2KPIA

Solution nmr structure of streptomyces coelicolor sco3027 modeled with zn+2 bound, northeast structural genomics consortium target rr58
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
56
structure length
56
Chain Sequence
MPLEAGLLEILACPACHAPLEERDAELICTGQDCGLAYPVRDGIPVLLVDEARRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein SCO3027
publication title Solution NMR structure of Streptomyces coelicolor SCO3027 modeled with Zn+2 bound, Northeast Structural Genomics Consortium Target RR58
rcsb
source organism Streptomyces coelicolor
molecule tags Structural genomics, unknown function
total genus 6
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2009-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03966 Trm112p Trm112p-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2kpiA01
1WCMI 2DE6A 1I50I 4NB8A 1X3WA 4NB9A 1RLYA 3S1NI 1USPA 1QYPA 1I6HI 2KPIA 3VMHA 3GTPI 1ML8A 2DE5A 4NBDA 1ZB8A 4MH4A 2PK7A 3GTOI 2NVXI 5C44I 3VMGA 2NVTI 3HOUI 4NBEA 2JR6A 1TWFI 4NBAA 2E2JI 3I4MI 4A3KI 3GTMI 1RO4A 2AKLA 2YU9I 3S15I 2BJOA 3ESWA 3HOWI 4A3DI 2JNYA 2P3YA 3GTGI 1L1OC 2HF1A 4NOZA 3RZDI 4NBCA 3K7AI 4QTTA 3HOZI 4BY7I 3CQZI 1DL6A 1TWHI 4A3FI 5C4JI 3HOXI 2JA8I 1I3QI 4A3II 2R92I 2K5RA 1TWGI 5IP7I 3HOVI 3H3VJ 3LUSA 5C4XI 4A3BI 4BXXI 2NVQI 1NUIA 1R9TI 3GTMS 4A3CI 2DE7A 3H0GI 4A93I 1YUAA 4Y7NI 2J6AA 4A3GI 1VLAA 4A3EI 3GTJI 4BY1I 1TWCI 2R7ZI 1USPB 3S1RI 2JA7I 3Q87A 1Y1VI 1ZB9A 1X3ZA 3S14I 2VUMI 2JS4A 3S1QI 3PO3I 1K83I 3M4OI 2E2HI 3VMIA 2NVYI 3HOYI 3S16I 3I4NI 1SFOI 3GTQI 1TWAI 1WW9A 4BBSI 2E2II 3FKII 2JA6I 4NBFA 3D6WA 4A3LI 2F4MA 5CM2M 4NBGA 3S2HI 3GTLI 1PFTA 5IP9I 3I07A 3EERA 1TFIA 2R93I 3U50C 3RZOI 3GKQA 1Y1WI 4BBRI 2RBLA 1Y1VS 4X6AI 4A3MI 4Y52I 5FLMI 2JA5I 3S2DI 2B63I 3S17I 3M3YI 3PO3S 4QTUA 4A3JI 3GTKI 4NBBA 1LQLA 1N2FA 3GCFA 3PO2I 2F4OA 5C3EI 3S1MI 3VB9A 4XX2A 4NBHA
chains in the Genus database with same CATH superfamily
2DE6A 3MZKB 1KC81 1X3WA 4NB9A 2Y0SA 1NJI2 2RHBA 1FDIA 1K8A1 1ZB8A 2VPWA 4RS4A 2JUBA 3CCL1 1TWFI 4NBAA 3I4MI 4E30A 1M1K2 2W04A 1VQP1 2QA4Z 3HKZA 4E33A 4MRIA 2LIYA 4E2XA 3JAMf 1VQ4Z 2JMOA 1S7MA 1L1OC 2HF1A 2QLVB 1WIIA 4BY7I 1YHQ1 1YI2Z 4E2ZA 2VF1A 1VQKZ 1VQOZ 4AYBA 2OTL1 4A3FI 3QWUA 2R92I 1QXFA 1QVFY 2EGTA 3H3VJ 3G711 5C4XI 2NVQI 3GTMS 3D9XA 3CME1 1RQFA 3G4S1 3I55Z 3CCEZ 4Y7NI 1S721 1VQ81 4RV9A 2J6AA 4DQYB 4RVHA 1VLAA 4A3EI 1JJ2Z 1N8R1 3F3PC 1WZNA 3Q87A 3OW2Y 2VPXA 4NH1C 1KC82 2VUMI 1VQ6Z 3M4OI 3HOYI 1Q811 3G6E1 2QREB 3I4NI 1K8A2 2RPRA 4MONA 3FKII 1FDOA 5D1OA 2F4MA 1ZH1A 4NBGA 5IT9b 1YIJZ 3S2HI 3CC21 3EERA 2OTJ1 3CCU1 2GU2A 1M1K1 4X6AI 1YITZ 4RVDA 2WB1A 3M3YI 3FQQA 3J80f 1VQ51 1N2FA 3GCFA 3PO2I 4MD7A 4XX2A 4NB8A 5T67A 1USPA 3CD6Z 2QKDA 2KPIA 4MD8A 1ML8A 2DE5A 2PK7A 3GTOI 5C44I 2NVTI 1SIWA 1Q821 4HH4A 3CCQZ 4HGYA 2E2JI 5D1PA 2JIMA 3CCQ1 4A3KI 1RO4A 2AKLA 2YU9I 4DGLA 3S15I 2BJOA 1VQL1 1YJN1 4EWCA 5A2Qf 2LEXA 1VQ71 3I56Z 1VQ9Z 5D1OB 2JNYA 2R6MA 4NOZA 3RZDI 3CCRZ 2O53A 4NBCA 3CXCZ 1Q812 5A2Qb 3HOZI 1W2BZ 5AN9F 1TWHI 5C4JI 3CC7Z 1I3QI 4A3II 2VPYA 1TWGI 2M6NA 5IP7I 3LUSA 4A3CI 2DE7A 4A93I 2QA41 3NDJA 1YUKA 3GTJI 1Z03A 3BG0B 1VQ41 1Q7Y1 2R7ZI 4CL1A 1USPB 3S1RI 2JA7I 1KQSY 3S14I 1YI21 2NAPA 2H85A 1VQK1 1VQO1 3PO3I 3S16I 4E2WA 1SFOI 3GTQI 2V3VA 4BBSI 2M48A 2E2II 1KD11 2JA6I 3T4NB 4A3LI 1X0TA 3I551 3CCE1 1Q822 3GTLI 5IP9I 3I07A 1TFIA 1VQMZ 3RZOI 2P28A 2QEXZ 1QVFZ 3J81f 2V45A 4Y52I 5FLMI 3S2DI 4E2YA 3S17I 2QR1B 3J81b 4NBBA 5FLXb 3CMAZ 1VQ61 2F4OA 5IT9f 2V8KA 3VB9A 3KIHA 1QF8A 2JIRA 1QYPA 2V8JA 2AYDA 2O4HA 3CCMZ 1YIJ1 4NBDA 4MH4A 3BG1B 2NVXI 3OW2Z 4RVGA 2KI7B 3VMGA 3HOUI 5T6BA 2YADA 1RNIA 1VQNZ 1YIT1 4MXUA 1VQN1 1Q7Y2 1QVGY 4HGZA 2PMZA 1YJ9Z 4TNUA 3HOWI 4A3DI 3NFZA 5T64A 1YJ91 2P3YA 2QRDB 3K7AI 3CD61 3MONA 1DL6A 1KD12 2Q51A 3IX0A 3HOXI 1YJWZ 2K5RA 1AA6A 2IZ3A 4A3BI 2OZKA 3CCJZ 1YUAA 2E9HA 2GTIA 3FQMA 1TWCI 3I561 3CCSZ 1VQ91 3CCR1 1Y1VI 2JS4A 3S1QI 3CC4Z 1K83I 3CC71 2E2HI 3VMIA 3CCVZ 2VUGA 1TWAI 1WW9A 1K731 4NBFA 5CM2M 2W03A 3NH4A 4MD9A 4E32A 3CCLZ 1Y1WI 4BBRI 4E31A 3IFUA 4A3MI 2JA5I 2B63I 4S1TA 3PO3S 3EEDA 1VQPZ 1LQLA 2IZ4A 2JIPA 3NH8A 3J7A4 1M901 5C3EI 3S1MI 2OOYB 4NBHA 1WCMI 1I50I 2LFUA 1KRLA 1RLYA 3S1NI 5LL6f 1I6HI 3GTPI 3VMHA 1YHQZ 3JAMb 2OTLZ 2RT9A 1KQSZ 1JJ2Y 3NH5A 3TDHB 2VPZA 4NFRA 1RO0A 1VQM1 1Z02A 3G71Z 2JIQA 4NBEA 5FLXf 2JR6A 2QEX1 4DK1A 2QRCB 3CMEZ 2OOXB 3G4SZ 3GTMI 1S72Z 1VQ8Z 1Q16A 1Q861 3KIFA 2G2KA 3CMA1 3VTNA 3ESWA 3MZLB 2I3CA 3GTGI 2IV2X 4QTTA 3CQZI 3CCM1 1K9M2 1JWHC 1NP6A 1K732 2JA8I 1NJI1 2HU9A 3G6EZ 3HOVI 1P9NA 4BXXI 1NUIA 1R9TI 2PM9A 1Z01A 2V8IA 3H0GI 1Y8CA 3CC2Z 4A3GI 3CPWY 2ZAEB 2OTJZ 4BY1I 3CCUZ 2E7ZA 3NDIA 1ZB9A 1M902 1X3ZA 2WAQA 3IF8A 1VQ5Z 1YJW1 2NVYI 3F3FC 4RVFA 1QVGZ 3P5JB 3J80b 3CPWZ 3D6WA 3CCJ1 2RIQA 3TE5B 3D2LA 1RO2A 1PFTA 2R93I 3U50C 2Q4ZA 1Q862 3CXCY 3GKQA 2RBLA 3CCS1 1Y1VS 3IR7A 1W2BY 2GTHA 1N8R2 4QTUA 4A3JI 3GTKI 1VQLZ 3CC41 1YJNZ 2K3RA 2JIOA 3CCV1 1VQ7Z 1WJ2A 1K9M1
chains in the Genus database with same CATH topology
2DE6A 3MZKB 1KC81 1X3WA 4NB9A 2Y0SA 1NJI2 2RHBA 1K8A1 1ZB8A 4RS4A 2JUBA 3CCL1 1TWFI 4NBAA 3I4MI 4E30A 1M1K2 2W04A 1VQP1 2QA4Z 3HKZA 4E33A 4MRIA 2LIYA 4E2XA 3JAMf 1VQ4Z 2JMOA 1S7MA 1L1OC 2HF1A 2QLVB 1WIIA 4BY7I 1YHQ1 1YI2Z 4E2ZA 2VF1A 1VQKZ 1VQOZ 4AYBA 2OTL1 4A3FI 3QWUA 2R92I 1QVFY 2EGTA 3H3VJ 3G711 5C4XI 2NVQI 3GTMS 3D9XA 3CME1 1RQFA 3G4S1 3I55Z 3CCEZ 4Y7NI 1S721 1VQ81 4RV9A 2J6AA 4DQYB 4RVHA 1VLAA 4A3EI 1JJ2Z 1N8R1 3F3PC 3Q87A 3OW2Y 4NH1C 1KC82 2VUMI 1VQ6Z 3M4OI 3HOYI 1Q811 3G6E1 2QREB 3I4NI 1K8A2 2RPRA 4MONA 3FKII 5D1OA 2F4MA 1ZH1A 4NBGA 5IT9b 1YIJZ 3S2HI 3CC21 3EERA 2OTJ1 3CCU1 2GU2A 1M1K1 4X6AI 1YITZ 4RVDA 2WB1A 3M3YI 3FQQA 3J80f 1VQ51 1N2FA 3GCFA 3PO2I 4MD7A 4XX2A 4NB8A 5T67A 1USPA 3CD6Z 2QKDA 2KPIA 4MD8A 1ML8A 2DE5A 2PK7A 3GTOI 5C44I 2NVTI 1Q821 4HH4A 3CCQZ 4HGYA 2E2JI 5D1PA 3CCQ1 4A3KI 1RO4A 2AKLA 2YU9I 4DGLA 3S15I 2BJOA 1VQL1 1YJN1 4EWCA 5A2Qf 1VQ71 3I56Z 1VQ9Z 5D1OB 2JNYA 2R6MA 4NOZA 3RZDI 3CXCZ 2O53A 4NBCA 3CCRZ 1Q812 5A2Qb 3HOZI 1W2BZ 5AN9F 1TWHI 5C4JI 3CC7Z 1I3QI 4A3II 1TWGI 2M6NA 5IP7I 3LUSA 4A3CI 2DE7A 4A93I 2QA41 3NDJA 1YUKA 3GTJI 1Z03A 3BG0B 1VQ41 1Q7Y1 2R7ZI 4CL1A 1USPB 3S1RI 2JA7I 1KQSY 3S14I 1YI21 2H85A 1VQK1 1VQO1 3PO3I 3S16I 4E2WA 1SFOI 3GTQI 4BBSI 2M48A 2E2II 1KD11 2JA6I 3T4NB 4A3LI 1X0TA 3I551 3CCE1 1Q822 3GTLI 5IP9I 3I07A 1TFIA 1VQMZ 3RZOI 2P28A 2QEXZ 1QVFZ 3J81f 4Y52I 5FLMI 3S2DI 4E2YA 3S17I 2QR1B 3J81b 4NBBA 5FLXb 3CMAZ 1VQ61 2F4OA 5IT9f 2V8KA 3VB9A 3KIHA 1QF8A 1QYPA 2V8JA 2O4HA 3CCMZ 1YIJ1 4NBDA 4MH4A 3BG1B 2NVXI 3OW2Z 4RVGA 2KI7B 3VMGA 3HOUI 5T6BA 2YADA 1RNIA 1VQNZ 1YIT1 4MXUA 1VQN1 1Q7Y2 1QVGY 4HGZA 2PMZA 1YJ9Z 4TNUA 3HOWI 4A3DI 3NFZA 5T64A 1YJ91 2P3YA 2QRDB 3K7AI 3CD61 3MONA 1DL6A 1KD12 2Q51A 3IX0A 3HOXI 1YJWZ 2K5RA 2IZ3A 4A3BI 2OZKA 3CCJZ 1YUAA 2E9HA 2GTIA 3FQMA 1TWCI 3I561 3CCSZ 1VQ91 3CCR1 1Y1VI 2JS4A 3S1QI 3CC4Z 1K83I 3CC71 2E2HI 3VMIA 3CCVZ 2VUGA 1TWAI 1WW9A 1K731 4NBFA 5CM2M 2W03A 3NH4A 4MD9A 4E32A 3CCLZ 1Y1WI 4BBRI 4E31A 3IFUA 4A3MI 2JA5I 2B63I 4S1TA 3PO3S 3EEDA 1VQPZ 1LQLA 2IZ4A 3NH8A 3J7A4 1M901 5C3EI 3S1MI 2OOYB 4NBHA 1WCMI 1I50I 2LFUA 1KRLA 1RLYA 3S1NI 5LL6f 1I6HI 3GTPI 3VMHA 1YHQZ 3JAMb 2OTLZ 2RT9A 1KQSZ 1JJ2Y 3NH5A 3TDHB 4NFRA 1RO0A 1VQM1 1Z02A 3G71Z 5FLXf 4NBEA 2JR6A 2QEX1 4DK1A 2QRCB 3CMEZ 2OOXB 3G4SZ 3GTMI 1S72Z 1VQ8Z 1Q861 3KIFA 2G2KA 3CMA1 3VTNA 3ESWA 3MZLB 2I3CA 3GTGI 4QTTA 3CQZI 3CCM1 1K9M2 1JWHC 1NP6A 1K732 2JA8I 1NJI1 2HU9A 3G6EZ 3HOVI 1P9NA 4BXXI 1NUIA 1R9TI 2PM9A 1Z01A 2V8IA 3H0GI 3CC2Z 4A3GI 3CPWY 2ZAEB 2OTJZ 4BY1I 3CCUZ 3NDIA 1ZB9A 1M902 1X3ZA 2WAQA 3IF8A 1VQ5Z 1YJW1 2NVYI 3F3FC 4RVFA 1QVGZ 3P5JB 3J80b 3CPWZ 3D6WA 3CCJ1 2RIQA 3TE5B 1RO2A 1PFTA 2R93I 3U50C 2Q4ZA 1Q862 3CXCY 3GKQA 2RBLA 3CCS1 1Y1VS 1W2BY 2GTHA 1N8R2 4QTUA 4A3JI 3GTKI 1VQLZ 3CC41 1YJNZ 2K3RA 3CCV1 1VQ7Z 1K9M1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WCM I;  2DE6 A;  1I50 I;  4NB8 A;  1X3W A;  4NB9 A;  1RLY A;  3S1N I;  1USP A;  1QYP A;  1I6H I;  2KPI A;  3VMH A;  3GTP I;  1ML8 A;  2DE5 A;  4NBD A;  1ZB8 A;  4MH4 A;  2PK7 A;  3GTO I;  2NVX I;  5C44 I;  3VMG A;  2NVT I;  3HOU I;  4NBE A;  2JR6 A;  1TWF I;  4NBA A;  2E2J I;  3I4M I;  4A3K I;  3GTM I;  1RO4 A;  2AKL A;  2YU9 I;  3S15 I;  2BJO A;  3ESW A;  3HOW I;  4A3D I;  2JNY A;  2P3Y A;  3GTG I;  1L1O C;  2HF1 A;  4NOZ A;  3RZD I;  4NBC A;  3K7A I;  4QTT A;  3HOZ I;  4BY7 I;  3CQZ I;  1DL6 A;  1TWH I;  4A3F I;  5C4J I;  3HOX I;  2JA8 I;  1I3Q I;  4A3I I;  2R92 I;  2K5R A;  1TWG I;  5IP7 I;  3HOV I;  3H3V J;  3LUS A;  5C4X I;  4A3B I;  4BXX I;  2NVQ I;  1NUI A;  1R9T I;  3GTM S;  4A3C I;  2DE7 A;  3H0G I;  4A93 I;  1YUA A;  4Y7N I;  2J6A A;  4A3G I;  1VLA A;  4A3E I;  3GTJ I;  4BY1 I;  1TWC I;  2R7Z I;  1USP B;  3S1R I;  2JA7 I;  3Q87 A;  1Y1V I;  1ZB9 A;  1X3Z A;  3S14 I;  2VUM I;  2JS4 A;  3S1Q I;  3PO3 I;  1K83 I;  3M4O I;  2E2H I;  3VMI A;  2NVY I;  3HOY I;  3S16 I;  3I4N I;  1SFO I;  3GTQ I;  1TWA I;  1WW9 A;  4BBS I;  2E2I I;  3FKI I;  2JA6 I;  4NBF A;  3D6W A;  4A3L I;  2F4M A;  5CM2 M;  4NBG A;  3S2H I;  3GTL I;  1PFT A;  5IP9 I;  3I07 A;  3EER A;  1TFI A;  2R93 I;  3U50 C;  3RZO I;  3GKQ A;  1Y1W I;  4BBR I;  2RBL A;  1Y1V S;  4X6A I;  4A3M I;  4Y52 I;  5FLM I;  2JA5 I;  3S2D I;  2B63 I;  3S17 I;  3M3Y I;  3PO3 S;  4QTU A;  4A3J I;  3GTK I;  4NBB A;  1LQL A;  1N2F A;  3GCF A;  3PO2 I;  2F4O A;  5C3E I;  3S1M I;  3VB9 A;  4XX2 A;  4NBH A; 
#chains in the Genus database with same CATH topology
 2DE6 A;  3MZK B;  1KC8 1;  1X3W A;  4NB9 A;  2Y0S A;  1NJI 2;  2RHB A;  1FDI A;  1K8A 1;  1ZB8 A;  2VPW A;  4RS4 A;  2JUB A;  3CCL 1;  1TWF I;  4NBA A;  3I4M I;  4E30 A;  1M1K 2;  2W04 A;  1VQP 1;  2QA4 Z;  3HKZ A;  4E33 A;  4MRI A;  2LIY A;  4E2X A;  3JAM f;  1VQ4 Z;  2JMO A;  1S7M A;  1L1O C;  2HF1 A;  2QLV B;  1WII A;  4BY7 I;  1YHQ 1;  1YI2 Z;  4E2Z A;  2VF1 A;  1VQK Z;  1VQO Z;  4AYB A;  2OTL 1;  4A3F I;  3QWU A;  2R92 I;  1QXF A;  1QVF Y;  2EGT A;  3H3V J;  3G71 1;  5C4X I;  2NVQ I;  3GTM S;  3D9X A;  3CME 1;  1RQF A;  3G4S 1;  3I55 Z;  3CCE Z;  4Y7N I;  1S72 1;  1VQ8 1;  4RV9 A;  2J6A A;  4DQY B;  4RVH A;  1VLA A;  4A3E I;  1JJ2 Z;  1N8R 1;  3F3P C;  1WZN A;  3Q87 A;  3OW2 Y;  2VPX A;  4NH1 C;  1KC8 2;  2VUM I;  1VQ6 Z;  3M4O I;  3HOY I;  1Q81 1;  3G6E 1;  2QRE B;  3I4N I;  1K8A 2;  2RPR A;  4MON A;  3FKI I;  1FDO A;  5D1O A;  2F4M A;  1ZH1 A;  4NBG A;  5IT9 b;  1YIJ Z;  3S2H I;  3CC2 1;  3EER A;  2OTJ 1;  3CCU 1;  2GU2 A;  1M1K 1;  4X6A I;  1YIT Z;  4RVD A;  2WB1 A;  3M3Y I;  3FQQ A;  3J80 f;  1VQ5 1;  1N2F A;  3GCF A;  3PO2 I;  4MD7 A;  4XX2 A;  4NB8 A;  5T67 A;  1USP A;  3CD6 Z;  2QKD A;  2KPI A;  4MD8 A;  1ML8 A;  2DE5 A;  2PK7 A;  3GTO I;  5C44 I;  2NVT I;  1SIW A;  1Q82 1;  4HH4 A;  3CCQ Z;  4HGY A;  2E2J I;  5D1P A;  2JIM A;  3CCQ 1;  4A3K I;  1RO4 A;  2AKL A;  2YU9 I;  4DGL A;  3S15 I;  2BJO A;  1VQL 1;  1YJN 1;  4EWC A;  5A2Q f;  2LEX A;  1VQ7 1;  3I56 Z;  1VQ9 Z;  5D1O B;  2JNY A;  2R6M A;  4NOZ A;  3RZD I;  3CCR Z;  2O53 A;  4NBC A;  3CXC Z;  1Q81 2;  5A2Q b;  3HOZ I;  1W2B Z;  5AN9 F;  1TWH I;  5C4J I;  3CC7 Z;  1I3Q I;  4A3I I;  2VPY A;  1TWG I;  2M6N A;  5IP7 I;  3LUS A;  4A3C I;  2DE7 A;  4A93 I;  2QA4 1;  3NDJ A;  1YUK A;  3GTJ I;  1Z03 A;  3BG0 B;  1VQ4 1;  1Q7Y 1;  2R7Z I;  4CL1 A;  1USP B;  3S1R I;  2JA7 I;  1KQS Y;  3S14 I;  1YI2 1;  2NAP A;  2H85 A;  1VQK 1;  1VQO 1;  3PO3 I;  3S16 I;  4E2W A;  1SFO I;  3GTQ I;  2V3V A;  4BBS I;  2M48 A;  2E2I I;  1KD1 1;  2JA6 I;  3T4N B;  4A3L I;  1X0T A;  3I55 1;  3CCE 1;  1Q82 2;  3GTL I;  5IP9 I;  3I07 A;  1TFI A;  1VQM Z;  3RZO I;  2P28 A;  2QEX Z;  1QVF Z;  3J81 f;  2V45 A;  4Y52 I;  5FLM I;  3S2D I;  4E2Y A;  3S17 I;  2QR1 B;  3J81 b;  4NBB A;  5FLX b;  3CMA Z;  1VQ6 1;  2F4O A;  5IT9 f;  2V8K A;  3VB9 A;  3KIH A;  1QF8 A;  2JIR A;  1QYP A;  2V8J A;  2AYD A;  2O4H A;  3CCM Z;  1YIJ 1;  4NBD A;  4MH4 A;  3BG1 B;  2NVX I;  3OW2 Z;  4RVG A;  2KI7 B;  3VMG A;  3HOU I;  5T6B A;  2YAD A;  1RNI A;  1VQN Z;  1YIT 1;  4MXU A;  1VQN 1;  1Q7Y 2;  1QVG Y;  4HGZ A;  2PMZ A;  1YJ9 Z;  4TNU A;  3HOW I;  4A3D I;  3NFZ A;  5T64 A;  1YJ9 1;  2P3Y A;  2QRD B;  3K7A I;  3CD6 1;  3MON A;  1DL6 A;  1KD1 2;  2Q51 A;  3IX0 A;  3HOX I;  1YJW Z;  2K5R A;  1AA6 A;  2IZ3 A;  4A3B I;  2OZK A;  3CCJ Z;  1YUA A;  2E9H A;  2GTI A;  3FQM A;  1TWC I;  3I56 1;  3CCS Z;  1VQ9 1;  3CCR 1;  1Y1V I;  2JS4 A;  3S1Q I;  3CC4 Z;  1K83 I;  3CC7 1;  2E2H I;  3VMI A;  3CCV Z;  2VUG A;  1TWA I;  1WW9 A;  1K73 1;  4NBF A;  5CM2 M;  2W03 A;  3NH4 A;  4MD9 A;  4E32 A;  3CCL Z;  1Y1W I;  4BBR I;  4E31 A;  3IFU A;  4A3M I;  2JA5 I;  2B63 I;  4S1T A;  3PO3 S;  3EED A;  1VQP Z;  1LQL A;  2IZ4 A;  2JIP A;  3NH8 A;  3J7A 4;  1M90 1;  5C3E I;  3S1M I;  2OOY B;  4NBH A;  1WCM I;  1I50 I;  2LFU A;  1KRL A;  1RLY A;  3S1N I;  5LL6 f;  1I6H I;  3GTP I;  3VMH A;  1YHQ Z;  3JAM b;  2OTL Z;  2RT9 A;  1KQS Z;  1JJ2 Y;  3NH5 A;  3TDH B;  2VPZ A;  4NFR A;  1RO0 A;  1VQM 1;  1Z02 A;  3G71 Z;  2JIQ A;  4NBE A;  5FLX f;  2JR6 A;  2QEX 1;  4DK1 A;  2QRC B;  3CME Z;  2OOX B;  3G4S Z;  3GTM I;  1S72 Z;  1VQ8 Z;  1Q16 A;  1Q86 1;  3KIF A;  2G2K A;  3CMA 1;  3VTN A;  3ESW A;  3MZL B;  2I3C A;  3GTG I;  2IV2 X;  4QTT A;  3CQZ I;  3CCM 1;  1K9M 2;  1JWH C;  1NP6 A;  1K73 2;  2JA8 I;  1NJI 1;  2HU9 A;  3G6E Z;  3HOV I;  1P9N A;  4BXX I;  1NUI A;  1R9T I;  2PM9 A;  1Z01 A;  2V8I A;  3H0G I;  1Y8C A;  3CC2 Z;  4A3G I;  3CPW Y;  2ZAE B;  2OTJ Z;  4BY1 I;  3CCU Z;  2E7Z A;  3NDI A;  1ZB9 A;  1M90 2;  1X3Z A;  2WAQ A;  3IF8 A;  1VQ5 Z;  1YJW 1;  2NVY I;  3F3F C;  4RVF A;  1QVG Z;  3P5J B;  3J80 b;  3CPW Z;  3D6W A;  3CCJ 1;  2RIQ A;  3TE5 B;  3D2L A;  1RO2 A;  1PFT A;  2R93 I;  3U50 C;  2Q4Z A;  1Q86 2;  3CXC Y;  3GKQ A;  2RBL A;  3CCS 1;  1Y1V S;  3IR7 A;  1W2B Y;  2GTH A;  1N8R 2;  4QTU A;  4A3J I;  3GTK I;  1VQL Z;  3CC4 1;  1YJN Z;  2K3R A;  2JIO A;  3CCV 1;  1VQ7 Z;  1WJ2 A;  1K9M 1; 
#chains in the Genus database with same CATH homology
 2DE6 A;  3MZK B;  1KC8 1;  1X3W A;  4NB9 A;  2Y0S A;  1NJI 2;  2RHB A;  1K8A 1;  1ZB8 A;  4RS4 A;  2JUB A;  3CCL 1;  1TWF I;  4NBA A;  3I4M I;  4E30 A;  1M1K 2;  2W04 A;  1VQP 1;  2QA4 Z;  3HKZ A;  4E33 A;  4MRI A;  2LIY A;  4E2X A;  3JAM f;  1VQ4 Z;  2JMO A;  1S7M A;  1L1O C;  2HF1 A;  2QLV B;  1WII A;  4BY7 I;  1YHQ 1;  1YI2 Z;  4E2Z A;  2VF1 A;  1VQK Z;  1VQO Z;  4AYB A;  2OTL 1;  4A3F I;  3QWU A;  2R92 I;  1QVF Y;  2EGT A;  3H3V J;  3G71 1;  5C4X I;  2NVQ I;  3GTM S;  3D9X A;  3CME 1;  1RQF A;  3G4S 1;  3I55 Z;  3CCE Z;  4Y7N I;  1S72 1;  1VQ8 1;  4RV9 A;  2J6A A;  4DQY B;  4RVH A;  1VLA A;  4A3E I;  1JJ2 Z;  1N8R 1;  3F3P C;  3Q87 A;  3OW2 Y;  4NH1 C;  1KC8 2;  2VUM I;  1VQ6 Z;  3M4O I;  3HOY I;  1Q81 1;  3G6E 1;  2QRE B;  3I4N I;  1K8A 2;  2RPR A;  4MON A;  3FKI I;  5D1O A;  2F4M A;  1ZH1 A;  4NBG A;  5IT9 b;  1YIJ Z;  3S2H I;  3CC2 1;  3EER A;  2OTJ 1;  3CCU 1;  2GU2 A;  1M1K 1;  4X6A I;  1YIT Z;  4RVD A;  2WB1 A;  3M3Y I;  3FQQ A;  3J80 f;  1VQ5 1;  1N2F A;  3GCF A;  3PO2 I;  4MD7 A;  4XX2 A;  4NB8 A;  5T67 A;  1USP A;  3CD6 Z;  2QKD A;  2KPI A;  4MD8 A;  1ML8 A;  2DE5 A;  2PK7 A;  3GTO I;  5C44 I;  2NVT I;  1Q82 1;  4HH4 A;  3CCQ Z;  4HGY A;  2E2J I;  5D1P A;  3CCQ 1;  4A3K I;  1RO4 A;  2AKL A;  2YU9 I;  4DGL A;  3S15 I;  2BJO A;  1VQL 1;  1YJN 1;  4EWC A;  5A2Q f;  1VQ7 1;  3I56 Z;  1VQ9 Z;  5D1O B;  2JNY A;  2R6M A;  4NOZ A;  3RZD I;  3CXC Z;  2O53 A;  4NBC A;  3CCR Z;  1Q81 2;  5A2Q b;  3HOZ I;  1W2B Z;  5AN9 F;  1TWH I;  5C4J I;  3CC7 Z;  1I3Q I;  4A3I I;  1TWG I;  2M6N A;  5IP7 I;  3LUS A;  4A3C I;  2DE7 A;  4A93 I;  2QA4 1;  3NDJ A;  1YUK A;  3GTJ I;  1Z03 A;  3BG0 B;  1VQ4 1;  1Q7Y 1;  2R7Z I;  4CL1 A;  1USP B;  3S1R I;  2JA7 I;  1KQS Y;  3S14 I;  1YI2 1;  2H85 A;  1VQK 1;  1VQO 1;  3PO3 I;  3S16 I;  4E2W A;  1SFO I;  3GTQ I;  4BBS I;  2M48 A;  2E2I I;  1KD1 1;  2JA6 I;  3T4N B;  4A3L I;  1X0T A;  3I55 1;  3CCE 1;  1Q82 2;  3GTL I;  5IP9 I;  3I07 A;  1TFI A;  1VQM Z;  3RZO I;  2P28 A;  2QEX Z;  1QVF Z;  3J81 f;  4Y52 I;  5FLM I;  3S2D I;  4E2Y A;  3S17 I;  2QR1 B;  3J81 b;  4NBB A;  5FLX b;  3CMA Z;  1VQ6 1;  2F4O A;  5IT9 f;  2V8K A;  3VB9 A;  3KIH A;  1QF8 A;  1QYP A;  2V8J A;  2O4H A;  3CCM Z;  1YIJ 1;  4NBD A;  4MH4 A;  3BG1 B;  2NVX I;  3OW2 Z;  4RVG A;  2KI7 B;  3VMG A;  3HOU I;  5T6B A;  2YAD A;  1RNI A;  1VQN Z;  1YIT 1;  4MXU A;  1VQN 1;  1Q7Y 2;  1QVG Y;  4HGZ A;  2PMZ A;  1YJ9 Z;  4TNU A;  3HOW I;  4A3D I;  3NFZ A;  5T64 A;  1YJ9 1;  2P3Y A;  2QRD B;  3K7A I;  3CD6 1;  3MON A;  1DL6 A;  1KD1 2;  2Q51 A;  3IX0 A;  3HOX I;  1YJW Z;  2K5R A;  2IZ3 A;  4A3B I;  2OZK A;  3CCJ Z;  1YUA A;  2E9H A;  2GTI A;  3FQM A;  1TWC I;  3I56 1;  3CCS Z;  1VQ9 1;  3CCR 1;  1Y1V I;  2JS4 A;  3S1Q I;  3CC4 Z;  1K83 I;  3CC7 1;  2E2H I;  3VMI A;  3CCV Z;  2VUG A;  1TWA I;  1WW9 A;  1K73 1;  4NBF A;  5CM2 M;  2W03 A;  3NH4 A;  4MD9 A;  4E32 A;  3CCL Z;  1Y1W I;  4BBR I;  4E31 A;  3IFU A;  4A3M I;  2JA5 I;  2B63 I;  4S1T A;  3PO3 S;  3EED A;  1VQP Z;  1LQL A;  2IZ4 A;  3NH8 A;  3J7A 4;  1M90 1;  5C3E I;  3S1M I;  2OOY B;  4NBH A;  1WCM I;  1I50 I;  2LFU A;  1KRL A;  1RLY A;  3S1N I;  5LL6 f;  1I6H I;  3GTP I;  3VMH A;  1YHQ Z;  3JAM b;  2OTL Z;  2RT9 A;  1KQS Z;  1JJ2 Y;  3NH5 A;  3TDH B;  4NFR A;  1RO0 A;  1VQM 1;  1Z02 A;  3G71 Z;  5FLX f;  4NBE A;  2JR6 A;  2QEX 1;  4DK1 A;  2QRC B;  3CME Z;  2OOX B;  3G4S Z;  3GTM I;  1S72 Z;  1VQ8 Z;  1Q86 1;  3KIF A;  2G2K A;  3CMA 1;  3VTN A;  3ESW A;  3MZL B;  2I3C A;  3GTG I;  4QTT A;  3CQZ I;  3CCM 1;  1K9M 2;  1JWH C;  1NP6 A;  1K73 2;  2JA8 I;  1NJI 1;  2HU9 A;  3G6E Z;  3HOV I;  1P9N A;  4BXX I;  1NUI A;  1R9T I;  2PM9 A;  1Z01 A;  2V8I A;  3H0G I;  3CC2 Z;  4A3G I;  3CPW Y;  2ZAE B;  2OTJ Z;  4BY1 I;  3CCU Z;  3NDI A;  1ZB9 A;  1M90 2;  1X3Z A;  2WAQ A;  3IF8 A;  1VQ5 Z;  1YJW 1;  2NVY I;  3F3F C;  4RVF A;  1QVG Z;  3P5J B;  3J80 b;  3CPW Z;  3D6W A;  3CCJ 1;  2RIQ A;  3TE5 B;  1RO2 A;  1PFT A;  2R93 I;  3U50 C;  2Q4Z A;  1Q86 2;  3CXC Y;  3GKQ A;  2RBL A;  3CCS 1;  1Y1V S;  1W2B Y;  2GTH A;  1N8R 2;  4QTU A;  4A3J I;  3GTK I;  1VQL Z;  3CC4 1;  1YJN Z;  2K3R A;  3CCV 1;  1VQ7 Z;  1K9M 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...