1SFOI

Rna polymerase ii strand separated elongation complex
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA STRAND
publication title Structural Basis of Transcription: Separation of RNA from DNA by RNA Polymerase II
pubmed doi rcsb
molecule tags Transcription/dna-rna hybrid
total genus 8
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1sfoI02
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1sfoI01
3GKQA 1ZB8A 2E2JI 1LQLA 2R7ZI 4A3II 3GTMI 3LUSA 2E2II 5C4XI 4BY7I 1WW9A 2KPIA 5IP9I 1R9TI 2YU9I 2DE5A 1TWCI 4A3FI 4BBSI 1Y1VI 2JA5I 3HOYI 4NBAA 3HOZI 3K7AI 4A3KI 1WCMI 3VB9A 5CM2M 4NBDA 3GTJI 1DL6A 4NOZA 3ESWA 3M3YI 3D6WA 3EERA 2HF1A 2NVYI 4A3EI 4A3CI 1USPA 4XX2A 3CQZI 3VMGA 2R92I 3PO3I 4X6AI 3GTQI 3GTKI 3S2DI 3GTPI 2NVQI 1RLYA 1YUAA 1ZB9A 2F4OA 1SFOI 3HOWI 3I4MI 4A3MI 3GTMS 3S17I 5FLMI 4Y52I 3VMIA 3PO2I 2VUMI 3S1QI 1RO4A 1Y1VS 4NBCA 1I3QI 2NVTI 2JA8I 1TWAI 2DE6A 3Q87A 2JA7I 1QYPA 2K5RA 4A3GI 3FKII 4NBFA 3H3VJ 3S1MI 4BY1I 2RBLA 2JR6A 3GCFA 3S2HI 2P3YA 3GTLI 2R93I 3GTGI 3PO3S 2BJOA 3U50C 3M4OI 5C4JI 3S1NI 4NBBA 1TWGI 1USPB 4NBGA 2JA6I 4A3JI 1VLAA 2NVXI 1X3WA 1I50I 4NB9A 4A3LI 1TWFI 3S14I 4A3DI 1N2FA 4A93I 2JS4A 4BBRI 3VMHA 1X3ZA 1NUIA 3S15I 4A3BI 3S16I 1TFIA 2DE7A 4MH4A 4NB8A 4BXXI 3H0GI 3S1RI 4NBHA 3RZDI 2B63I 2E2HI 3I4NI 5C3EI 4NBEA 3RZOI 3HOVI 4Y7NI 1PFTA 4QTTA 1L1OC 1K83I 2PK7A 1TWHI 3HOXI 3GTOI 2AKLA 3I07A 2J6AA 5IP7I 1I6HI 1Y1WI 3HOUI 5C44I 2JNYA 1ML8A 2F4MA 4QTUA
chains in the Genus database with same CATH superfamily
1Q862 1VQK1 2E2JI 3NDIA 1VQ51 3GTMI 3LUSA 5IP9I 2DE5A 1Q821 3OW2Y 1Y1VI 3HOZI 3K7AI 1Y8CA 3M3YI 3MZLB 3CC71 3D6WA 3J81f 2NVYI 1Q861 4A3CI 2V3VA 5FLXb 4RVGA 1VQ7Z 3PO3I 4MONA 5D1OA 1VQP1 3GTKI 5D1PA 1QVGZ 3GTPI 1RLYA 1ZB9A 3IR7A 4A3MI 3NH8A 2G2KA 3GTMS 2QRCB 3S17I 2JIRA 3VMIA 2VUMI 3S1QI 1QVGY 1K9M2 4RVDA 1Y1VS 4MD8A 1I3QI 3NDJA 2LEXA 1AA6A 2NVTI 3CCU1 5T64A 2VF1A 3FKII 3KIHA 2R93I 2P3YA 3GTGI 3PO3S 3U50C 3BG1B 3J81b 1VQMZ 1TWGI 1USPB 1K9M1 2V45A 2QREB 3CMEZ 1X3WA 2KI7B 2O4HA 2V8KA 3CMAZ 4A3LI 1N2FA 2K3RA 2JS4A 3VMHA 4RVFA 3CC21 3CCLZ 4E32A 1QVFZ 1YJ9Z 1Z02A 2W04A 1M902 4NBHA 5IT9f 4E30A 5AN9F 3HOVI 1PFTA 1L1OC 1VQLZ 2PK7A 2AYDA 3I07A 1W2BZ 1QVFY 3J7A4 4RS4A 3CCS1 1LQLA 3CMA1 5LL6f 1VQN1 2PM9A 2VUGA 1VQ5Z 2EGTA 1KRLA 2OZKA 1W2BY 1M901 1K731 4BY7I 2JIPA 2Y0SA 2YU9I 2YADA 1YJ91 1YHQ1 2JA5I 4A3KI 3ESWA 2QRDB 2RHBA 3D9XA 3EERA 3P5JB 4RVHA 3F3FC 1VQ61 1Q16A 3D2LA 4A3EI 1VQPZ 3NH5A 3GTQI 1NP6A 5IT9b 3S2DI 2NVQI 2VPXA 1SFOI 3HOWI 1S7MA 3I4MI 1QF8A 5T67A 3CCE1 1N8R2 4Y52I 3PO2I 3CCJZ 3G711 1YIJ1 3I551 3EEDA 3CCUZ 1X0TA 3CCQZ 2JA8I 1TWAI 2DE6A 2JA7I 3IFUA 2JUBA 4E2YA 1YITZ 3S2HI 2RPRA 1N8R1 1K8A2 1JWHC 1WIIA 2NVXI 1YJN1 5D1OB 2LIYA 3CCV1 3CCJ1 2E9HA 4A3DI 4E2WA 3CC2Z 3QWUA 3S16I 4MH4A 3CCQ1 3TDHB 2LFUA 4BXXI 3H0GI 3S1RI 1S72Z 2E7ZA 2RIQA 2IV2X 2E2HI 1K8A1 1YIT1 3HOXI 2QEX1 2AKLA 3MONA 4RV9A 3FQMA 5IP7I 1I6HI 2JNYA 4EWCA 3CCSZ 2VPYA 3MZKB 1RO0A 3GKQA 1VQNZ 1ZB8A 2R7ZI 3IX0A 4A3II 2OOXB 4MRIA 1VQO1 2HU9A 1Q812 3CD61 1WW9A 1R9TI 1YI21 1YHQZ 4MXUA 4BBSI 2QA41 3HOYI 1S721 2VPZA 5CM2M 4NBDA 3GTJI 4NOZA 1WJ2A 1VQ4Z 1WZNA 1VQ6Z 2HF1A 3CQZI 3CCM1 3VMGA 2R92I 4DGLA 1Q811 2QR1B 2I3CA 4HH4A 1YUAA 2F4OA 2PMZA 3CCEZ 2OTJ1 1FDIA 4E2ZA 5FLMI 3KIFA 2WB1A 3CCRZ 3G71Z 3F3PC 1ZH1A 4DK1A 1VQ41 3BG0B 1YIJZ 3I55Z 2VPWA 1RQFA 2IZ4A 2M48A 3I561 5A2Qf 2K5RA 2JIQA 3NH4A 1Z01A 2GU2A 3S1MI 2RBLA 2BJOA 3HKZA 5C4JI 4E33A 4E2XA 3CPWZ 4S1TA 4NBGA 1YJNZ 4A3JI 1VLAA 2JA6I 3VTNA 1I50I 3CCVZ 4NB9A 3CCR1 2GTIA 1TWFI 2JIOA 4BBRI 1X3ZA 3CPWY 1NUIA 3S15I 4A3BI 2DE7A 2V8JA 1P9NA 4NB8A 1Z03A 2GTHA 2Q51A 3FQQA 2B63I 2OTL1 3I4NI 1QXFA 5C3EI 4NBEA 2O53A 2QEXZ 4NH1C 4QTTA 3GTOI 3G6EZ 4CL1A 2J6AA 1Y1WI 3HOUI 1ML8A 1VQ91 1VQ8Z 2V8IA 1FDOA 5A2Qb 3G4SZ 1JJ2Z 1VQOZ 3CXCZ 3CD6Z 2E2II 5C4XI 1YI2Z 1SIWA 2KPIA 2JIMA 2JMOA 3TE5B 1KD12 3J80f 1TWCI 2QA4Z 4A3FI 1KQSZ 1KC82 1M1K2 4NBAA 2NAPA 1WCMI 3VB9A 1JJ2Y 1DL6A 2QLVB 3CXCY 4HGZA 4TNUA 2P28A 3G6E1 1Q7Y2 3CCMZ 1KQSY 1RO2A 1VQ81 1USPA 4XX2A 4X6AI 3CC4Z 1VQ71 1NJI2 3G4S1 1YJWZ 1KD11 1KC81 1M1K1 2OTJZ 4DQYB 3IF8A 3JAMf 2RT9A 3NFZA 1RO4A 1Q7Y1 4MD7A 4NBCA 4HGYA 4MD9A 4AYBA 2WAQA 2QKDA 1NJI1 3J80b 3I56Z 3Q87A 2ZAEB 1YUKA 1QYPA 3CC41 1K732 4A3GI 4NBFA 4E31A 3H3VJ 1YJW1 4BY1I 2JR6A 3GCFA 3GTLI 3M4OI 3S1NI 4NBBA 2IZ3A 1VQM1 2Q4ZA 2M6NA 3CME1 1VQKZ 3T4NB 3S14I 4NFRA 4A93I 1RNIA 1TFIA 5FLXf 3CCL1 3JAMb 3RZDI 5T6BA 2OTLZ 2R6MA 1Q822 3RZOI 4Y7NI 3CC7Z 1K83I 2OOYB 1TWHI 1VQL1 2H85A 1VQ9Z 5C44I 2F4MA 2W03A 4QTUA 3OW2Z
chains in the Genus database with same CATH topology
1Q862 1VQK1 2E2JI 3NDIA 1VQ51 3GTMI 3LUSA 5IP9I 2DE5A 1Q821 3OW2Y 1Y1VI 3HOZI 3K7AI 3M3YI 3MZLB 3CC71 3D6WA 3J81f 2NVYI 1Q861 4A3CI 5FLXb 4RVGA 1VQ7Z 3PO3I 4MONA 5D1OA 1VQP1 3GTKI 5D1PA 1QVGZ 3GTPI 1RLYA 1ZB9A 4A3MI 3NH8A 2G2KA 3GTMS 2QRCB 3S17I 3VMIA 2VUMI 3S1QI 1QVGY 1K9M2 4RVDA 1Y1VS 4MD8A 1I3QI 3NDJA 2NVTI 3CCU1 5T64A 2VF1A 3FKII 3KIHA 2R93I 2P3YA 3GTGI 3PO3S 3U50C 3BG1B 3J81b 1VQMZ 1TWGI 1USPB 1K9M1 2QREB 3CMEZ 1X3WA 2KI7B 2O4HA 2V8KA 3CMAZ 4A3LI 1N2FA 2K3RA 2JS4A 3VMHA 4RVFA 3CC21 3CCLZ 4E32A 1QVFZ 1YJ9Z 1Z02A 2W04A 1M902 4NBHA 5IT9f 4E30A 5AN9F 3HOVI 1PFTA 1L1OC 1VQLZ 2PK7A 3I07A 1W2BZ 1QVFY 3J7A4 4RS4A 3CCS1 1LQLA 3CMA1 5LL6f 1VQN1 2PM9A 2VUGA 1VQ5Z 2EGTA 1KRLA 2OZKA 1W2BY 1M901 1K731 4BY7I 2Y0SA 2YU9I 2YADA 1YJ91 1YHQ1 2JA5I 4A3KI 3ESWA 2QRDB 2RHBA 3D9XA 3EERA 3P5JB 4RVHA 3F3FC 1VQ61 4A3EI 1VQPZ 3NH5A 3GTQI 1NP6A 5IT9b 3S2DI 2NVQI 1SFOI 3HOWI 1S7MA 3I4MI 1QF8A 5T67A 3CCE1 1N8R2 4Y52I 3PO2I 3CCJZ 3G711 1YIJ1 3I551 3EEDA 3CCUZ 1X0TA 3CCQZ 2JA8I 1TWAI 2DE6A 2JA7I 3IFUA 2JUBA 4E2YA 1YITZ 3S2HI 2RPRA 1N8R1 1K8A2 1JWHC 1WIIA 2NVXI 1YJN1 5D1OB 2LIYA 3CCV1 3CCJ1 2E9HA 4A3DI 4E2WA 3CC2Z 3QWUA 3S16I 4MH4A 3CCQ1 3TDHB 2LFUA 4BXXI 3H0GI 3S1RI 1S72Z 2RIQA 2E2HI 1K8A1 1YIT1 3HOXI 2QEX1 2AKLA 3MONA 4RV9A 3FQMA 5IP7I 1I6HI 2JNYA 4EWCA 3CCSZ 3MZKB 1RO0A 3GKQA 1VQNZ 1ZB8A 2R7ZI 3IX0A 4A3II 2OOXB 4MRIA 1VQO1 2HU9A 1Q812 3CD61 1WW9A 1R9TI 1YI21 1YHQZ 4MXUA 4BBSI 2QA41 3HOYI 1S721 5CM2M 4NBDA 3GTJI 4NOZA 1VQ4Z 1VQ6Z 2HF1A 3CQZI 3CCM1 3VMGA 2R92I 4DGLA 1Q811 2QR1B 2I3CA 4HH4A 1YUAA 2F4OA 2PMZA 3CCEZ 2OTJ1 4E2ZA 5FLMI 3KIFA 2WB1A 3CCRZ 3G71Z 3F3PC 1ZH1A 4DK1A 1VQ41 3BG0B 1YIJZ 3I55Z 1RQFA 2IZ4A 2M48A 3I561 5A2Qf 2K5RA 3NH4A 1Z01A 2GU2A 3S1MI 2RBLA 2BJOA 3HKZA 5C4JI 4E33A 4E2XA 3CPWZ 4S1TA 4NBGA 1YJNZ 4A3JI 1VLAA 2JA6I 3VTNA 1I50I 3CCVZ 4NB9A 3CCR1 2GTIA 1TWFI 4BBRI 1X3ZA 3CPWY 1NUIA 3S15I 4A3BI 2DE7A 2V8JA 1P9NA 4NB8A 1Z03A 2GTHA 2Q51A 3FQQA 2B63I 2OTL1 3I4NI 5C3EI 4NBEA 2O53A 2QEXZ 4NH1C 4QTTA 3GTOI 3G6EZ 4CL1A 2J6AA 1Y1WI 3HOUI 1ML8A 1VQ91 1VQ8Z 2V8IA 5A2Qb 3G4SZ 1JJ2Z 1VQOZ 3CXCZ 3CD6Z 2E2II 5C4XI 1YI2Z 2KPIA 2JMOA 3TE5B 1KD12 3J80f 1TWCI 2QA4Z 4A3FI 1KQSZ 1KC82 1M1K2 4NBAA 1WCMI 3VB9A 1JJ2Y 1DL6A 2QLVB 3CXCY 4HGZA 4TNUA 2P28A 3G6E1 1Q7Y2 3CCMZ 1KQSY 1RO2A 1VQ81 1USPA 4XX2A 4X6AI 3CC4Z 1VQ71 1NJI2 3G4S1 1YJWZ 1KD11 1KC81 1M1K1 2OTJZ 4DQYB 3IF8A 3JAMf 2RT9A 3NFZA 1RO4A 1Q7Y1 4MD7A 4NBCA 4HGYA 4MD9A 4AYBA 2WAQA 2QKDA 1NJI1 3J80b 3I56Z 3Q87A 2ZAEB 1YUKA 1QYPA 3CC41 1K732 4A3GI 4NBFA 4E31A 3H3VJ 1YJW1 4BY1I 2JR6A 3GCFA 3GTLI 3M4OI 3S1NI 4NBBA 2IZ3A 1VQM1 2Q4ZA 2M6NA 3CME1 1VQKZ 3T4NB 3S14I 4NFRA 4A93I 1RNIA 1TFIA 5FLXf 3CCL1 3JAMb 3RZDI 5T6BA 2OTLZ 2R6MA 1Q822 3RZOI 4Y7NI 3CC7Z 1K83I 2OOYB 1TWHI 1VQL1 2H85A 1VQ9Z 5C44I 2F4MA 2W03A 4QTUA 3OW2Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GKQ A;  1ZB8 A;  2E2J I;  1LQL A;  2R7Z I;  4A3I I;  3GTM I;  3LUS A;  2E2I I;  5C4X I;  4BY7 I;  1WW9 A;  2KPI A;  5IP9 I;  1R9T I;  2YU9 I;  2DE5 A;  1TWC I;  4A3F I;  4BBS I;  1Y1V I;  2JA5 I;  3HOY I;  4NBA A;  3HOZ I;  3K7A I;  4A3K I;  1WCM I;  3VB9 A;  5CM2 M;  4NBD A;  3GTJ I;  1DL6 A;  4NOZ A;  3ESW A;  3M3Y I;  3D6W A;  3EER A;  2HF1 A;  2NVY I;  4A3E I;  4A3C I;  1USP A;  4XX2 A;  3CQZ I;  3VMG A;  2R92 I;  3PO3 I;  4X6A I;  3GTQ I;  3GTK I;  3S2D I;  3GTP I;  2NVQ I;  1RLY A;  1YUA A;  1ZB9 A;  2F4O A;  1SFO I;  3HOW I;  3I4M I;  4A3M I;  3GTM S;  3S17 I;  5FLM I;  4Y52 I;  3VMI A;  3PO2 I;  2VUM I;  3S1Q I;  1RO4 A;  1Y1V S;  4NBC A;  1I3Q I;  2NVT I;  2JA8 I;  1TWA I;  2DE6 A;  3Q87 A;  2JA7 I;  1QYP A;  2K5R A;  4A3G I;  3FKI I;  4NBF A;  3H3V J;  3S1M I;  4BY1 I;  2RBL A;  2JR6 A;  3GCF A;  3S2H I;  2P3Y A;  3GTL I;  2R93 I;  3GTG I;  3PO3 S;  2BJO A;  3U50 C;  3M4O I;  5C4J I;  3S1N I;  4NBB A;  1TWG I;  1USP B;  4NBG A;  2JA6 I;  4A3J I;  1VLA A;  2NVX I;  1X3W A;  1I50 I;  4NB9 A;  4A3L I;  1TWF I;  3S14 I;  4A3D I;  1N2F A;  4A93 I;  2JS4 A;  4BBR I;  3VMH A;  1X3Z A;  1NUI A;  3S15 I;  4A3B I;  3S16 I;  1TFI A;  2DE7 A;  4MH4 A;  4NB8 A;  4BXX I;  3H0G I;  3S1R I;  4NBH A;  3RZD I;  2B63 I;  2E2H I;  3I4N I;  5C3E I;  4NBE A;  3RZO I;  3HOV I;  4Y7N I;  1PFT A;  4QTT A;  1L1O C;  1K83 I;  2PK7 A;  1TWH I;  3HOX I;  3GTO I;  2AKL A;  3I07 A;  2J6A A;  5IP7 I;  1I6H I;  1Y1W I;  3HOU I;  5C44 I;  2JNY A;  1ML8 A;  2F4M A;  4QTU A; 
#chains in the Genus database with same CATH topology
 1Q86 2;  1VQK 1;  2E2J I;  3NDI A;  1VQ5 1;  3GTM I;  3LUS A;  5IP9 I;  2DE5 A;  1Q82 1;  3OW2 Y;  1Y1V I;  3HOZ I;  3K7A I;  1Y8C A;  3M3Y I;  3MZL B;  3CC7 1;  3D6W A;  3J81 f;  2NVY I;  1Q86 1;  4A3C I;  2V3V A;  5FLX b;  4RVG A;  1VQ7 Z;  3PO3 I;  4MON A;  5D1O A;  1VQP 1;  3GTK I;  5D1P A;  1QVG Z;  3GTP I;  1RLY A;  1ZB9 A;  3IR7 A;  4A3M I;  3NH8 A;  2G2K A;  3GTM S;  2QRC B;  3S17 I;  2JIR A;  3VMI A;  2VUM I;  3S1Q I;  1QVG Y;  1K9M 2;  4RVD A;  1Y1V S;  4MD8 A;  1I3Q I;  3NDJ A;  2LEX A;  1AA6 A;  2NVT I;  3CCU 1;  5T64 A;  2VF1 A;  3FKI I;  3KIH A;  2R93 I;  2P3Y A;  3GTG I;  3PO3 S;  3U50 C;  3BG1 B;  3J81 b;  1VQM Z;  1TWG I;  1USP B;  1K9M 1;  2V45 A;  2QRE B;  3CME Z;  1X3W A;  2KI7 B;  2O4H A;  2V8K A;  3CMA Z;  4A3L I;  1N2F A;  2K3R A;  2JS4 A;  3VMH A;  4RVF A;  3CC2 1;  3CCL Z;  4E32 A;  1QVF Z;  1YJ9 Z;  1Z02 A;  2W04 A;  1M90 2;  4NBH A;  5IT9 f;  4E30 A;  5AN9 F;  3HOV I;  1PFT A;  1L1O C;  1VQL Z;  2PK7 A;  2AYD A;  3I07 A;  1W2B Z;  1QVF Y;  3J7A 4;  4RS4 A;  3CCS 1;  1LQL A;  3CMA 1;  5LL6 f;  1VQN 1;  2PM9 A;  2VUG A;  1VQ5 Z;  2EGT A;  1KRL A;  2OZK A;  1W2B Y;  1M90 1;  1K73 1;  4BY7 I;  2JIP A;  2Y0S A;  2YU9 I;  2YAD A;  1YJ9 1;  1YHQ 1;  2JA5 I;  4A3K I;  3ESW A;  2QRD B;  2RHB A;  3D9X A;  3EER A;  3P5J B;  4RVH A;  3F3F C;  1VQ6 1;  1Q16 A;  3D2L A;  4A3E I;  1VQP Z;  3NH5 A;  3GTQ I;  1NP6 A;  5IT9 b;  3S2D I;  2NVQ I;  2VPX A;  1SFO I;  3HOW I;  1S7M A;  3I4M I;  1QF8 A;  5T67 A;  3CCE 1;  1N8R 2;  4Y52 I;  3PO2 I;  3CCJ Z;  3G71 1;  1YIJ 1;  3I55 1;  3EED A;  3CCU Z;  1X0T A;  3CCQ Z;  2JA8 I;  1TWA I;  2DE6 A;  2JA7 I;  3IFU A;  2JUB A;  4E2Y A;  1YIT Z;  3S2H I;  2RPR A;  1N8R 1;  1K8A 2;  1JWH C;  1WII A;  2NVX I;  1YJN 1;  5D1O B;  2LIY A;  3CCV 1;  3CCJ 1;  2E9H A;  4A3D I;  4E2W A;  3CC2 Z;  3QWU A;  3S16 I;  4MH4 A;  3CCQ 1;  3TDH B;  2LFU A;  4BXX I;  3H0G I;  3S1R I;  1S72 Z;  2E7Z A;  2RIQ A;  2IV2 X;  2E2H I;  1K8A 1;  1YIT 1;  3HOX I;  2QEX 1;  2AKL A;  3MON A;  4RV9 A;  3FQM A;  5IP7 I;  1I6H I;  2JNY A;  4EWC A;  3CCS Z;  2VPY A;  3MZK B;  1RO0 A;  3GKQ A;  1VQN Z;  1ZB8 A;  2R7Z I;  3IX0 A;  4A3I I;  2OOX B;  4MRI A;  1VQO 1;  2HU9 A;  1Q81 2;  3CD6 1;  1WW9 A;  1R9T I;  1YI2 1;  1YHQ Z;  4MXU A;  4BBS I;  2QA4 1;  3HOY I;  1S72 1;  2VPZ A;  5CM2 M;  4NBD A;  3GTJ I;  4NOZ A;  1WJ2 A;  1VQ4 Z;  1WZN A;  1VQ6 Z;  2HF1 A;  3CQZ I;  3CCM 1;  3VMG A;  2R92 I;  4DGL A;  1Q81 1;  2QR1 B;  2I3C A;  4HH4 A;  1YUA A;  2F4O A;  2PMZ A;  3CCE Z;  2OTJ 1;  1FDI A;  4E2Z A;  5FLM I;  3KIF A;  2WB1 A;  3CCR Z;  3G71 Z;  3F3P C;  1ZH1 A;  4DK1 A;  1VQ4 1;  3BG0 B;  1YIJ Z;  3I55 Z;  2VPW A;  1RQF A;  2IZ4 A;  2M48 A;  3I56 1;  5A2Q f;  2K5R A;  2JIQ A;  3NH4 A;  1Z01 A;  2GU2 A;  3S1M I;  2RBL A;  2BJO A;  3HKZ A;  5C4J I;  4E33 A;  4E2X A;  3CPW Z;  4S1T A;  4NBG A;  1YJN Z;  4A3J I;  1VLA A;  2JA6 I;  3VTN A;  1I50 I;  3CCV Z;  4NB9 A;  3CCR 1;  2GTI A;  1TWF I;  2JIO A;  4BBR I;  1X3Z A;  3CPW Y;  1NUI A;  3S15 I;  4A3B I;  2DE7 A;  2V8J A;  1P9N A;  4NB8 A;  1Z03 A;  2GTH A;  2Q51 A;  3FQQ A;  2B63 I;  2OTL 1;  3I4N I;  1QXF A;  5C3E I;  4NBE A;  2O53 A;  2QEX Z;  4NH1 C;  4QTT A;  3GTO I;  3G6E Z;  4CL1 A;  2J6A A;  1Y1W I;  3HOU I;  1ML8 A;  1VQ9 1;  1VQ8 Z;  2V8I A;  1FDO A;  5A2Q b;  3G4S Z;  1JJ2 Z;  1VQO Z;  3CXC Z;  3CD6 Z;  2E2I I;  5C4X I;  1YI2 Z;  1SIW A;  2KPI A;  2JIM A;  2JMO A;  3TE5 B;  1KD1 2;  3J80 f;  1TWC I;  2QA4 Z;  4A3F I;  1KQS Z;  1KC8 2;  1M1K 2;  4NBA A;  2NAP A;  1WCM I;  3VB9 A;  1JJ2 Y;  1DL6 A;  2QLV B;  3CXC Y;  4HGZ A;  4TNU A;  2P28 A;  3G6E 1;  1Q7Y 2;  3CCM Z;  1KQS Y;  1RO2 A;  1VQ8 1;  1USP A;  4XX2 A;  4X6A I;  3CC4 Z;  1VQ7 1;  1NJI 2;  3G4S 1;  1YJW Z;  1KD1 1;  1KC8 1;  1M1K 1;  2OTJ Z;  4DQY B;  3IF8 A;  3JAM f;  2RT9 A;  3NFZ A;  1RO4 A;  1Q7Y 1;  4MD7 A;  4NBC A;  4HGY A;  4MD9 A;  4AYB A;  2WAQ A;  2QKD A;  1NJI 1;  3J80 b;  3I56 Z;  3Q87 A;  2ZAE B;  1YUK A;  1QYP A;  3CC4 1;  1K73 2;  4A3G I;  4NBF A;  4E31 A;  3H3V J;  1YJW 1;  4BY1 I;  2JR6 A;  3GCF A;  3GTL I;  3M4O I;  3S1N I;  4NBB A;  2IZ3 A;  1VQM 1;  2Q4Z A;  2M6N A;  3CME 1;  1VQK Z;  3T4N B;  3S14 I;  4NFR A;  4A93 I;  1RNI A;  1TFI A;  5FLX f;  3CCL 1;  3JAM b;  3RZD I;  5T6B A;  2OTL Z;  2R6M A;  1Q82 2;  3RZO I;  4Y7N I;  3CC7 Z;  1K83 I;  2OOY B;  1TWH I;  1VQL 1;  2H85 A;  1VQ9 Z;  5C44 I;  2F4M A;  2W03 A;  4QTU A;  3OW2 Z; 
#chains in the Genus database with same CATH homology
 1Q86 2;  1VQK 1;  2E2J I;  3NDI A;  1VQ5 1;  3GTM I;  3LUS A;  5IP9 I;  2DE5 A;  1Q82 1;  3OW2 Y;  1Y1V I;  3HOZ I;  3K7A I;  3M3Y I;  3MZL B;  3CC7 1;  3D6W A;  3J81 f;  2NVY I;  1Q86 1;  4A3C I;  5FLX b;  4RVG A;  1VQ7 Z;  3PO3 I;  4MON A;  5D1O A;  1VQP 1;  3GTK I;  5D1P A;  1QVG Z;  3GTP I;  1RLY A;  1ZB9 A;  4A3M I;  3NH8 A;  2G2K A;  3GTM S;  2QRC B;  3S17 I;  3VMI A;  2VUM I;  3S1Q I;  1QVG Y;  1K9M 2;  4RVD A;  1Y1V S;  4MD8 A;  1I3Q I;  3NDJ A;  2NVT I;  3CCU 1;  5T64 A;  2VF1 A;  3FKI I;  3KIH A;  2R93 I;  2P3Y A;  3GTG I;  3PO3 S;  3U50 C;  3BG1 B;  3J81 b;  1VQM Z;  1TWG I;  1USP B;  1K9M 1;  2QRE B;  3CME Z;  1X3W A;  2KI7 B;  2O4H A;  2V8K A;  3CMA Z;  4A3L I;  1N2F A;  2K3R A;  2JS4 A;  3VMH A;  4RVF A;  3CC2 1;  3CCL Z;  4E32 A;  1QVF Z;  1YJ9 Z;  1Z02 A;  2W04 A;  1M90 2;  4NBH A;  5IT9 f;  4E30 A;  5AN9 F;  3HOV I;  1PFT A;  1L1O C;  1VQL Z;  2PK7 A;  3I07 A;  1W2B Z;  1QVF Y;  3J7A 4;  4RS4 A;  3CCS 1;  1LQL A;  3CMA 1;  5LL6 f;  1VQN 1;  2PM9 A;  2VUG A;  1VQ5 Z;  2EGT A;  1KRL A;  2OZK A;  1W2B Y;  1M90 1;  1K73 1;  4BY7 I;  2Y0S A;  2YU9 I;  2YAD A;  1YJ9 1;  1YHQ 1;  2JA5 I;  4A3K I;  3ESW A;  2QRD B;  2RHB A;  3D9X A;  3EER A;  3P5J B;  4RVH A;  3F3F C;  1VQ6 1;  4A3E I;  1VQP Z;  3NH5 A;  3GTQ I;  1NP6 A;  5IT9 b;  3S2D I;  2NVQ I;  1SFO I;  3HOW I;  1S7M A;  3I4M I;  1QF8 A;  5T67 A;  3CCE 1;  1N8R 2;  4Y52 I;  3PO2 I;  3CCJ Z;  3G71 1;  1YIJ 1;  3I55 1;  3EED A;  3CCU Z;  1X0T A;  3CCQ Z;  2JA8 I;  1TWA I;  2DE6 A;  2JA7 I;  3IFU A;  2JUB A;  4E2Y A;  1YIT Z;  3S2H I;  2RPR A;  1N8R 1;  1K8A 2;  1JWH C;  1WII A;  2NVX I;  1YJN 1;  5D1O B;  2LIY A;  3CCV 1;  3CCJ 1;  2E9H A;  4A3D I;  4E2W A;  3CC2 Z;  3QWU A;  3S16 I;  4MH4 A;  3CCQ 1;  3TDH B;  2LFU A;  4BXX I;  3H0G I;  3S1R I;  1S72 Z;  2RIQ A;  2E2H I;  1K8A 1;  1YIT 1;  3HOX I;  2QEX 1;  2AKL A;  3MON A;  4RV9 A;  3FQM A;  5IP7 I;  1I6H I;  2JNY A;  4EWC A;  3CCS Z;  3MZK B;  1RO0 A;  3GKQ A;  1VQN Z;  1ZB8 A;  2R7Z I;  3IX0 A;  4A3I I;  2OOX B;  4MRI A;  1VQO 1;  2HU9 A;  1Q81 2;  3CD6 1;  1WW9 A;  1R9T I;  1YI2 1;  1YHQ Z;  4MXU A;  4BBS I;  2QA4 1;  3HOY I;  1S72 1;  5CM2 M;  4NBD A;  3GTJ I;  4NOZ A;  1VQ4 Z;  1VQ6 Z;  2HF1 A;  3CQZ I;  3CCM 1;  3VMG A;  2R92 I;  4DGL A;  1Q81 1;  2QR1 B;  2I3C A;  4HH4 A;  1YUA A;  2F4O A;  2PMZ A;  3CCE Z;  2OTJ 1;  4E2Z A;  5FLM I;  3KIF A;  2WB1 A;  3CCR Z;  3G71 Z;  3F3P C;  1ZH1 A;  4DK1 A;  1VQ4 1;  3BG0 B;  1YIJ Z;  3I55 Z;  1RQF A;  2IZ4 A;  2M48 A;  3I56 1;  5A2Q f;  2K5R A;  3NH4 A;  1Z01 A;  2GU2 A;  3S1M I;  2RBL A;  2BJO A;  3HKZ A;  5C4J I;  4E33 A;  4E2X A;  3CPW Z;  4S1T A;  4NBG A;  1YJN Z;  4A3J I;  1VLA A;  2JA6 I;  3VTN A;  1I50 I;  3CCV Z;  4NB9 A;  3CCR 1;  2GTI A;  1TWF I;  4BBR I;  1X3Z A;  3CPW Y;  1NUI A;  3S15 I;  4A3B I;  2DE7 A;  2V8J A;  1P9N A;  4NB8 A;  1Z03 A;  2GTH A;  2Q51 A;  3FQQ A;  2B63 I;  2OTL 1;  3I4N I;  5C3E I;  4NBE A;  2O53 A;  2QEX Z;  4NH1 C;  4QTT A;  3GTO I;  3G6E Z;  4CL1 A;  2J6A A;  1Y1W I;  3HOU I;  1ML8 A;  1VQ9 1;  1VQ8 Z;  2V8I A;  5A2Q b;  3G4S Z;  1JJ2 Z;  1VQO Z;  3CXC Z;  3CD6 Z;  2E2I I;  5C4X I;  1YI2 Z;  2KPI A;  2JMO A;  3TE5 B;  1KD1 2;  3J80 f;  1TWC I;  2QA4 Z;  4A3F I;  1KQS Z;  1KC8 2;  1M1K 2;  4NBA A;  1WCM I;  3VB9 A;  1JJ2 Y;  1DL6 A;  2QLV B;  3CXC Y;  4HGZ A;  4TNU A;  2P28 A;  3G6E 1;  1Q7Y 2;  3CCM Z;  1KQS Y;  1RO2 A;  1VQ8 1;  1USP A;  4XX2 A;  4X6A I;  3CC4 Z;  1VQ7 1;  1NJI 2;  3G4S 1;  1YJW Z;  1KD1 1;  1KC8 1;  1M1K 1;  2OTJ Z;  4DQY B;  3IF8 A;  3JAM f;  2RT9 A;  3NFZ A;  1RO4 A;  1Q7Y 1;  4MD7 A;  4NBC A;  4HGY A;  4MD9 A;  4AYB A;  2WAQ A;  2QKD A;  1NJI 1;  3J80 b;  3I56 Z;  3Q87 A;  2ZAE B;  1YUK A;  1QYP A;  3CC4 1;  1K73 2;  4A3G I;  4NBF A;  4E31 A;  3H3V J;  1YJW 1;  4BY1 I;  2JR6 A;  3GCF A;  3GTL I;  3M4O I;  3S1N I;  4NBB A;  2IZ3 A;  1VQM 1;  2Q4Z A;  2M6N A;  3CME 1;  1VQK Z;  3T4N B;  3S14 I;  4NFR A;  4A93 I;  1RNI A;  1TFI A;  5FLX f;  3CCL 1;  3JAM b;  3RZD I;  5T6B A;  2OTL Z;  2R6M A;  1Q82 2;  3RZO I;  4Y7N I;  3CC7 Z;  1K83 I;  2OOY B;  1TWH I;  1VQL 1;  2H85 A;  1VQ9 Z;  5C44 I;  2F4M A;  2W03 A;  4QTU A;  3OW2 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...