P5JB 1DL6A 3S2HI 2K3RA 2R7ZI 2KI7B 3BG1B 2V8KA 3D9XA 5A2Qf 1YHQZ 1VQLZ 2JR6A 3F3PC 4RVFA 3U50C 1TFIA 3VB9A 2JMOA 2F4OA 2IZ4A 3CXCY 2JA5I 2H85A 2R92I 4BXXI 1VQ61 3CCSZ 2VF1A 1FDOA 5D1PA 3Q87A 5C4XI 1RO4A 1K9M2 3MZLB 3S16I 2QRCB 4NBDA 1WIIA 3M4OI 4NBEA 3KIHA 3IX0A
chains in the Genus database with same CATH topology
1VLAA 1QF8A 2HU9A 1TWGI 3CC41 3IF8A 2ZAEB 3H3VJ 2RPRA 3OW2Y 4A3II 4HGYA 2YADA 4E2XA 2JS4A 1K8A2 1LQLA 2W04A 1YUAA 2HF1A 3JAMf 3I4NI 1NJI1 1Q822 2Q51A 5C4JI 2E2JI 5T64A 3FQQA 4E33A 3CCV1 3PO2I 3ESWA 1WW9A 4HGZA 5FLXf 4EWCA 1VQ7Z 1M902 1JJ2Y 1YIJ1 1VQ51 3IFUA 4MH4A 3CCVZ 1VQN1 3F3FC 2WAQA 1YJ91 3GTKI 1QVFZ 1YJWZ 4DQYB 1YIJZ 1Y1WI 5IT9b 2EGTA 1TWCI 2B63I 3RZDI 4E32A 3S17I 1VQNZ 1YJ9Z 3LUSA 4NB8A 2P28A 3HOUI 2W03A 2P3YA 1VQP1 1RNIA 3NFZA 1VQ41 1KRLA 3D6WA 3FKII 1KQSZ 3MZKB 1QVGZ 4MD8A 1VQPZ 1KD12 2AKLA 3VMGA 1VQ4Z 1M1K2 2NVTI 2RIQA 2QEX1 3KIFA 5IP9I 1YI2Z 3GCFA 1Q812 1Y1VI 3S1QI 1YHQ1 3CQZI 2E2HI 3HOWI 3G6EZ 2DE7A 3FQMA 1YIT1 3RZOI 3S14I 4HH4A 1SFOI 5T6BA 2V8JA 4NBCA 3CPWY 3CCS1 1ML8A 5FLMI 2IZ3A 4CL1A 1YITZ 4A3DI 3J81f 4MRIA 4A3JI 3S1NI 3CCJ1 3CCL1 3J80f 1I6HI 4RVDA 3CCU1 3NDIA 2E9HA 3CCJZ 1USPB 2K5RA 1W2BZ 3CCLZ 2JA7I 1WCMI 4A3MI 1USPA 3CCUZ 1X0TA 1VQ91 3GTJI 2QKDA 4A3KI 3CCR1 3S1RI 3K7AI 4BBRI 2RHBA 3GTPI 3EERA 1VQ9Z 1K8A1 3JAMb 3PO3I 3HOYI 1I50I 3GTMI 1ZB9A 3TDHB 3CCRZ 1K732 3TE5B 1VQ71 1RO0A 3I4MI 1RQFA 5FLXb 2NVQI 4BY7I 2WB1A 1Q861 1TWHI 1JJ2Z 1M901 1YJW1 1S7MA 2PMZA 3CCQ1 4MD9A 1Z03A 1N8R2 4Y52I 3CD61 3VMHA 5C3EI 3CCQZ 1Q7Y2 3GTGI 2GTHA 2VUGA 4E2YA 2R93I 2OOXB 1ZB8A 3CD6Z 2V8IA 1VQK1 2LFUA 3MONA 1YI21 2QLVB 2KPIA 1QVFY 4NBAA 4E2WA 4NB9A 4RS4A 1KD11 5IT9f 1VQKZ 3G6E1 1M1K1 2OTJ1 1JWHC 1Y1VS 2QA4Z 2PM9A 1KQSY 2OTL1 4A3BI 1I3QI 1QVGY 3S15I 3QWUA 2OTJZ 5A2Qb 1VQO1 3NH4A 3I561 2YU9I 2OTLZ 3CC71 2OOYB 4RV9A 1KC82 1R9TI 4BBSI 5C44I 3J81b 3EEDA 2M6NA 1VQOZ 3M3YI 1K83I 3NH5A 4TNUA 4E2ZA 3I56Z 4NH1C 3CC7Z 1P9NA 3CXCZ 3J80b 3CCM1 3G4S1 2NVXI 2QRDB 1TWAI 5LL6f 2GTIA 3H0GI 4E30A 5D1OB 2VUMI 4A93I 3HKZA 1K9M1 1Z02A 3GTLI 1VQ8Z 5D1OA 3CCMZ 3G4SZ 4MONA 4QTTA 4E31A 3CMA1 3BG0B 4A3CI 3HOZI 1ZH1A 3J7A4 3I551 4A3FI 3NDJA 1TWFI 2JUBA 1VQM1 3CMAZ 3OW2Z 1W2BY 3PO3S 5AN9F 2F4MA 3I55Z 1VQ6Z 2PK7A 3GTMS 4XX2A 2E2II 2M48A 1VQMZ 2J6AA 1K731 4DGLA 1Q821 1QYPA 4BY1I 2BJOA 2G2KA 2Q4ZA 4NFRA 3VTNA 3G711 3CME1 3CC4Z 4NBHA 1S721 4A3GI 5IP7I 2RT9A 1NJI2 4X6AI 1N8R1 1Z01A 3S1MI 2O4HA 2RBLA 3CC21 1PFTA 3G71Z 3CMEZ 2OZKA 4MD7A 1S72Z 3GKQA 4DK1A 1Q7Y1 1Q862 4NBGA 2DE5A 3HOXI 3CC2Z 4Y7NI 3T4NB 1YUKA 5T67A 4QTUA 3S2DI 1L1OC 4AYBA 2JNYA 3GTOI 2O53A 2QA41 3CCE1 1VQ5Z 3I07A 4NBFA 1YJN1 4NOZA 2JA8I 1X3WA 3HOVI 4A3EI 2GU2A 3GTQI 2NVYI 2R6MA 4S1TA 2JA6I 2LIYA 1Q811 3CCEZ 1RLYA 1YJNZ 3NH8A 1NUIA 2QR1B 2I3CA 2Y0SA 1RO2A 5CM2M 3CPWZ 4NBBA 3VMIA 1KC81 2QREB 4MXUA 1N2FA 2DE6A 4A3LI 1NP6A 4RVGA 1VQL1 4RVHA 1X3ZA 1VQ81 2QEXZ 3P5JB 1DL6A 3S2HI 2K3RA 2R7ZI 2KI7B 3BG1B 2V8KA 3D9XA 5A2Qf 1YHQZ 1VQLZ 2JR6A 3F3PC 4RVFA 3U50C 1TFIA 3VB9A 2JMOA 2F4OA 2IZ4A 3CXCY 2JA5I 2H85A 2R92I 4BXXI 1VQ61 3CCSZ 2VF1A 5D1PA 3Q87A 5C4XI 1RO4A 1K9M2 3MZLB 3S16I 2QRCB 4NBDA 1WIIA 3M4OI 4NBEA 3KIHA 3IX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KPI A;  1SFO I;  4NBC A;  4NBA A;  1VLA A;  4X6A I;  4NB9 A;  3S1M I;  2RBL A;  1PFT A;  1ML8 A;  5FLM I;  1TWG I;  3GKQ A;  3H3V J;  1Y1V S;  4A3D I;  4NBG A;  4A3J I;  3S1N I;  2DE5 A;  3HOX I;  4Y7N I;  4A3I I;  4A3B I;  1I3Q I;  2JS4 A;  1I6H I;  3S15 I;  4QTU A;  1LQL A;  1YUA A;  3S2D I;  1L1O C;  2HF1 A;  1USP B;  2K5R A;  3I4N I;  2YU9 I;  2JNY A;  3GTO I;  5C4J I;  3I07 A;  2E2J I;  4NBF A;  1R9T I;  2JA7 I;  1WCM I;  4A3M I;  4BBS I;  4NOZ A;  5C44 I;  1USP A;  2JA8 I;  1X3W A;  3HOV I;  3M3Y I;  1K83 I;  4A3E I;  3PO2 I;  3ESW A;  1WW9 A;  3GTQ I;  2NVY I;  3GTJ I;  2JA6 I;  4A3K I;  3S1R I;  2NVX I;  1RLY A;  3K7A I;  1TWA I;  4BBR I;  3H0G I;  3GTP I;  2VUM I;  3EER A;  4A93 I;  1NUI A;  4MH4 A;  3PO3 I;  3HOY I;  3GTL I;  1I50 I;  3GTK I;  3GTM I;  1ZB9 A;  5CM2 M;  4QTT A;  1Y1W I;  4NBB A;  3VMI A;  1TWC I;  2B63 I;  3RZD I;  4A3C I;  3HOZ I;  3I4M I;  3S17 I;  1N2F A;  2DE6 A;  3LUS A;  4NB8 A;  4A3L I;  2NVQ I;  4BY7 I;  3HOU I;  2P3Y A;  1X3Z A;  4A3F I;  1TWH I;  3D6W A;  1TWF I;  3FKI I;  1DL6 A;  3S2H I;  2R7Z I;  3PO3 S;  2F4M A;  3GTM S;  2PK7 A;  4Y52 I;  2JR6 A;  4XX2 A;  2E2I I;  2AKL A;  3VMG A;  3U50 C;  2NVT I;  1TFI A;  2J6A A;  3VB9 A;  3VMH A;  1QYP A;  5C3E I;  2F4O A;  5IP9 I;  3GTG I;  4BY1 I;  2BJO A;  3GCF A;  1Y1V I;  2JA5 I;  2R92 I;  4BXX I;  3S1Q I;  2R93 I;  3CQZ I;  3Q87 A;  2E2H I;  1ZB8 A;  5C4X I;  1RO4 A;  3HOW I;  2DE7 A;  3S16 I;  4NBD A;  4NBH A;  3M4O I;  4NBE A;  4A3G I;  5IP7 I;  3RZO I;  3S14 I; 
#chains in the Genus database with same CATH topology
 2E7Z A;  1VLA A;  1QF8 A;  2HU9 A;  1TWG I;  3CC4 1;  3IF8 A;  1Q16 A;  2ZAE B;  3H3V J;  2RPR A;  3OW2 Y;  4A3I I;  4HGY A;  2YAD A;  4E2X A;  2JS4 A;  1K8A 2;  1LQL A;  2W04 A;  1YUA A;  2HF1 A;  3JAM f;  3I4N I;  1NJI 1;  1Q82 2;  2Q51 A;  5C4J I;  2E2J I;  5T64 A;  3FQQ A;  4E33 A;  3CCV 1;  3PO2 I;  3ESW A;  1WW9 A;  4HGZ A;  5FLX f;  4EWC A;  1VQ7 Z;  1M90 2;  1JJ2 Y;  1YIJ 1;  1VQ5 1;  3IFU A;  4MH4 A;  3CCV Z;  1VQN 1;  3F3F C;  2WAQ A;  1YJ9 1;  3GTK I;  1QVF Z;  1YJW Z;  4DQY B;  1YIJ Z;  1Y1W I;  5IT9 b;  2EGT A;  1TWC I;  2B63 I;  3RZD I;  4E32 A;  3S17 I;  1VQN Z;  1YJ9 Z;  3LUS A;  4NB8 A;  2P28 A;  3HOU I;  2V3V A;  2W03 A;  2P3Y A;  1VQP 1;  1RNI A;  3NFZ A;  1VQ4 1;  1KRL A;  3D6W A;  3FKI I;  1KQS Z;  3MZK B;  1QVG Z;  4MD8 A;  1VQP Z;  1KD1 2;  2AKL A;  3VMG A;  1VQ4 Z;  1M1K 2;  2NVT I;  2RIQ A;  2QEX 1;  3KIF A;  5IP9 I;  1YI2 Z;  3GCF A;  1Q81 2;  1Y1V I;  3S1Q I;  1YHQ 1;  3CQZ I;  2E2H I;  3HOW I;  3G6E Z;  2DE7 A;  3FQM A;  1YIT 1;  2JIR A;  3S14 I;  3RZO I;  4HH4 A;  1SFO I;  5T6B A;  2V8J A;  4NBC A;  3CPW Y;  3CCS 1;  1ML8 A;  5FLM I;  2IZ3 A;  4CL1 A;  1YIT Z;  1SIW A;  4A3D I;  3J81 f;  4MRI A;  4A3J I;  3S1N I;  1QXF A;  3CCJ 1;  3CCL 1;  3J80 f;  1I6H I;  4RVD A;  3CCU 1;  3NDI A;  2E9H A;  3CCJ Z;  1USP B;  2K5R A;  1W2B Z;  3CCL Z;  2JA7 I;  1WCM I;  4A3M I;  1USP A;  3CCU Z;  1X0T A;  1VQ9 1;  2JIM A;  1AA6 A;  3GTJ I;  2QKD A;  4A3K I;  3CCR 1;  3S1R I;  3K7A I;  4BBR I;  2RHB A;  3GTP I;  3EER A;  1VQ9 Z;  1K8A 1;  3JAM b;  3PO3 I;  3HOY I;  1I50 I;  3GTM I;  1ZB9 A;  3TDH B;  1Y8C A;  3CCR Z;  1K73 2;  3TE5 B;  1VQ7 1;  1RO0 A;  2V45 A;  3D2L A;  3I4M I;  1RQF A;  2NAP A;  5FLX b;  2NVQ I;  4BY7 I;  2WB1 A;  1Q86 1;  1TWH I;  1JJ2 Z;  1M90 1;  1YJW 1;  1S7M A;  2PMZ A;  3CCQ 1;  2VPW A;  4MD9 A;  1Z03 A;  1N8R 2;  4Y52 I;  3CD6 1;  3VMH A;  5C3E I;  3CCQ Z;  1Q7Y 2;  3GTG I;  2GTH A;  2VUG A;  4E2Y A;  2R93 I;  2OOX B;  2VPY A;  1ZB8 A;  3CD6 Z;  2V8I A;  1VQK 1;  2LFU A;  3MON A;  1YI2 1;  2QLV B;  2KPI A;  1QVF Y;  4NBA A;  4E2W A;  4NB9 A;  4RS4 A;  1KD1 1;  5IT9 f;  1VQK Z;  2VPZ A;  3G6E 1;  1M1K 1;  2OTJ 1;  1JWH C;  1Y1V S;  2QA4 Z;  2PM9 A;  1KQS Y;  2OTL 1;  4A3B I;  1I3Q I;  1QVG Y;  3S15 I;  3QWU A;  2OTJ Z;  5A2Q b;  1VQO 1;  3NH4 A;  3I56 1;  2YU9 I;  2OTL Z;  3CC7 1;  2OOY B;  4RV9 A;  1KC8 2;  1R9T I;  4BBS I;  5C44 I;  3J81 b;  3EED A;  2M6N A;  1VQO Z;  3M3Y I;  1K83 I;  2JIO A;  3NH5 A;  4TNU A;  4E2Z A;  3I56 Z;  4NH1 C;  3CC7 Z;  1P9N A;  3CXC Z;  3J80 b;  3CCM 1;  3G4S 1;  2LEX A;  2NVX I;  2QRD B;  1TWA I;  5LL6 f;  2GTI A;  3H0G I;  4E30 A;  5D1O B;  2VUM I;  4A93 I;  3HKZ A;  1K9M 1;  2VPX A;  1Z02 A;  3GTL I;  1VQ8 Z;  1FDI A;  5D1O A;  3CCM Z;  3G4S Z;  2JIQ A;  4MON A;  4QTT A;  1WJ2 A;  4E31 A;  3CMA 1;  3BG0 B;  4A3C I;  3HOZ I;  1ZH1 A;  3J7A 4;  3I55 1;  4A3F I;  3NDJ A;  1TWF I;  2JUB A;  1VQM 1;  3CMA Z;  3OW2 Z;  1W2B Y;  3PO3 S;  5AN9 F;  2F4M A;  3I55 Z;  1VQ6 Z;  2PK7 A;  3GTM S;  4XX2 A;  2E2I I;  2M48 A;  1VQM Z;  2J6A A;  1K73 1;  4DGL A;  1Q82 1;  1QYP A;  4BY1 I;  2BJO A;  2G2K A;  2Q4Z A;  2IV2 X;  4NFR A;  3VTN A;  3G71 1;  3CME 1;  3CC4 Z;  2JIP A;  4NBH A;  1S72 1;  4A3G I;  5IP7 I;  2RT9 A;  1NJI 2;  4X6A I;  1N8R 1;  1Z01 A;  3S1M I;  2O4H A;  2RBL A;  3CC2 1;  1PFT A;  3G71 Z;  3CME Z;  2OZK A;  4MD7 A;  1S72 Z;  3GKQ A;  4DK1 A;  1Q7Y 1;  1Q86 2;  4NBG A;  2DE5 A;  3HOX I;  3IR7 A;  3CC2 Z;  4Y7N I;  3T4N B;  1YUK A;  5T67 A;  4QTU A;  3S2D I;  1L1O C;  4AYB A;  1WZN A;  2JNY A;  3GTO I;  2O53 A;  2QA4 1;  3CCE 1;  2AYD A;  1VQ5 Z;  3I07 A;  4NBF A;  1YJN 1;  4NOZ A;  2JA8 I;  1X3W A;  3HOV I;  4A3E I;  2GU2 A;  3GTQ I;  2NVY I;  2R6M A;  4S1T A;  2JA6 I;  2LIY A;  1Q81 1;  3CCE Z;  1RLY A;  1YJN Z;  3NH8 A;  1NUI A;  2QR1 B;  2I3C A;  2Y0S A;  1RO2 A;  5CM2 M;  3CPW Z;  4NBB A;  3VMI A;  1KC8 1;  2QRE B;  4MXU A;  1N2F A;  2DE6 A;  4A3L I;  1NP6 A;  4RVG A;  1VQL 1;  4RVH A;  1X3Z A;  1VQ8 1;  2QEX Z;  3P5J B;  1DL6 A;  3S2H I;  2K3R A;  2R7Z I;  2KI7 B;  3BG1 B;  2V8K A;  3D9X A;  5A2Q f;  1YHQ Z;  1VQL Z;  2JR6 A;  3F3P C;  4RVF A;  3U50 C;  1TFI A;  3VB9 A;  2JMO A;  2F4O A;  2IZ4 A;  3CXC Y;  2JA5 I;  2H85 A;  2R92 I;  4BXX I;  1VQ6 1;  3CCS Z;  2VF1 A;  1FDO A;  5D1P A;  3Q87 A;  5C4X I;  1RO4 A;  1K9M 2;  3MZL B;  3S16 I;  2QRC B;  4NBD A;  1WII A;  3M4O I;  4NBE A;  3KIH A;  3IX0 A; 
#chains in the Genus database with same CATH homology
 1VLA A;  1QF8 A;  2HU9 A;  1TWG I;  3CC4 1;  3IF8 A;  2ZAE B;  3H3V J;  2RPR A;  3OW2 Y;  4A3I I;  4HGY A;  2YAD A;  4E2X A;  2JS4 A;  1K8A 2;  1LQL A;  2W04 A;  1YUA A;  2HF1 A;  3JAM f;  3I4N I;  1NJI 1;  1Q82 2;  2Q51 A;  5C4J I;  2E2J I;  5T64 A;  3FQQ A;  4E33 A;  3CCV 1;  3PO2 I;  3ESW A;  1WW9 A;  4HGZ A;  5FLX f;  4EWC A;  1VQ7 Z;  1M90 2;  1JJ2 Y;  1YIJ 1;  1VQ5 1;  3IFU A;  4MH4 A;  3CCV Z;  1VQN 1;  3F3F C;  2WAQ A;  1YJ9 1;  3GTK I;  1QVF Z;  1YJW Z;  4DQY B;  1YIJ Z;  1Y1W I;  5IT9 b;  2EGT A;  1TWC I;  2B63 I;  3RZD I;  4E32 A;  3S17 I;  1VQN Z;  1YJ9 Z;  3LUS A;  4NB8 A;  2P28 A;  3HOU I;  2W03 A;  2P3Y A;  1VQP 1;  1RNI A;  3NFZ A;  1VQ4 1;  1KRL A;  3D6W A;  3FKI I;  1KQS Z;  3MZK B;  1QVG Z;  4MD8 A;  1VQP Z;  1KD1 2;  2AKL A;  3VMG A;  1VQ4 Z;  1M1K 2;  2NVT I;  2RIQ A;  2QEX 1;  3KIF A;  5IP9 I;  1YI2 Z;  3GCF A;  1Q81 2;  1Y1V I;  3S1Q I;  1YHQ 1;  3CQZ I;  2E2H I;  3HOW I;  3G6E Z;  2DE7 A;  3FQM A;  1YIT 1;  3RZO I;  3S14 I;  4HH4 A;  1SFO I;  5T6B A;  2V8J A;  4NBC A;  3CPW Y;  3CCS 1;  1ML8 A;  5FLM I;  2IZ3 A;  4CL1 A;  1YIT Z;  4A3D I;  3J81 f;  4MRI A;  4A3J I;  3S1N I;  3CCJ 1;  3CCL 1;  3J80 f;  1I6H I;  4RVD A;  3CCU 1;  3NDI A;  2E9H A;  3CCJ Z;  1USP B;  2K5R A;  1W2B Z;  3CCL Z;  2JA7 I;  1WCM I;  4A3M I;  1USP A;  3CCU Z;  1X0T A;  1VQ9 1;  3GTJ I;  2QKD A;  4A3K I;  3CCR 1;  3S1R I;  3K7A I;  4BBR I;  2RHB A;  3GTP I;  3EER A;  1VQ9 Z;  1K8A 1;  3JAM b;  3PO3 I;  3HOY I;  1I50 I;  3GTM I;  1ZB9 A;  3TDH B;  3CCR Z;  1K73 2;  3TE5 B;  1VQ7 1;  1RO0 A;  3I4M I;  1RQF A;  5FLX b;  2NVQ I;  4BY7 I;  2WB1 A;  1Q86 1;  1TWH I;  1JJ2 Z;  1M90 1;  1YJW 1;  1S7M A;  2PMZ A;  3CCQ 1;  4MD9 A;  1Z03 A;  1N8R 2;  4Y52 I;  3CD6 1;  3VMH A;  5C3E I;  3CCQ Z;  1Q7Y 2;  3GTG I;  2GTH A;  2VUG A;  4E2Y A;  2R93 I;  2OOX B;  1ZB8 A;  3CD6 Z;  2V8I A;  1VQK 1;  2LFU A;  3MON A;  1YI2 1;  2QLV B;  2KPI A;  1QVF Y;  4NBA A;  4E2W A;  4NB9 A;  4RS4 A;  1KD1 1;  5IT9 f;  1VQK Z;  3G6E 1;  1M1K 1;  2OTJ 1;  1JWH C;  1Y1V S;  2QA4 Z;  2PM9 A;  1KQS Y;  2OTL 1;  4A3B I;  1I3Q I;  1QVG Y;  3S15 I;  3QWU A;  2OTJ Z;  5A2Q b;  1VQO 1;  3NH4 A;  3I56 1;  2YU9 I;  2OTL Z;  3CC7 1;  2OOY B;  4RV9 A;  1KC8 2;  1R9T I;  4BBS I;  5C44 I;  3J81 b;  3EED A;  2M6N A;  1VQO Z;  3M3Y I;  1K83 I;  3NH5 A;  4TNU A;  4E2Z A;  3I56 Z;  4NH1 C;  3CC7 Z;  1P9N A;  3CXC Z;  3J80 b;  3CCM 1;  3G4S 1;  2NVX I;  2QRD B;  1TWA I;  5LL6 f;  2GTI A;  3H0G I;  4E30 A;  5D1O B;  2VUM I;  4A93 I;  3HKZ A;  1K9M 1;  1Z02 A;  3GTL I;  1VQ8 Z;  5D1O A;  3CCM Z;  3G4S Z;  4MON A;  4QTT A;  4E31 A;  3CMA 1;  3BG0 B;  4A3C I;  3HOZ I;  1ZH1 A;  3J7A 4;  3I55 1;  4A3F I;  3NDJ A;  1TWF I;  2JUB A;  1VQM 1;  3CMA Z;  3OW2 Z;  1W2B Y;  3PO3 S;  5AN9 F;  2F4M A;  3I55 Z;  1VQ6 Z;  2PK7 A;  3GTM S;  4XX2 A;  2E2I I;  2M48 A;  1VQM Z;  2J6A A;  1K73 1;  4DGL A;  1Q82 1;  1QYP A;  4BY1 I;  2BJO A;  2G2K A;  2Q4Z A;  4NFR A;  3VTN A;  3G71 1;  3CME 1;  3CC4 Z;  4NBH A;  1S72 1;  4A3G I;  5IP7 I;  2RT9 A;  1NJI 2;  4X6A I;  1N8R 1;  1Z01 A;  3S1M I;  2O4H A;  2RBL A;  3CC2 1;  1PFT A;  3G71 Z;  3CME Z;  2OZK A;  4MD7 A;  1S72 Z;  3GKQ A;  4DK1 A;  1Q7Y 1;  1Q86 2;  4NBG A;  2DE5 A;  3HOX I;  3CC2 Z;  4Y7N I;  3T4N B;  1YUK A;  5T67 A;  4QTU A;  3S2D I;  1L1O C;  4AYB A;  2JNY A;  3GTO I;  2O53 A;  2QA4 1;  3CCE 1;  1VQ5 Z;  3I07 A;  4NBF A;  1YJN 1;  4NOZ A;  2JA8 I;  1X3W A;  3HOV I;  4A3E I;  2GU2 A;  3GTQ I;  2NVY I;  2R6M A;  4S1T A;  2JA6 I;  2LIY A;  1Q81 1;  3CCE Z;  1RLY A;  1YJN Z;  3NH8 A;  1NUI A;  2QR1 B;  2I3C A;  2Y0S A;  1RO2 A;  5CM2 M;  3CPW Z;  4NBB A;  3VMI A;  1KC8 1;  2QRE B;  4MXU A;  1N2F A;  2DE6 A;  4A3L I;  1NP6 A;  4RVG A;  1VQL 1;  4RVH A;  1X3Z A;  1VQ8 1;  2QEX Z;  3P5J B;  1DL6 A;  3S2H I;  2K3R A;  2R7Z I;  2KI7 B;  3BG1 B;  2V8K A;  3D9X A;  5A2Q f;  1YHQ Z;  1VQL Z;  2JR6 A;  3F3P C;  4RVF A;  3U50 C;  1TFI A;  3VB9 A;  2JMO A;  2F4O A;  2IZ4 A;  3CXC Y;  2JA5 I;  2H85 A;  2R92 I;  4BXX I;  1VQ6 1;  3CCS Z;  2VF1 A;  5D1P A;  3Q87 A;  5C4X I;  1RO4 A;  1K9M 2;  3MZL B;  3S16 I;  2QRC B;  4NBD A;  1WII A;  3M4O I;  4NBE A;  3KIH A;  3IX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...