2KPIA

Solution nmr structure of streptomyces coelicolor sco3027 modeled with zn+2 bound, northeast structural genomics consortium target rr58
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
56
structure length
56
Chain Sequence
MPLEAGLLEILACPACHAPLEERDAELICTGQDCGLAYPVRDGIPVLLVDEARRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of Streptomyces coelicolor SCO3027 modeled with Zn+2 bound, Northeast Structural Genomics Consortium Target RR58
rcsb
source organism Streptomyces coelicolor
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein SCO3027
total genus 6
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2009-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03966 Trm112p Trm112p-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2kpiA01
1TWFI 2NVYI 4NBEA 1QYPA 2K5RA 4BXXI 3S1RI 4A3FI 1Y1WI 4X6AI 1I50I 1X3ZA 2PK7A 1I3QI 2P3YA 3PO3I 1RLYA 3VMIA 1I6HI 3K7AI 1USPA 1SFOI 4A3II 2JR6A 3PO2I 3Q87A 4Y7NI 4A3BI 2JA5I 3HOUI 2AKLA 4NB8A 1WCMI 1K83I 4QTTA 2DE5A 1X3WA 1L1OC 1LQLA 2DE7A 2NVTI 3HOWI 1ZB8A 3U50C 2R92I 3S1QI 3D6WA 3VB9A 2JNYA 4A3LI 3GTLI 3S1MI 2RBLA 3I4MI 4BY7I 4A3MI 4BBSI 2R7ZI 1YUAA 1ML8A 2E2II 2E2JI 2JA7I 3HOXI 1Y1VS 3GTPI 4XX2A 5C3EI 3HOYI 3S17I 1Y1VI 4A3CI 3GTMS 2KPIA 2JS4A 4BBRI 4NBBA 5C4JI 2JA8I 4Y52I 4NOZA 2JA6I 2E2HI 4NB9A 5C44I 5IP7I 3GTGI 1TFIA 2F4OA 3RZOI 3M4OI 4NBHA 3ESWA 1TWGI 1ZB9A 3HOVI 3H3VJ 2BJOA 3S16I 2NVQI 1DL6A 1TWAI 3GCFA 3M3YI 3S2DI 2F4MA 3GTMI 1TWCI 3EERA 1PFTA 3GTQI 5C4XI 4NBDA 2HF1A 3S2HI 3VMGA 3GKQA 3S1NI 1VLAA 4A3GI 2R93I 1N2FA 4A3EI 3PO3S 4NBFA 3S15I 2DE6A 2YU9I 2J6AA 1WW9A 4NBGA 2B63I 3H0GI 3I4NI 3RZDI 4A3KI 4A3JI 1TWHI 3S14I 4NBAA 3GTJI 4A3DI 1USPB 1NUIA 3FKII 3I07A 3LUSA 1R9TI 5CM2M 4MH4A 5IP9I 3GTKI 4QTUA 5FLMI 3GTOI 1RO4A 3VMHA 2NVXI 4A93I 3CQZI 4BY1I 2VUMI 4NBCA 3HOZI
chains in the Genus database with same CATH superfamily
2GTIA 4HGYA 4E33A 4NBEA 1M901 2RIQA 2IZ4A 1YHQ1 1K732 3S1RI 1X3ZA 1NJI2 3G711 1I3QI 2P3YA 1Q7Y1 5IT9f 1I6HI 1QVFZ 3K7AI 1VQ4Z 1USPA 2O53A 1QF8A 2JR6A 2JUBA 1VQK1 4Y7NI 2ZAEB 4E31A 1VQ81 4NB8A 1WCMI 1Q861 4E2XA 2OTLZ 2R6MA 3J81f 1VQO1 2LEXA 3D6WA 3GTLI 4BY7I 4A3MI 3IFUA 1Y1VS 3CC21 3GTPI 3HOYI 1KC81 3S17I 1Y1VI 2OTL1 2JIOA 3GTMS 1FDOA 1YJ91 3CPWZ 2JS4A 2VPXA 3EEDA 1YJN1 2V8KA 3F3PC 2QLVB 4NOZA 3CCEZ 1S721 3JAMf 3IF8A 4E2YA 4NBHA 1TWGI 2JIMA 1ZB9A 3HOVI 2NVQI 3M3YI 1Q811 4E2ZA 3EERA 1PFTA 1Z02A 1KD12 3GKQA 3CCS1 1KC82 3P5JB 4NBFA 3S15I 3CC41 1VQL1 3G6E1 3CXCZ 1USPB 3CD61 1QVGY 3I551 3LUSA 2GTHA 4RVGA 3CC4Z 3CMEZ 3CCM1 1VQN1 1RO4A 2NVXI 3I56Z 1Z03A 1WIIA 2VUMI 1YJ9Z 3CD6Z 2P28A 2OOXB 1TWFI 3CCU1 2V45A 3I55Z 2H85A 4NH1C 4E32A 1S72Z 4BXXI 2PK7A 2NAPA 3CCL1 3VMIA 1YUKA 1SFOI 4A3II 2RHBA 3PO2I 4A3BI 2VPWA 1K83I 4QTTA 1VQ61 2PMZA 2DE5A 1M902 2VPYA 3G6EZ 1ZB8A 2R92I 3OW2Y 3S1QI 2JNYA 3S1MI 2RBLA 3I4MI 5FLXf 1YIJZ 2V3VA 2R7ZI 1YUAA 3HKZA 1Q822 3CXCY 2JA7I 1KQSY 3HOXI 1K8A2 4TNUA 4A3CI 1VQM1 2KPIA 3T4NB 3MONA 4NBBA 3CCRZ 4HH4A 3FQQA 2V8JA 2QA4Z 2E2HI 2JA6I 5C44I 5IP7I 2JMOA 1WZNA 4CL1A 2IZ3A 2F4OA 3RZOI 2PM9A 3J7A4 2BJOA 1DL6A 1TWAI 2M6NA 3MZKB 1NJI1 3S2DI 2F4MA 3GTMI 5C4XI 5D1OA 1WJ2A 3VMGA 2HU9A 4A3GI 4AYBA 2R93I 2W03A 1N2FA 4A3EI 3PO3S 2IV2X 2DE6A 2J6AA 1WW9A 2VUGA 3I4NI 2VPZA 2KI7B 3RZDI 1VQ41 3S14I 4A3DI 1NUIA 4DGLA 3J80f 3I07A 3CC7Z 3CCQ1 1Q16A 2YADA 5IP9I 2WB1A 5FLMI 3KIFA 4A93I 1YI2Z 2NVYI 5A2Qb 1W2BZ 2JIQA 1K9M1 2AYDA 2QA41 5FLXb 2K5RA 3CC71 4X6AI 1I50I 1YHQZ 3BG0B 3CCVZ 1Z01A 1VQ6Z 4MD8A 1X0TA 3CME1 3CCMZ 3NDIA 1M1K1 3CMAZ 1KRLA 3I561 1N8R1 3HOUI 2LFUA 2AKLA 1QVGZ 3D9XA 5T64A 1X3WA 1LQLA 2NVTI 2M48A 1K9M2 3HOWI 3U50C 1YITZ 1VQMZ 3CCSZ 2WAQA 2RPRA 3CCV1 4BBSI 1ML8A 2E2II 2JIRA 4MRIA 1AA6A 3G71Z 4BBRI 2LIYA 3NH8A 3J81b 1Y8CA 4Y52I 1M1K2 4NB9A 4DQYB 3CCE1 1TFIA 1YIT1 3IR7A 3M4OI 3H3VJ 1W2BY 1NP6A 1VQ9Z 1VQPZ 1VQKZ 2QKDA 2QEX1 1TWCI 1JWHC 1VQ8Z 2HF1A 3S2HI 1RNIA 3G4SZ 1VLAA 1VQOZ 3OW2Z 2YU9I 2VF1A 3CC2Z 2B63I 4RVFA 3H0GI 3CCR1 4A3KI 1RO2A 1TWHI 3MZLB 2RT9A 3GTJI 4DK1A 1VQ71 2OTJ1 1Q7Y2 1RO0A 3KIHA 3NFZA 1VQNZ 4MH4A 3CCJ1 3GTKI 4EWCA 4E30A 2K3RA 1K8A1 3GTOI 1YIJ1 4BY1I 3JAMb 4RV9A 3HOZI 2E9HA 3NDJA 3BG1B 1QYPA 4RVHA 4A3FI 1Y1WI 3PO3I 1RLYA 4RVDA 1VQ91 3VTNA 1VQP1 1ZH1A 1K731 2QEXZ 2QREB 2GU2A 3FQMA 3Q87A 5T6BA 3NH4A 5T67A 1KQSZ 2W04A 2OZKA 3G4S1 4E2WA 3D2LA 1YI21 4MD9A 2JA5I 2G2KA 1L1OC 2QRCB 2DE7A 2Q4ZA 2QR1B 3VB9A 4S1TA 4A3LI 1QXFA 2I3CA 5D1OB 1Q812 1FDIA 2Q51A 4NFRA 2E2JI 3CCUZ 4XX2A 5C3EI 2O4HA 2E7ZA 4RS4A 1JJ2Z 3CCQZ 5C4JI 1VQ51 1YJWZ 2JA8I 1N8R2 3GTGI 3F3FC 3QWUA 1S7MA 2OOYB 3IX0A 5IT9b 3ESWA 1YJNZ 1SIWA 3S16I 2Y0SA 3GCFA 1RQFA 3CPWY 2V8IA 3GTQI 4NBDA 3J80b 1JJ2Y 3TDHB 5LL6f 1YJW1 1VQ5Z 3S1NI 1KD11 3NH5A 1VQ7Z 2OTJZ 3TE5B 4MXUA 2JIPA 4NBGA 5D1PA 4MD7A 4A3JI 4NBAA 3CCJZ 3CMA1 3CCLZ 3FKII 5A2Qf 1P9NA 4MONA 1R9TI 1Q821 1VQLZ 5CM2M 4QTUA 5AN9F 2EGTA 3VMHA 1QVFY 3CQZI 2QRDB 4HGZA 1Q862 4NBCA
chains in the Genus database with same CATH topology
2GTIA 4HGYA 4E33A 4NBEA 1M901 2RIQA 2IZ4A 1YHQ1 1K732 3S1RI 1X3ZA 1NJI2 3G711 1I3QI 2P3YA 1Q7Y1 5IT9f 1I6HI 1QVFZ 3K7AI 1VQ4Z 1USPA 2O53A 1QF8A 2JR6A 2JUBA 1VQK1 4Y7NI 2ZAEB 4E31A 1VQ81 4NB8A 1WCMI 1Q861 4E2XA 2OTLZ 2R6MA 3J81f 1VQO1 3D6WA 3GTLI 4BY7I 4A3MI 3IFUA 1Y1VS 3CC21 3GTPI 3HOYI 1KC81 3S17I 1Y1VI 2OTL1 3GTMS 3CPWZ 1YJ91 2JS4A 3EEDA 1YJN1 2V8KA 3F3PC 2QLVB 4NOZA 3CCEZ 1S721 3JAMf 3IF8A 4E2YA 4NBHA 1TWGI 1ZB9A 3HOVI 2NVQI 3M3YI 1Q811 4E2ZA 3EERA 1PFTA 1Z02A 1KD12 3GKQA 3CCS1 1KC82 3P5JB 4NBFA 3S15I 3CC41 1VQL1 3G6E1 3CXCZ 1USPB 3CD61 1QVGY 3I551 3LUSA 2GTHA 4RVGA 3CC4Z 3CMEZ 3CCM1 1VQN1 1RO4A 2NVXI 3I56Z 1Z03A 1WIIA 2VUMI 1YJ9Z 3CD6Z 2P28A 2OOXB 1TWFI 3CCU1 3I55Z 2H85A 4NH1C 4E32A 1S72Z 4BXXI 2PK7A 3CCL1 3VMIA 1YUKA 1SFOI 4A3II 2RHBA 3PO2I 4A3BI 1K83I 4QTTA 1VQ61 2PMZA 2DE5A 1M902 3G6EZ 1ZB8A 2R92I 3OW2Y 3S1QI 2JNYA 3S1MI 2RBLA 3I4MI 5FLXf 1YIJZ 2R7ZI 1YUAA 3HKZA 1Q822 3CXCY 2JA7I 1KQSY 3HOXI 1K8A2 4TNUA 4A3CI 1VQM1 2KPIA 3T4NB 3MONA 4NBBA 3CCRZ 4HH4A 3FQQA 2V8JA 2QA4Z 2E2HI 2JA6I 5C44I 5IP7I 2JMOA 4CL1A 2IZ3A 2F4OA 3RZOI 2PM9A 3J7A4 2BJOA 1DL6A 1TWAI 2M6NA 3MZKB 1NJI1 3S2DI 2F4MA 3GTMI 5C4XI 5D1OA 3VMGA 2HU9A 4A3GI 4AYBA 2R93I 2W03A 1N2FA 4A3EI 3PO3S 2DE6A 2J6AA 1WW9A 2VUGA 3I4NI 2KI7B 3RZDI 1VQ41 3S14I 4A3DI 1NUIA 4DGLA 3J80f 3I07A 3CC7Z 3CCQ1 2YADA 5IP9I 2WB1A 5FLMI 3KIFA 4A93I 1YI2Z 2NVYI 5A2Qb 1W2BZ 1K9M1 2QA41 5FLXb 2K5RA 3CC71 4X6AI 1I50I 1YHQZ 3BG0B 3CCVZ 1Z01A 1VQ6Z 4MD8A 1X0TA 3CME1 3CCMZ 3NDIA 1M1K1 3CMAZ 1KRLA 3I561 1N8R1 3HOUI 2LFUA 2AKLA 1QVGZ 3D9XA 5T64A 1X3WA 1LQLA 2NVTI 2M48A 1K9M2 3HOWI 3U50C 1YITZ 1VQMZ 3CCSZ 2WAQA 2RPRA 3CCV1 4BBSI 1ML8A 2E2II 4MRIA 3G71Z 4BBRI 2LIYA 3NH8A 3J81b 4Y52I 1M1K2 4NB9A 4DQYB 3CCE1 1TFIA 1YIT1 3M4OI 3H3VJ 1W2BY 1NP6A 1VQ9Z 1VQPZ 1VQKZ 2QKDA 2QEX1 1TWCI 1JWHC 1VQ8Z 2HF1A 3S2HI 1RNIA 3G4SZ 1VLAA 1VQOZ 3OW2Z 2YU9I 2VF1A 3CC2Z 2B63I 4RVFA 3H0GI 3CCR1 4A3KI 1RO2A 1TWHI 3MZLB 2RT9A 3GTJI 4DK1A 1VQ71 2OTJ1 1Q7Y2 1RO0A 3KIHA 3NFZA 1VQNZ 4MH4A 3CCJ1 3GTKI 4EWCA 4E30A 2K3RA 1K8A1 3GTOI 1YIJ1 4BY1I 3JAMb 4RV9A 3HOZI 2E9HA 3NDJA 3BG1B 1QYPA 4RVHA 4A3FI 1Y1WI 3PO3I 1RLYA 4RVDA 1VQ91 3VTNA 1VQP1 1ZH1A 1K731 2QEXZ 2QREB 2GU2A 3FQMA 3Q87A 5T6BA 3NH4A 5T67A 1KQSZ 2W04A 2OZKA 3G4S1 4E2WA 1YI21 2JA5I 4MD9A 2G2KA 1L1OC 2QRCB 2DE7A 2Q4ZA 2QR1B 3VB9A 4S1TA 4A3LI 2I3CA 5D1OB 1Q812 2Q51A 4NFRA 2E2JI 3CCUZ 4XX2A 5C3EI 2O4HA 4RS4A 1JJ2Z 3CCQZ 5C4JI 1VQ51 1YJWZ 2JA8I 1N8R2 3GTGI 3F3FC 3QWUA 1S7MA 2OOYB 3IX0A 5IT9b 3ESWA 1YJNZ 3S16I 2Y0SA 3GCFA 1RQFA 3CPWY 2V8IA 3GTQI 4NBDA 3J80b 1JJ2Y 3TDHB 5LL6f 1YJW1 1VQ5Z 3S1NI 1KD11 3NH5A 1VQ7Z 2OTJZ 3TE5B 4MXUA 4NBGA 5D1PA 4MD7A 4A3JI 4NBAA 3CCJZ 3CMA1 3CCLZ 3FKII 5A2Qf 1P9NA 4MONA 1R9TI 1Q821 1VQLZ 5CM2M 4QTUA 5AN9F 2EGTA 3VMHA 1QVFY 3CQZI 2QRDB 4HGZA 1Q862 4NBCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWF I;  2NVY I;  4NBE A;  1QYP A;  2K5R A;  4BXX I;  3S1R I;  4A3F I;  1Y1W I;  4X6A I;  1I50 I;  1X3Z A;  2PK7 A;  1I3Q I;  2P3Y A;  3PO3 I;  1RLY A;  3VMI A;  1I6H I;  3K7A I;  1USP A;  1SFO I;  4A3I I;  2JR6 A;  3PO2 I;  3Q87 A;  4Y7N I;  4A3B I;  2JA5 I;  3HOU I;  2AKL A;  4NB8 A;  1WCM I;  1K83 I;  4QTT A;  2DE5 A;  1X3W A;  1L1O C;  1LQL A;  2DE7 A;  2NVT I;  3HOW I;  1ZB8 A;  3U50 C;  2R92 I;  3S1Q I;  3D6W A;  3VB9 A;  2JNY A;  4A3L I;  3GTL I;  3S1M I;  2RBL A;  3I4M I;  4BY7 I;  4A3M I;  4BBS I;  2R7Z I;  1YUA A;  1ML8 A;  2E2I I;  2E2J I;  2JA7 I;  3HOX I;  1Y1V S;  3GTP I;  4XX2 A;  5C3E I;  3HOY I;  3S17 I;  1Y1V I;  4A3C I;  3GTM S;  2KPI A;  2JS4 A;  4BBR I;  4NBB A;  5C4J I;  2JA8 I;  4Y52 I;  4NOZ A;  2JA6 I;  2E2H I;  4NB9 A;  5C44 I;  5IP7 I;  3GTG I;  1TFI A;  2F4O A;  3RZO I;  3M4O I;  4NBH A;  3ESW A;  1TWG I;  1ZB9 A;  3HOV I;  3H3V J;  2BJO A;  3S16 I;  2NVQ I;  1DL6 A;  1TWA I;  3GCF A;  3M3Y I;  3S2D I;  2F4M A;  3GTM I;  1TWC I;  3EER A;  1PFT A;  3GTQ I;  5C4X I;  4NBD A;  2HF1 A;  3S2H I;  3VMG A;  3GKQ A;  3S1N I;  1VLA A;  4A3G I;  2R93 I;  1N2F A;  4A3E I;  3PO3 S;  4NBF A;  3S15 I;  2DE6 A;  2YU9 I;  2J6A A;  1WW9 A;  4NBG A;  2B63 I;  3H0G I;  3I4N I;  3RZD I;  4A3K I;  4A3J I;  1TWH I;  3S14 I;  4NBA A;  3GTJ I;  4A3D I;  1USP B;  1NUI A;  3FKI I;  3I07 A;  3LUS A;  1R9T I;  5CM2 M;  4MH4 A;  5IP9 I;  3GTK I;  4QTU A;  5FLM I;  3GTO I;  1RO4 A;  3VMH A;  2NVX I;  4A93 I;  3CQZ I;  4BY1 I;  2VUM I;  4NBC A;  3HOZ I; 
#chains in the Genus database with same CATH topology
 2GTI A;  4HGY A;  4E33 A;  4NBE A;  1M90 1;  2RIQ A;  2IZ4 A;  1YHQ 1;  1K73 2;  3S1R I;  1X3Z A;  1NJI 2;  3G71 1;  1I3Q I;  2P3Y A;  1Q7Y 1;  5IT9 f;  1I6H I;  1QVF Z;  3K7A I;  1VQ4 Z;  1USP A;  2O53 A;  1QF8 A;  2JR6 A;  2JUB A;  1VQK 1;  4Y7N I;  2ZAE B;  4E31 A;  1VQ8 1;  4NB8 A;  1WCM I;  1Q86 1;  4E2X A;  2OTL Z;  2R6M A;  3J81 f;  1VQO 1;  2LEX A;  3D6W A;  3GTL I;  4BY7 I;  4A3M I;  3IFU A;  1Y1V S;  3CC2 1;  3GTP I;  3HOY I;  1KC8 1;  3S17 I;  1Y1V I;  2OTL 1;  2JIO A;  3GTM S;  1FDO A;  1YJ9 1;  3CPW Z;  2JS4 A;  2VPX A;  3EED A;  1YJN 1;  2V8K A;  3F3P C;  2QLV B;  4NOZ A;  3CCE Z;  1S72 1;  3JAM f;  3IF8 A;  4E2Y A;  4NBH A;  1TWG I;  2JIM A;  1ZB9 A;  3HOV I;  2NVQ I;  3M3Y I;  1Q81 1;  4E2Z A;  3EER A;  1PFT A;  1Z02 A;  1KD1 2;  3GKQ A;  3CCS 1;  1KC8 2;  3P5J B;  4NBF A;  3S15 I;  3CC4 1;  1VQL 1;  3G6E 1;  3CXC Z;  1USP B;  3CD6 1;  1QVG Y;  3I55 1;  3LUS A;  2GTH A;  4RVG A;  3CC4 Z;  3CME Z;  3CCM 1;  1VQN 1;  1RO4 A;  2NVX I;  3I56 Z;  1Z03 A;  1WII A;  2VUM I;  1YJ9 Z;  3CD6 Z;  2P28 A;  2OOX B;  1TWF I;  3CCU 1;  2V45 A;  3I55 Z;  2H85 A;  4NH1 C;  4E32 A;  1S72 Z;  4BXX I;  2PK7 A;  2NAP A;  3CCL 1;  3VMI A;  1YUK A;  1SFO I;  4A3I I;  2RHB A;  3PO2 I;  4A3B I;  2VPW A;  1K83 I;  4QTT A;  1VQ6 1;  2PMZ A;  2DE5 A;  1M90 2;  2VPY A;  3G6E Z;  1ZB8 A;  2R92 I;  3OW2 Y;  3S1Q I;  2JNY A;  3S1M I;  2RBL A;  3I4M I;  5FLX f;  1YIJ Z;  2V3V A;  2R7Z I;  1YUA A;  3HKZ A;  1Q82 2;  3CXC Y;  2JA7 I;  1KQS Y;  3HOX I;  1K8A 2;  4TNU A;  4A3C I;  1VQM 1;  2KPI A;  3T4N B;  3MON A;  4NBB A;  3CCR Z;  4HH4 A;  3FQQ A;  2V8J A;  2QA4 Z;  2E2H I;  2JA6 I;  5C44 I;  5IP7 I;  2JMO A;  1WZN A;  4CL1 A;  2IZ3 A;  2F4O A;  3RZO I;  2PM9 A;  3J7A 4;  2BJO A;  1DL6 A;  1TWA I;  2M6N A;  3MZK B;  1NJI 1;  3S2D I;  2F4M A;  3GTM I;  5C4X I;  5D1O A;  1WJ2 A;  3VMG A;  2HU9 A;  4A3G I;  4AYB A;  2R93 I;  2W03 A;  1N2F A;  4A3E I;  3PO3 S;  2IV2 X;  2DE6 A;  2J6A A;  1WW9 A;  2VUG A;  3I4N I;  2VPZ A;  2KI7 B;  3RZD I;  1VQ4 1;  3S14 I;  4A3D I;  1NUI A;  4DGL A;  3J80 f;  3I07 A;  3CC7 Z;  3CCQ 1;  1Q16 A;  2YAD A;  5IP9 I;  2WB1 A;  5FLM I;  3KIF A;  4A93 I;  1YI2 Z;  2NVY I;  5A2Q b;  1W2B Z;  2JIQ A;  1K9M 1;  2AYD A;  2QA4 1;  5FLX b;  2K5R A;  3CC7 1;  4X6A I;  1I50 I;  1YHQ Z;  3BG0 B;  3CCV Z;  1Z01 A;  1VQ6 Z;  4MD8 A;  1X0T A;  3CME 1;  3CCM Z;  3NDI A;  1M1K 1;  3CMA Z;  1KRL A;  3I56 1;  1N8R 1;  3HOU I;  2LFU A;  2AKL A;  1QVG Z;  3D9X A;  5T64 A;  1X3W A;  1LQL A;  2NVT I;  2M48 A;  1K9M 2;  3HOW I;  3U50 C;  1YIT Z;  1VQM Z;  3CCS Z;  2WAQ A;  2RPR A;  3CCV 1;  4BBS I;  1ML8 A;  2E2I I;  2JIR A;  4MRI A;  1AA6 A;  3G71 Z;  4BBR I;  2LIY A;  3NH8 A;  3J81 b;  1Y8C A;  4Y52 I;  1M1K 2;  4NB9 A;  4DQY B;  3CCE 1;  1TFI A;  1YIT 1;  3IR7 A;  3M4O I;  3H3V J;  1W2B Y;  1NP6 A;  1VQ9 Z;  1VQP Z;  1VQK Z;  2QKD A;  2QEX 1;  1TWC I;  1JWH C;  1VQ8 Z;  2HF1 A;  3S2H I;  1RNI A;  3G4S Z;  1VLA A;  1VQO Z;  3OW2 Z;  2YU9 I;  2VF1 A;  3CC2 Z;  2B63 I;  4RVF A;  3H0G I;  3CCR 1;  4A3K I;  1RO2 A;  1TWH I;  3MZL B;  2RT9 A;  3GTJ I;  4DK1 A;  1VQ7 1;  2OTJ 1;  1Q7Y 2;  1RO0 A;  3KIH A;  3NFZ A;  1VQN Z;  4MH4 A;  3CCJ 1;  3GTK I;  4EWC A;  4E30 A;  2K3R A;  1K8A 1;  3GTO I;  1YIJ 1;  4BY1 I;  3JAM b;  4RV9 A;  3HOZ I;  2E9H A;  3NDJ A;  3BG1 B;  1QYP A;  4RVH A;  4A3F I;  1Y1W I;  3PO3 I;  1RLY A;  4RVD A;  1VQ9 1;  3VTN A;  1VQP 1;  1ZH1 A;  1K73 1;  2QEX Z;  2QRE B;  2GU2 A;  3FQM A;  3Q87 A;  5T6B A;  3NH4 A;  5T67 A;  1KQS Z;  2W04 A;  2OZK A;  3G4S 1;  4E2W A;  3D2L A;  1YI2 1;  4MD9 A;  2JA5 I;  2G2K A;  1L1O C;  2QRC B;  2DE7 A;  2Q4Z A;  2QR1 B;  3VB9 A;  4S1T A;  4A3L I;  1QXF A;  2I3C A;  5D1O B;  1Q81 2;  1FDI A;  2Q51 A;  4NFR A;  2E2J I;  3CCU Z;  4XX2 A;  5C3E I;  2O4H A;  2E7Z A;  4RS4 A;  1JJ2 Z;  3CCQ Z;  5C4J I;  1VQ5 1;  1YJW Z;  2JA8 I;  1N8R 2;  3GTG I;  3F3F C;  3QWU A;  1S7M A;  2OOY B;  3IX0 A;  5IT9 b;  3ESW A;  1YJN Z;  1SIW A;  3S16 I;  2Y0S A;  3GCF A;  1RQF A;  3CPW Y;  2V8I A;  3GTQ I;  4NBD A;  3J80 b;  1JJ2 Y;  3TDH B;  5LL6 f;  1YJW 1;  1VQ5 Z;  3S1N I;  1KD1 1;  3NH5 A;  1VQ7 Z;  2OTJ Z;  3TE5 B;  4MXU A;  2JIP A;  4NBG A;  5D1P A;  4MD7 A;  4A3J I;  4NBA A;  3CCJ Z;  3CMA 1;  3CCL Z;  3FKI I;  5A2Q f;  1P9N A;  4MON A;  1R9T I;  1Q82 1;  1VQL Z;  5CM2 M;  4QTU A;  5AN9 F;  2EGT A;  3VMH A;  1QVF Y;  3CQZ I;  2QRD B;  4HGZ A;  1Q86 2;  4NBC A; 
#chains in the Genus database with same CATH homology
 2GTI A;  4HGY A;  4E33 A;  4NBE A;  1M90 1;  2RIQ A;  2IZ4 A;  1YHQ 1;  1K73 2;  3S1R I;  1X3Z A;  1NJI 2;  3G71 1;  1I3Q I;  2P3Y A;  1Q7Y 1;  5IT9 f;  1I6H I;  1QVF Z;  3K7A I;  1VQ4 Z;  1USP A;  2O53 A;  1QF8 A;  2JR6 A;  2JUB A;  1VQK 1;  4Y7N I;  2ZAE B;  4E31 A;  1VQ8 1;  4NB8 A;  1WCM I;  1Q86 1;  4E2X A;  2OTL Z;  2R6M A;  3J81 f;  1VQO 1;  3D6W A;  3GTL I;  4BY7 I;  4A3M I;  3IFU A;  1Y1V S;  3CC2 1;  3GTP I;  3HOY I;  1KC8 1;  3S17 I;  1Y1V I;  2OTL 1;  3GTM S;  3CPW Z;  1YJ9 1;  2JS4 A;  3EED A;  1YJN 1;  2V8K A;  3F3P C;  2QLV B;  4NOZ A;  3CCE Z;  1S72 1;  3JAM f;  3IF8 A;  4E2Y A;  4NBH A;  1TWG I;  1ZB9 A;  3HOV I;  2NVQ I;  3M3Y I;  1Q81 1;  4E2Z A;  3EER A;  1PFT A;  1Z02 A;  1KD1 2;  3GKQ A;  3CCS 1;  1KC8 2;  3P5J B;  4NBF A;  3S15 I;  3CC4 1;  1VQL 1;  3G6E 1;  3CXC Z;  1USP B;  3CD6 1;  1QVG Y;  3I55 1;  3LUS A;  2GTH A;  4RVG A;  3CC4 Z;  3CME Z;  3CCM 1;  1VQN 1;  1RO4 A;  2NVX I;  3I56 Z;  1Z03 A;  1WII A;  2VUM I;  1YJ9 Z;  3CD6 Z;  2P28 A;  2OOX B;  1TWF I;  3CCU 1;  3I55 Z;  2H85 A;  4NH1 C;  4E32 A;  1S72 Z;  4BXX I;  2PK7 A;  3CCL 1;  3VMI A;  1YUK A;  1SFO I;  4A3I I;  2RHB A;  3PO2 I;  4A3B I;  1K83 I;  4QTT A;  1VQ6 1;  2PMZ A;  2DE5 A;  1M90 2;  3G6E Z;  1ZB8 A;  2R92 I;  3OW2 Y;  3S1Q I;  2JNY A;  3S1M I;  2RBL A;  3I4M I;  5FLX f;  1YIJ Z;  2R7Z I;  1YUA A;  3HKZ A;  1Q82 2;  3CXC Y;  2JA7 I;  1KQS Y;  3HOX I;  1K8A 2;  4TNU A;  4A3C I;  1VQM 1;  2KPI A;  3T4N B;  3MON A;  4NBB A;  3CCR Z;  4HH4 A;  3FQQ A;  2V8J A;  2QA4 Z;  2E2H I;  2JA6 I;  5C44 I;  5IP7 I;  2JMO A;  4CL1 A;  2IZ3 A;  2F4O A;  3RZO I;  2PM9 A;  3J7A 4;  2BJO A;  1DL6 A;  1TWA I;  2M6N A;  3MZK B;  1NJI 1;  3S2D I;  2F4M A;  3GTM I;  5C4X I;  5D1O A;  3VMG A;  2HU9 A;  4A3G I;  4AYB A;  2R93 I;  2W03 A;  1N2F A;  4A3E I;  3PO3 S;  2DE6 A;  2J6A A;  1WW9 A;  2VUG A;  3I4N I;  2KI7 B;  3RZD I;  1VQ4 1;  3S14 I;  4A3D I;  1NUI A;  4DGL A;  3J80 f;  3I07 A;  3CC7 Z;  3CCQ 1;  2YAD A;  5IP9 I;  2WB1 A;  5FLM I;  3KIF A;  4A93 I;  1YI2 Z;  2NVY I;  5A2Q b;  1W2B Z;  1K9M 1;  2QA4 1;  5FLX b;  2K5R A;  3CC7 1;  4X6A I;  1I50 I;  1YHQ Z;  3BG0 B;  3CCV Z;  1Z01 A;  1VQ6 Z;  4MD8 A;  1X0T A;  3CME 1;  3CCM Z;  3NDI A;  1M1K 1;  3CMA Z;  1KRL A;  3I56 1;  1N8R 1;  3HOU I;  2LFU A;  2AKL A;  1QVG Z;  3D9X A;  5T64 A;  1X3W A;  1LQL A;  2NVT I;  2M48 A;  1K9M 2;  3HOW I;  3U50 C;  1YIT Z;  1VQM Z;  3CCS Z;  2WAQ A;  2RPR A;  3CCV 1;  4BBS I;  1ML8 A;  2E2I I;  4MRI A;  3G71 Z;  4BBR I;  2LIY A;  3NH8 A;  3J81 b;  4Y52 I;  1M1K 2;  4NB9 A;  4DQY B;  3CCE 1;  1TFI A;  1YIT 1;  3M4O I;  3H3V J;  1W2B Y;  1NP6 A;  1VQ9 Z;  1VQP Z;  1VQK Z;  2QKD A;  2QEX 1;  1TWC I;  1JWH C;  1VQ8 Z;  2HF1 A;  3S2H I;  1RNI A;  3G4S Z;  1VLA A;  1VQO Z;  3OW2 Z;  2YU9 I;  2VF1 A;  3CC2 Z;  2B63 I;  4RVF A;  3H0G I;  3CCR 1;  4A3K I;  1RO2 A;  1TWH I;  3MZL B;  2RT9 A;  3GTJ I;  4DK1 A;  1VQ7 1;  2OTJ 1;  1Q7Y 2;  1RO0 A;  3KIH A;  3NFZ A;  1VQN Z;  4MH4 A;  3CCJ 1;  3GTK I;  4EWC A;  4E30 A;  2K3R A;  1K8A 1;  3GTO I;  1YIJ 1;  4BY1 I;  3JAM b;  4RV9 A;  3HOZ I;  2E9H A;  3NDJ A;  3BG1 B;  1QYP A;  4RVH A;  4A3F I;  1Y1W I;  3PO3 I;  1RLY A;  4RVD A;  1VQ9 1;  3VTN A;  1VQP 1;  1ZH1 A;  1K73 1;  2QEX Z;  2QRE B;  2GU2 A;  3FQM A;  3Q87 A;  5T6B A;  3NH4 A;  5T67 A;  1KQS Z;  2W04 A;  2OZK A;  3G4S 1;  4E2W A;  1YI2 1;  2JA5 I;  4MD9 A;  2G2K A;  1L1O C;  2QRC B;  2DE7 A;  2Q4Z A;  2QR1 B;  3VB9 A;  4S1T A;  4A3L I;  2I3C A;  5D1O B;  1Q81 2;  2Q51 A;  4NFR A;  2E2J I;  3CCU Z;  4XX2 A;  5C3E I;  2O4H A;  4RS4 A;  1JJ2 Z;  3CCQ Z;  5C4J I;  1VQ5 1;  1YJW Z;  2JA8 I;  1N8R 2;  3GTG I;  3F3F C;  3QWU A;  1S7M A;  2OOY B;  3IX0 A;  5IT9 b;  3ESW A;  1YJN Z;  3S16 I;  2Y0S A;  3GCF A;  1RQF A;  3CPW Y;  2V8I A;  3GTQ I;  4NBD A;  3J80 b;  1JJ2 Y;  3TDH B;  5LL6 f;  1YJW 1;  1VQ5 Z;  3S1N I;  1KD1 1;  3NH5 A;  1VQ7 Z;  2OTJ Z;  3TE5 B;  4MXU A;  4NBG A;  5D1P A;  4MD7 A;  4A3J I;  4NBA A;  3CCJ Z;  3CMA 1;  3CCL Z;  3FKI I;  5A2Q f;  1P9N A;  4MON A;  1R9T I;  1Q82 1;  1VQL Z;  5CM2 M;  4QTU A;  5AN9 F;  2EGT A;  3VMH A;  1QVF Y;  3CQZ I;  2QRD B;  4HGZ A;  1Q86 2;  4NBC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...