2KPIA

Solution nmr structure of streptomyces coelicolor sco3027 modeled with zn+2 bound, northeast structural genomics consortium target rr58
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
56
structure length
56
Chain Sequence
MPLEAGLLEILACPACHAPLEERDAELICTGQDCGLAYPVRDGIPVLLVDEARRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein SCO3027
publication title Solution NMR structure of Streptomyces coelicolor SCO3027 modeled with Zn+2 bound, Northeast Structural Genomics Consortium Target RR58
rcsb
source organism Streptomyces coelicolor
total genus 6
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2009-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03966 Trm112p Trm112p-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2kpiA01
4BXXI 4BBRI 4BY1I 3M4OI 1X3ZA 5C44I 1I6HI 2J6AA 2F4MA 4NOZA 4NBFA 5C4XI 4X6AI 1YUAA 4A3CI 1TWAI 1RLYA 1TWFI 1X3WA 1I3QI 3GTOI 3D6WA 4NB8A 1L1OC 2DE6A 5C3EI 1TWGI 3RZOI 3U50C 3I07A 3ESWA 3FKII 3S1MI 1WW9A 2K5RA 3VB9A 1DL6A 2E2HI 3LUSA 5IP9I 2DE7A 3S15I 3HOVI 4MH4A 1ZB8A 5FLMI 2YU9I 1ZB9A 2R92I 3S1RI 3HOWI 4A3LI 3HOXI 3VMHA 5C4JI 4QTUA 2JS4A 3S14I 3GTJI 3S2DI 5CM2M 3S17I 3S1QI 1Y1WI 1R9TI 4NBCA 3GKQA 3VMGA 5IP7I 1WCMI 4NBGA 3RZDI 1NUIA 2VUMI 3CQZI 2NVQI 2HF1A 2E2JI 4A3GI 4NB9A 4A3JI 3PO2I 3PO3I 4NBEA 3GTGI 3GTKI 4A3EI 4QTTA 3S1NI 3PO3S 2NVYI 2KPIA 2JA8I 4NBHA 3K7AI 2E2II 2P3YA 2PK7A 3I4MI 4NBDA 2R93I 3M3YI 1TWCI 1QYPA 2RBLA 3GTLI 3GTQI 1RO4A 3VMIA 1PFTA 2R7ZI 4A93I 2NVXI 2B63I 4NBAA 4XX2A 4A3II 2AKLA 3HOZI 1K83I 3EERA 2NVTI 3GCFA 4A3KI 1Y1VI 2F4OA 3H3VJ 3HOYI 1Y1VS 2JA7I 4A3MI 1TFIA 3HOUI 3S16I 1TWHI 2JR6A 4Y52I 1LQLA 3I4NI 3GTMI 4A3BI 3H0GI 1SFOI 1VLAA 3GTMS 4A3FI 1USPA 3S2HI 1USPB 2BJOA 4Y7NI 1N2FA 4BY7I 2DE5A 4NBBA 1I50I 2JA5I 4A3DI 3GTPI 1ML8A 4BBSI 3Q87A 2JA6I 2JNYA
chains in the Genus database with same CATH superfamily
4BXXI 1YJ91 3CCQZ 4BY1I 3CC71 2I3CA 1X3ZA 2QR1B 2J6AA 2F4MA 1NP6A 3CCQ1 4NBFA 4DK1A 1VQL1 4X6AI 1YUAA 1TWAI 2QREB 1TWFI 1X3WA 2VPWA 2VPZA 4E30A 2OTJZ 2QRDB 2VUGA 4E2ZA 3I07A 3FKII 1W2BY 3OW2Z 2K5RA 3VB9A 1DL6A 2OTJ1 3CXCY 1QVFZ 3G6EZ 1VQMZ 5IT9f 1M1K2 1M901 1YITZ 1Y8CA 2QA41 2R92I 3HOWI 4A3LI 4MD9A 2PM9A 3HOXI 3G6E1 3VMHA 1KRLA 2JS4A 1X0TA 2V45A 1Q16A 5CM2M 1YIT1 1Q861 1Y1WI 1Q7Y2 1N8R1 5IP7I 3NH8A 3CMEZ 1VQ5Z 3RZDI 1Q821 3CQZI 2NVQI 4A3GI 1VQ51 1VQP1 1YJNZ 3GTKI 2NVYI 4HGYA 2JA8I 4RVGA 4NBHA 1VQ4Z 3IX0A 1YJN1 1QYPA 3JAMf 1RO4A 3VMIA 3CC4Z 1VQ41 1YJWZ 1M1K1 2NVXI 1VQNZ 2W04A 3F3FC 2NVTI 3CC41 1YJW1 3CCRZ 2F4OA 3HOYI 1VQN1 1TFIA 3CCR1 4RS4A 3CCLZ 1USPA 2V8JA 4MRIA 1YI2Z 3QWUA 1YI21 1VQ8Z 2JA5I 4RVFA 3GTPI 4BBSI 3Q87A 2IZ3A 4BBRI 4MD8A 1K9M1 1VQ81 3VTNA 1P9NA 3M4OI 2JIQA 1Q811 5IT9b 1NJI2 3CPWY 5D1OB 3F3PC 4A3CI 1JJ2Y 3GTOI 2KI7B 1L1OC 2R6MA 2V3VA 3RZOI 3U50C 5T67A 1VQ9Z 1Z03A 2P28A 2RHBA 2DE7A 5D1PA 4E2XA 1VQ91 2VPYA 2QLVB 1Q862 3G71Z 2LEXA 2QEXZ 1N8R2 1S72Z 2VPXA 2QKDA 1AA6A 3MZLB 1Q822 3JAMb 2OTLZ 4E31A 1RNIA 4QTUA 3G711 3S17I 2QEX1 3S1QI 1S721 1NJI1 3VMGA 4S1TA 1WCMI 1WJ2A 1YUKA 2VUMI 4MD7A 3J80f 3PO3I 4NBEA 3PO3S 1RO0A 2KPIA 4HGZA 3CCMZ 2P3YA 2PK7A 4NBDA 3J7A4 1TWCI 2RBLA 2ZAEB 1VQM1 4A93I 1QVGZ 3NFZA 4A3II 5FLXf 2JMOA 2EGTA 1K83I 3GCFA 3CPWZ 3J81f 1VQOZ 2OZKA 2HU9A 1JWHC 4A3MI 3HOUI 1TWHI 2GTHA 3NDJA 3CME1 4Y52I 2M6NA 3GTMI 2GTIA 4A3BI 1VLAA 2M48A 3GTMS 3S2HI 3NH4A 3NH5A 3IR7A 2VF1A 3CCSZ 3CMAZ 4Y7NI 4RVDA 4BY7I 1Z01A 2PMZA 1K9M2 1QXFA 4NBBA 1Z02A 1Q812 4A3DI 3CCS1 2O4HA 3CMA1 3MONA 1RQFA 2JA6I 2V8KA 4NH1C 4EWCA 5D1OA 1K732 1VQKZ 1KQSY 3D9XA 4NOZA 1FDIA 2K3RA 4RVHA 1W2BZ 1RLYA 2YADA 3D6WA 3CXCZ 3CD6Z 3EEDA 2DE6A 5C3EI 3CCL1 1TWGI 2G2KA 1KD12 4E2YA 3S1MI 3CC2Z 3TDHB 2E2HI 3J80b 3S15I 3CC21 3I55Z 4MH4A 3OW2Y 1ZB8A 5FLMI 2YU9I 3S1RI 1QVFY 2Q4ZA 4E33A 3BG1B 4E2WA 3S2DI 1K731 2QRCB 5FLXb 4NBGA 4MXUA 1NUIA 3J81b 2E2JI 4NB9A 1KC81 2V8IA 2O53A 4A3EI 1KD11 3HKZA 4CL1A 3T4NB 2E2II 3NDIA 3I4MI 3IF8A 1VQ6Z 3GTQI 1PFTA 2R7ZI 2NAPA 1YJ9Z 2OTL1 3HOZI 3EERA 1WIIA 5A2Qf 4E32A 1Y1VI 3H3VJ 1Y1VS 2IZ4A 2JA7I 1VQLZ 1FDOA 2JR6A 3H0GI 1SIWA 5LL6f 5T64A 4A3FI 2E9HA 1K8A1 3CCM1 2DE5A 4HH4A 2JIPA 1I50I 1QF8A 3CCVZ 2JNYA 2QA4Z 1JJ2Z 3CCV1 1I6HI 5C44I 2IV2X 3TE5B 3MZKB 4NFRA 3G4SZ 1VQO1 5C4XI 2OOYB 3FQQA 1I3QI 4NB8A 3G4S1 2H85A 4MONA 2E7ZA 3ESWA 1S7MA 1VQPZ 1WW9A 4RV9A 2JUBA 3LUSA 3IFUA 5IP9I 3KIFA 3I56Z 4AYBA 3HOVI 2JIRA 1VQ7Z 3D2LA 1ZB9A 2JIMA 3I561 3P5JB 4DQYB 2Y0SA 5C4JI 5AN9F 3S14I 1VQ71 1VQK1 3GTJI 2LFUA 1R9TI 4NBCA 3GKQA 3CCJZ 2RT9A 1KC82 5A2Qb 2LIYA 3CD61 1RO2A 2HF1A 1YIJZ 3CCJ1 3CCEZ 1WZNA 1Q7Y1 4A3JI 3PO2I 3GTGI 2Q51A 4QTTA 3S1NI 1YIJ1 3K7AI 3CCE1 2WB1A 2W03A 2JIOA 2R93I 3M3YI 3GTLI 2AYDA 3I551 5T6BA 1YHQZ 3KIHA 2B63I 4NBAA 4XX2A 2AKLA 2RIQA 4A3KI 4TNUA 4DGLA 3BG0B 1YHQ1 3FQMA 1QVGY 2RPRA 3CCUZ 3S16I 1LQLA 3I4NI 2WAQA 1K8A2 1ZH1A 1SFOI 2GU2A 3CCU1 1USPB 2BJOA 1N2FA 2OOXB 1VQ61 3CC7Z 1M902 1KQSZ 1ML8A
chains in the Genus database with same CATH topology
4BXXI 1YJ91 3CCQZ 4BY1I 3CC71 2I3CA 1X3ZA 2QR1B 2J6AA 2F4MA 1NP6A 3CCQ1 4NBFA 4DK1A 1VQL1 4X6AI 1YUAA 1TWAI 2QREB 1TWFI 1X3WA 4E30A 2OTJZ 2QRDB 2VUGA 4E2ZA 3I07A 3FKII 1W2BY 3OW2Z 2K5RA 3VB9A 1DL6A 2OTJ1 3CXCY 1QVFZ 3G6EZ 1VQMZ 5IT9f 1M1K2 1M901 1YITZ 2QA41 2R92I 3HOWI 4A3LI 4MD9A 2PM9A 3HOXI 3G6E1 3VMHA 1KRLA 2JS4A 1X0TA 5CM2M 1YIT1 1Q861 1Y1WI 1Q7Y2 1N8R1 5IP7I 3NH8A 3CMEZ 1VQ5Z 3RZDI 1Q821 3CQZI 2NVQI 4A3GI 1VQ51 1VQP1 1YJNZ 3GTKI 2NVYI 4HGYA 2JA8I 4RVGA 4NBHA 1VQ4Z 3IX0A 1YJN1 1QYPA 3JAMf 1RO4A 3VMIA 3CC4Z 1VQ41 1YJWZ 1M1K1 2NVXI 1VQNZ 2W04A 3F3FC 2NVTI 3CC41 1YJW1 3CCRZ 2F4OA 3HOYI 1VQN1 1TFIA 3CCR1 4RS4A 3CCLZ 1USPA 2V8JA 4MRIA 1YI2Z 3QWUA 1YI21 1VQ8Z 2JA5I 4RVFA 3GTPI 4BBSI 3Q87A 2IZ3A 4BBRI 4MD8A 1K9M1 1VQ81 3VTNA 1P9NA 3M4OI 1Q811 5IT9b 1NJI2 3CPWY 5D1OB 3F3PC 4A3CI 1JJ2Y 3GTOI 2KI7B 1L1OC 2R6MA 3RZOI 3U50C 5T67A 1VQ9Z 1Z03A 2P28A 2RHBA 2DE7A 5D1PA 4E2XA 1VQ91 2QLVB 1Q862 3G71Z 2QEXZ 1N8R2 1S72Z 2QKDA 3MZLB 1Q822 3JAMb 2OTLZ 4E31A 1RNIA 4QTUA 3G711 3S17I 2QEX1 3S1QI 1S721 1NJI1 3VMGA 4S1TA 1WCMI 1YUKA 2VUMI 4MD7A 3J80f 3PO3I 4NBEA 3PO3S 1RO0A 2KPIA 4HGZA 3CCMZ 2P3YA 2PK7A 4NBDA 3J7A4 1TWCI 2RBLA 2ZAEB 1VQM1 4A93I 1QVGZ 3NFZA 4A3II 5FLXf 2JMOA 2EGTA 1K83I 3GCFA 3CPWZ 3J81f 1VQOZ 2OZKA 2HU9A 1JWHC 4A3MI 3HOUI 1TWHI 2GTHA 3NDJA 3CME1 4Y52I 2M6NA 3GTMI 2GTIA 4A3BI 1VLAA 2M48A 3GTMS 3S2HI 3NH4A 3NH5A 2VF1A 3CCSZ 3CMAZ 4Y7NI 4RVDA 4BY7I 1Z01A 2PMZA 1K9M2 4NBBA 1Z02A 1Q812 4A3DI 3CCS1 2O4HA 3CMA1 3MONA 1RQFA 2JA6I 2V8KA 4NH1C 4EWCA 5D1OA 1K732 1VQKZ 1KQSY 3D9XA 4NOZA 2K3RA 4RVHA 1W2BZ 1RLYA 2YADA 3D6WA 3CXCZ 3CD6Z 3EEDA 2DE6A 5C3EI 3CCL1 1TWGI 2G2KA 1KD12 4E2YA 3S1MI 3CC2Z 3TDHB 2E2HI 3J80b 3S15I 3CC21 3I55Z 4MH4A 3OW2Y 1ZB8A 5FLMI 2YU9I 3S1RI 1QVFY 2Q4ZA 4E33A 3BG1B 4E2WA 3S2DI 1K731 2QRCB 5FLXb 4NBGA 4MXUA 1NUIA 3J81b 2E2JI 4NB9A 1KC81 2V8IA 2O53A 4A3EI 1KD11 3HKZA 4CL1A 3T4NB 2E2II 3NDIA 3I4MI 3IF8A 1VQ6Z 3GTQI 1PFTA 2R7ZI 1YJ9Z 2OTL1 3HOZI 3EERA 1WIIA 5A2Qf 4E32A 1Y1VI 3H3VJ 1Y1VS 2IZ4A 2JA7I 1VQLZ 2JR6A 3H0GI 5LL6f 5T64A 4A3FI 2E9HA 1K8A1 3CCM1 2DE5A 4HH4A 1I50I 1QF8A 3CCVZ 2JNYA 2QA4Z 1JJ2Z 3CCV1 1I6HI 5C44I 3TE5B 3MZKB 4NFRA 3G4SZ 1VQO1 5C4XI 2OOYB 3FQQA 1I3QI 4NB8A 3G4S1 2H85A 4MONA 3ESWA 1S7MA 1VQPZ 1WW9A 4RV9A 2JUBA 3LUSA 3IFUA 5IP9I 3KIFA 3I56Z 4AYBA 3HOVI 1VQ7Z 1ZB9A 3I561 3P5JB 4DQYB 2Y0SA 5C4JI 5AN9F 3S14I 1VQ71 1VQK1 3GTJI 2LFUA 1R9TI 4NBCA 3GKQA 3CCJZ 2RT9A 1KC82 5A2Qb 2LIYA 3CD61 1RO2A 2HF1A 1YIJZ 3CCJ1 3CCEZ 1Q7Y1 4A3JI 3PO2I 3GTGI 2Q51A 4QTTA 3S1NI 1YIJ1 3K7AI 3CCE1 2WB1A 2W03A 2R93I 3M3YI 3GTLI 3I551 5T6BA 1YHQZ 3KIHA 2B63I 4NBAA 4XX2A 2AKLA 2RIQA 4A3KI 4TNUA 4DGLA 3BG0B 1YHQ1 3FQMA 1QVGY 2RPRA 3CCUZ 3S16I 1LQLA 3I4NI 2WAQA 1K8A2 1ZH1A 1SFOI 2GU2A 3CCU1 1USPB 2BJOA 1N2FA 2OOXB 1VQ61 3CC7Z 1M902 1KQSZ 1ML8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BXX I;  4BBR I;  4BY1 I;  3M4O I;  1X3Z A;  5C44 I;  1I6H I;  2J6A A;  2F4M A;  4NOZ A;  4NBF A;  5C4X I;  4X6A I;  1YUA A;  4A3C I;  1TWA I;  1RLY A;  1TWF I;  1X3W A;  1I3Q I;  3GTO I;  3D6W A;  4NB8 A;  1L1O C;  2DE6 A;  5C3E I;  1TWG I;  3RZO I;  3U50 C;  3I07 A;  3ESW A;  3FKI I;  3S1M I;  1WW9 A;  2K5R A;  3VB9 A;  1DL6 A;  2E2H I;  3LUS A;  5IP9 I;  2DE7 A;  3S15 I;  3HOV I;  4MH4 A;  1ZB8 A;  5FLM I;  2YU9 I;  1ZB9 A;  2R92 I;  3S1R I;  3HOW I;  4A3L I;  3HOX I;  3VMH A;  5C4J I;  4QTU A;  2JS4 A;  3S14 I;  3GTJ I;  3S2D I;  5CM2 M;  3S17 I;  3S1Q I;  1Y1W I;  1R9T I;  4NBC A;  3GKQ A;  3VMG A;  5IP7 I;  1WCM I;  4NBG A;  3RZD I;  1NUI A;  2VUM I;  3CQZ I;  2NVQ I;  2HF1 A;  2E2J I;  4A3G I;  4NB9 A;  4A3J I;  3PO2 I;  3PO3 I;  4NBE A;  3GTG I;  3GTK I;  4A3E I;  4QTT A;  3S1N I;  3PO3 S;  2NVY I;  2KPI A;  2JA8 I;  4NBH A;  3K7A I;  2E2I I;  2P3Y A;  2PK7 A;  3I4M I;  4NBD A;  2R93 I;  3M3Y I;  1TWC I;  1QYP A;  2RBL A;  3GTL I;  3GTQ I;  1RO4 A;  3VMI A;  1PFT A;  2R7Z I;  4A93 I;  2NVX I;  2B63 I;  4NBA A;  4XX2 A;  4A3I I;  2AKL A;  3HOZ I;  1K83 I;  3EER A;  2NVT I;  3GCF A;  4A3K I;  1Y1V I;  2F4O A;  3H3V J;  3HOY I;  1Y1V S;  2JA7 I;  4A3M I;  1TFI A;  3HOU I;  3S16 I;  1TWH I;  2JR6 A;  4Y52 I;  1LQL A;  3I4N I;  3GTM I;  4A3B I;  3H0G I;  1SFO I;  1VLA A;  3GTM S;  4A3F I;  1USP A;  3S2H I;  1USP B;  2BJO A;  4Y7N I;  1N2F A;  4BY7 I;  2DE5 A;  4NBB A;  1I50 I;  2JA5 I;  4A3D I;  3GTP I;  1ML8 A;  4BBS I;  3Q87 A;  2JA6 I;  2JNY A; 
#chains in the Genus database with same CATH topology
 4BXX I;  1YJ9 1;  3CCQ Z;  4BY1 I;  3CC7 1;  2I3C A;  1X3Z A;  2QR1 B;  2J6A A;  2F4M A;  1NP6 A;  3CCQ 1;  4NBF A;  4DK1 A;  1VQL 1;  4X6A I;  1YUA A;  1TWA I;  2QRE B;  1TWF I;  1X3W A;  2VPW A;  2VPZ A;  4E30 A;  2OTJ Z;  2QRD B;  2VUG A;  4E2Z A;  3I07 A;  3FKI I;  1W2B Y;  3OW2 Z;  2K5R A;  3VB9 A;  1DL6 A;  2OTJ 1;  3CXC Y;  1QVF Z;  3G6E Z;  1VQM Z;  5IT9 f;  1M1K 2;  1M90 1;  1YIT Z;  1Y8C A;  2QA4 1;  2R92 I;  3HOW I;  4A3L I;  4MD9 A;  2PM9 A;  3HOX I;  3G6E 1;  3VMH A;  1KRL A;  2JS4 A;  1X0T A;  2V45 A;  1Q16 A;  5CM2 M;  1YIT 1;  1Q86 1;  1Y1W I;  1Q7Y 2;  1N8R 1;  5IP7 I;  3NH8 A;  3CME Z;  1VQ5 Z;  3RZD I;  1Q82 1;  3CQZ I;  2NVQ I;  4A3G I;  1VQ5 1;  1VQP 1;  1YJN Z;  3GTK I;  2NVY I;  4HGY A;  2JA8 I;  4RVG A;  4NBH A;  1VQ4 Z;  3IX0 A;  1YJN 1;  1QYP A;  3JAM f;  1RO4 A;  3VMI A;  3CC4 Z;  1VQ4 1;  1YJW Z;  1M1K 1;  2NVX I;  1VQN Z;  2W04 A;  3F3F C;  2NVT I;  3CC4 1;  1YJW 1;  3CCR Z;  2F4O A;  3HOY I;  1VQN 1;  1TFI A;  3CCR 1;  4RS4 A;  3CCL Z;  1USP A;  2V8J A;  4MRI A;  1YI2 Z;  3QWU A;  1YI2 1;  1VQ8 Z;  2JA5 I;  4RVF A;  3GTP I;  4BBS I;  3Q87 A;  2IZ3 A;  4BBR I;  4MD8 A;  1K9M 1;  1VQ8 1;  3VTN A;  1P9N A;  3M4O I;  2JIQ A;  1Q81 1;  5IT9 b;  1NJI 2;  3CPW Y;  5D1O B;  3F3P C;  4A3C I;  1JJ2 Y;  3GTO I;  2KI7 B;  1L1O C;  2R6M A;  2V3V A;  3RZO I;  3U50 C;  5T67 A;  1VQ9 Z;  1Z03 A;  2P28 A;  2RHB A;  2DE7 A;  5D1P A;  4E2X A;  1VQ9 1;  2VPY A;  2QLV B;  1Q86 2;  3G71 Z;  2LEX A;  2QEX Z;  1N8R 2;  1S72 Z;  2VPX A;  2QKD A;  1AA6 A;  3MZL B;  1Q82 2;  3JAM b;  2OTL Z;  4E31 A;  1RNI A;  4QTU A;  3G71 1;  3S17 I;  2QEX 1;  3S1Q I;  1S72 1;  1NJI 1;  3VMG A;  4S1T A;  1WCM I;  1WJ2 A;  1YUK A;  2VUM I;  4MD7 A;  3J80 f;  3PO3 I;  4NBE A;  3PO3 S;  1RO0 A;  2KPI A;  4HGZ A;  3CCM Z;  2P3Y A;  2PK7 A;  4NBD A;  3J7A 4;  1TWC I;  2RBL A;  2ZAE B;  1VQM 1;  4A93 I;  1QVG Z;  3NFZ A;  4A3I I;  5FLX f;  2JMO A;  2EGT A;  1K83 I;  3GCF A;  3CPW Z;  3J81 f;  1VQO Z;  2OZK A;  2HU9 A;  1JWH C;  4A3M I;  3HOU I;  1TWH I;  2GTH A;  3NDJ A;  3CME 1;  4Y52 I;  2M6N A;  3GTM I;  2GTI A;  4A3B I;  1VLA A;  2M48 A;  3GTM S;  3S2H I;  3NH4 A;  3NH5 A;  3IR7 A;  2VF1 A;  3CCS Z;  3CMA Z;  4Y7N I;  4RVD A;  4BY7 I;  1Z01 A;  2PMZ A;  1K9M 2;  1QXF A;  4NBB A;  1Z02 A;  1Q81 2;  4A3D I;  3CCS 1;  2O4H A;  3CMA 1;  3MON A;  1RQF A;  2JA6 I;  2V8K A;  4NH1 C;  4EWC A;  5D1O A;  1K73 2;  1VQK Z;  1KQS Y;  3D9X A;  4NOZ A;  1FDI A;  2K3R A;  4RVH A;  1W2B Z;  1RLY A;  2YAD A;  3D6W A;  3CXC Z;  3CD6 Z;  3EED A;  2DE6 A;  5C3E I;  3CCL 1;  1TWG I;  2G2K A;  1KD1 2;  4E2Y A;  3S1M I;  3CC2 Z;  3TDH B;  2E2H I;  3J80 b;  3S15 I;  3CC2 1;  3I55 Z;  4MH4 A;  3OW2 Y;  1ZB8 A;  5FLM I;  2YU9 I;  3S1R I;  1QVF Y;  2Q4Z A;  4E33 A;  3BG1 B;  4E2W A;  3S2D I;  1K73 1;  2QRC B;  5FLX b;  4NBG A;  4MXU A;  1NUI A;  3J81 b;  2E2J I;  4NB9 A;  1KC8 1;  2V8I A;  2O53 A;  4A3E I;  1KD1 1;  3HKZ A;  4CL1 A;  3T4N B;  2E2I I;  3NDI A;  3I4M I;  3IF8 A;  1VQ6 Z;  3GTQ I;  1PFT A;  2R7Z I;  2NAP A;  1YJ9 Z;  2OTL 1;  3HOZ I;  3EER A;  1WII A;  5A2Q f;  4E32 A;  1Y1V I;  3H3V J;  1Y1V S;  2IZ4 A;  2JA7 I;  1VQL Z;  1FDO A;  2JR6 A;  3H0G I;  1SIW A;  5LL6 f;  5T64 A;  4A3F I;  2E9H A;  1K8A 1;  3CCM 1;  2DE5 A;  4HH4 A;  2JIP A;  1I50 I;  1QF8 A;  3CCV Z;  2JNY A;  2QA4 Z;  1JJ2 Z;  3CCV 1;  1I6H I;  5C44 I;  2IV2 X;  3TE5 B;  3MZK B;  4NFR A;  3G4S Z;  1VQO 1;  5C4X I;  2OOY B;  3FQQ A;  1I3Q I;  4NB8 A;  3G4S 1;  2H85 A;  4MON A;  2E7Z A;  3ESW A;  1S7M A;  1VQP Z;  1WW9 A;  4RV9 A;  2JUB A;  3LUS A;  3IFU A;  5IP9 I;  3KIF A;  3I56 Z;  4AYB A;  3HOV I;  2JIR A;  1VQ7 Z;  3D2L A;  1ZB9 A;  2JIM A;  3I56 1;  3P5J B;  4DQY B;  2Y0S A;  5C4J I;  5AN9 F;  3S14 I;  1VQ7 1;  1VQK 1;  3GTJ I;  2LFU A;  1R9T I;  4NBC A;  3GKQ A;  3CCJ Z;  2RT9 A;  1KC8 2;  5A2Q b;  2LIY A;  3CD6 1;  1RO2 A;  2HF1 A;  1YIJ Z;  3CCJ 1;  3CCE Z;  1WZN A;  1Q7Y 1;  4A3J I;  3PO2 I;  3GTG I;  2Q51 A;  4QTT A;  3S1N I;  1YIJ 1;  3K7A I;  3CCE 1;  2WB1 A;  2W03 A;  2JIO A;  2R93 I;  3M3Y I;  3GTL I;  2AYD A;  3I55 1;  5T6B A;  1YHQ Z;  3KIH A;  2B63 I;  4NBA A;  4XX2 A;  2AKL A;  2RIQ A;  4A3K I;  4TNU A;  4DGL A;  3BG0 B;  1YHQ 1;  3FQM A;  1QVG Y;  2RPR A;  3CCU Z;  3S16 I;  1LQL A;  3I4N I;  2WAQ A;  1K8A 2;  1ZH1 A;  1SFO I;  2GU2 A;  3CCU 1;  1USP B;  2BJO A;  1N2F A;  2OOX B;  1VQ6 1;  3CC7 Z;  1M90 2;  1KQS Z;  1ML8 A; 
#chains in the Genus database with same CATH homology
 4BXX I;  1YJ9 1;  3CCQ Z;  4BY1 I;  3CC7 1;  2I3C A;  1X3Z A;  2QR1 B;  2J6A A;  2F4M A;  1NP6 A;  3CCQ 1;  4NBF A;  4DK1 A;  1VQL 1;  4X6A I;  1YUA A;  1TWA I;  2QRE B;  1TWF I;  1X3W A;  4E30 A;  2OTJ Z;  2QRD B;  2VUG A;  4E2Z A;  3I07 A;  3FKI I;  1W2B Y;  3OW2 Z;  2K5R A;  3VB9 A;  1DL6 A;  2OTJ 1;  3CXC Y;  1QVF Z;  3G6E Z;  1VQM Z;  5IT9 f;  1M1K 2;  1M90 1;  1YIT Z;  2QA4 1;  2R92 I;  3HOW I;  4A3L I;  4MD9 A;  2PM9 A;  3HOX I;  3G6E 1;  3VMH A;  1KRL A;  2JS4 A;  1X0T A;  5CM2 M;  1YIT 1;  1Q86 1;  1Y1W I;  1Q7Y 2;  1N8R 1;  5IP7 I;  3NH8 A;  3CME Z;  1VQ5 Z;  3RZD I;  1Q82 1;  3CQZ I;  2NVQ I;  4A3G I;  1VQ5 1;  1VQP 1;  1YJN Z;  3GTK I;  2NVY I;  4HGY A;  2JA8 I;  4RVG A;  4NBH A;  1VQ4 Z;  3IX0 A;  1YJN 1;  1QYP A;  3JAM f;  1RO4 A;  3VMI A;  3CC4 Z;  1VQ4 1;  1YJW Z;  1M1K 1;  2NVX I;  1VQN Z;  2W04 A;  3F3F C;  2NVT I;  3CC4 1;  1YJW 1;  3CCR Z;  2F4O A;  3HOY I;  1VQN 1;  1TFI A;  3CCR 1;  4RS4 A;  3CCL Z;  1USP A;  2V8J A;  4MRI A;  1YI2 Z;  3QWU A;  1YI2 1;  1VQ8 Z;  2JA5 I;  4RVF A;  3GTP I;  4BBS I;  3Q87 A;  2IZ3 A;  4BBR I;  4MD8 A;  1K9M 1;  1VQ8 1;  3VTN A;  1P9N A;  3M4O I;  1Q81 1;  5IT9 b;  1NJI 2;  3CPW Y;  5D1O B;  3F3P C;  4A3C I;  1JJ2 Y;  3GTO I;  2KI7 B;  1L1O C;  2R6M A;  3RZO I;  3U50 C;  5T67 A;  1VQ9 Z;  1Z03 A;  2P28 A;  2RHB A;  2DE7 A;  5D1P A;  4E2X A;  1VQ9 1;  2QLV B;  1Q86 2;  3G71 Z;  2QEX Z;  1N8R 2;  1S72 Z;  2QKD A;  3MZL B;  1Q82 2;  3JAM b;  2OTL Z;  4E31 A;  1RNI A;  4QTU A;  3G71 1;  3S17 I;  2QEX 1;  3S1Q I;  1S72 1;  1NJI 1;  3VMG A;  4S1T A;  1WCM I;  1YUK A;  2VUM I;  4MD7 A;  3J80 f;  3PO3 I;  4NBE A;  3PO3 S;  1RO0 A;  2KPI A;  4HGZ A;  3CCM Z;  2P3Y A;  2PK7 A;  4NBD A;  3J7A 4;  1TWC I;  2RBL A;  2ZAE B;  1VQM 1;  4A93 I;  1QVG Z;  3NFZ A;  4A3I I;  5FLX f;  2JMO A;  2EGT A;  1K83 I;  3GCF A;  3CPW Z;  3J81 f;  1VQO Z;  2OZK A;  2HU9 A;  1JWH C;  4A3M I;  3HOU I;  1TWH I;  2GTH A;  3NDJ A;  3CME 1;  4Y52 I;  2M6N A;  3GTM I;  2GTI A;  4A3B I;  1VLA A;  2M48 A;  3GTM S;  3S2H I;  3NH4 A;  3NH5 A;  2VF1 A;  3CCS Z;  3CMA Z;  4Y7N I;  4RVD A;  4BY7 I;  1Z01 A;  2PMZ A;  1K9M 2;  4NBB A;  1Z02 A;  1Q81 2;  4A3D I;  3CCS 1;  2O4H A;  3CMA 1;  3MON A;  1RQF A;  2JA6 I;  2V8K A;  4NH1 C;  4EWC A;  5D1O A;  1K73 2;  1VQK Z;  1KQS Y;  3D9X A;  4NOZ A;  2K3R A;  4RVH A;  1W2B Z;  1RLY A;  2YAD A;  3D6W A;  3CXC Z;  3CD6 Z;  3EED A;  2DE6 A;  5C3E I;  3CCL 1;  1TWG I;  2G2K A;  1KD1 2;  4E2Y A;  3S1M I;  3CC2 Z;  3TDH B;  2E2H I;  3J80 b;  3S15 I;  3CC2 1;  3I55 Z;  4MH4 A;  3OW2 Y;  1ZB8 A;  5FLM I;  2YU9 I;  3S1R I;  1QVF Y;  2Q4Z A;  4E33 A;  3BG1 B;  4E2W A;  3S2D I;  1K73 1;  2QRC B;  5FLX b;  4NBG A;  4MXU A;  1NUI A;  3J81 b;  2E2J I;  4NB9 A;  1KC8 1;  2V8I A;  2O53 A;  4A3E I;  1KD1 1;  3HKZ A;  4CL1 A;  3T4N B;  2E2I I;  3NDI A;  3I4M I;  3IF8 A;  1VQ6 Z;  3GTQ I;  1PFT A;  2R7Z I;  1YJ9 Z;  2OTL 1;  3HOZ I;  3EER A;  1WII A;  5A2Q f;  4E32 A;  1Y1V I;  3H3V J;  1Y1V S;  2IZ4 A;  2JA7 I;  1VQL Z;  2JR6 A;  3H0G I;  5LL6 f;  5T64 A;  4A3F I;  2E9H A;  1K8A 1;  3CCM 1;  2DE5 A;  4HH4 A;  1I50 I;  1QF8 A;  3CCV Z;  2JNY A;  2QA4 Z;  1JJ2 Z;  3CCV 1;  1I6H I;  5C44 I;  3TE5 B;  3MZK B;  4NFR A;  3G4S Z;  1VQO 1;  5C4X I;  2OOY B;  3FQQ A;  1I3Q I;  4NB8 A;  3G4S 1;  2H85 A;  4MON A;  3ESW A;  1S7M A;  1VQP Z;  1WW9 A;  4RV9 A;  2JUB A;  3LUS A;  3IFU A;  5IP9 I;  3KIF A;  3I56 Z;  4AYB A;  3HOV I;  1VQ7 Z;  1ZB9 A;  3I56 1;  3P5J B;  4DQY B;  2Y0S A;  5C4J I;  5AN9 F;  3S14 I;  1VQ7 1;  1VQK 1;  3GTJ I;  2LFU A;  1R9T I;  4NBC A;  3GKQ A;  3CCJ Z;  2RT9 A;  1KC8 2;  5A2Q b;  2LIY A;  3CD6 1;  1RO2 A;  2HF1 A;  1YIJ Z;  3CCJ 1;  3CCE Z;  1Q7Y 1;  4A3J I;  3PO2 I;  3GTG I;  2Q51 A;  4QTT A;  3S1N I;  1YIJ 1;  3K7A I;  3CCE 1;  2WB1 A;  2W03 A;  2R93 I;  3M3Y I;  3GTL I;  3I55 1;  5T6B A;  1YHQ Z;  3KIH A;  2B63 I;  4NBA A;  4XX2 A;  2AKL A;  2RIQ A;  4A3K I;  4TNU A;  4DGL A;  3BG0 B;  1YHQ 1;  3FQM A;  1QVG Y;  2RPR A;  3CCU Z;  3S16 I;  1LQL A;  3I4N I;  2WAQ A;  1K8A 2;  1ZH1 A;  1SFO I;  2GU2 A;  3CCU 1;  1USP B;  2BJO A;  1N2F A;  2OOX B;  1VQ6 1;  3CC7 Z;  1M90 2;  1KQS Z;  1ML8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...