3GTPI

Backtracked rna polymerase ii complex with 24mer rna
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 8
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtpI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtpI02
3RZDI 1Y1VI 3VMGA 4A3JI 2YU9I 3HOUI 1PFTA 3ESWA 4Y52I 2JR6A 3U50C 3VMHA 3S2HI 1QYPA 2JA7I 2NVTI 4Y7NI 1K83I 3PO3S 2BJOA 3I4NI 2PK7A 3PO3I 2NVYI 3GTMI 2E2HI 3S1NI 4A3MI 4NB8A 5C44I 2E2II 3PO2I 1TWCI 4BY7I 3EERA 1Y1VS 4NBBA 4NOZA 4QTUA 3S1MI 5C3EI 2HF1A 1R9TI 2B63I 3LUSA 1SFOI 3FKII 4A93I 5CM2M 1ZB8A 1TWGI 4NBGA 1Y1WI 3GTPI 3GTKI 3GTQI 3CQZI 5IP9I 2DE5A 3GTGI 4A3CI 1VLAA 3VMIA 2JS4A 3GTOI 5FLMI 2JNYA 5C4JI 1X3WA 4NBDA 3HOVI 4NBHA 2K5RA 3I4MI 2E2JI 3GTJI 3H0GI 3RZOI 4A3EI 1TWAI 1YUAA 1WW9A 4QTTA 5IP7I 1ZB9A 3H3VJ 1L1OC 1N2FA 1TFIA 4BBRI 3GTLI 1I50I 3VB9A 3HOWI 3K7AI 3HOZI 3S2DI 1ML8A 2R92I 1I6HI 2DE7A 2P3YA 3HOYI 2R93I 4A3LI 2R7ZI 3S15I 4BBSI 3GKQA 2RBLA 3GCFA 3S16I 4BXXI 1USPB 2JA6I 3M3YI 3GTMS 4A3GI 2JA8I 3HOXI 4NBAA 3D6WA 3S1RI 1USPA 4A3DI 2F4OA 4XX2A 4A3KI 1RLYA 3S17I 2J6AA 4NBFA 3S14I 2KPIA 2NVXI 5C4XI 2NVQI 2F4MA 4MH4A 4NBEA 4NB9A 1WCMI 3Q87A 3I07A 2VUMI 1I3QI 2AKLA 4BY1I 4X6AI 1NUIA 4NBCA 1X3ZA 2JA5I 4A3FI 1TWHI 1TWFI 1RO4A 2DE6A 3S1QI 4A3BI 4A3II 3M4OI 1LQLA 1DL6A
chains in the Genus database with same CATH superfamily
3VMGA 3HOUI 3ESWA 3VMHA 2V8IA 3BG1B 2VPWA 1QYPA 3CME1 2JA7I 3S2HI 2QEXZ 1K83I 2VUGA 1S7MA 4HH4A 3CPWZ 1N8R2 3S1NI 4A3MI 1NJI2 2E2II 1YUKA 4TNUA 3NFZA 1KQSY 3CXCZ 2HF1A 1R9TI 3MZKB 3CCEZ 2QA41 3G4SZ 2W03A 3CCS1 1VLAA 5D1OB 3GTOI 1X0TA 2JNYA 2QRCB 2LEXA 3HOVI 1QXFA 2K5RA 1ZH1A 2Y0SA 1W2BY 2O53A 2E2JI 1QVFZ 3RZOI 1RNIA 4A3EI 4RVHA 4QTTA 3JAMb 4E2ZA 1VQ9Z 3NDJA 3IR7A 1VQO1 1L1OC 1K732 3CC2Z 1WZNA 1M902 2RT9A 1Q861 1KC81 1Q821 2R92I 2P3YA 3HOYI 2R93I 3S15I 2HU9A 3S16I 4BXXI 2JA6I 3CCJ1 1YJN1 1USPA 1JWHC 2OOYB 3CCMZ 3CCQ1 4A3DI 4XX2A 2QLVB 2V45A 3CCE1 1YJW1 2J6AA 1Q16A 1YJ91 3FQMA 3D2LA 1WCMI 3I07A 3CCQZ 4CL1A 2AKLA 1Y8CA 3CMAZ 1KC82 1X3ZA 3J80b 1TWHI 2QR1B 4HGYA 2DE6A 2Q4ZA 5A2Qf 4MD7A 5IT9b 2GTIA 4A3II 2VPYA 1VQOZ 3J80f 1DL6A 3RZDI 2V8KA 1PFTA 2W04A 4DK1A 4Y52I 2NVTI 3PO3S 1Q811 3GTMI 3CCSZ 4NB8A 4MONA 2Q51A 3PO2I 4BY7I 3EERA 3CCUZ 1Y1VS 1YJWZ 2RIQA 2V3VA 3TDHB 3NH5A 1YJ9Z 2B63I 1SFOI 3FKII 1VQK1 1Q7Y2 1KD12 1ZB8A 3IF8A 3GTKI 3CQZI 3GTGI 2DE5A 1FDIA 2JIRA 2JS4A 3VMIA 2IZ4A 1P9NA 1VQ6Z 5C4JI 2OTJ1 1X3WA 4NBDA 1M901 3CPWY 3H0GI 3QWUA 3CC4Z 1TWAI 1YUAA 1WW9A 2PMZA 1VQ81 2KI7B 3H3VJ 1K9M2 2H85A 3GTLI 3VB9A 2ZAEB 3MZLB 2IZ3A 2VPZA 3CCR1 1VQLZ 1JJ2Y 3J7A4 4E33A 2YADA 2V8JA 3GKQA 2RBLA 1USPB 3NH8A 1NJI1 4A3GI 2EGTA 3D6WA 4NBAA 1W2BZ 2KPIA 2NVXI 5C4XI 2NVQI 1K9M1 2OTJZ 4MH4A 5FLXf 4MD9A 4NBEA 1Z03A 4NB9A 3Q87A 4E2XA 1K8A2 1I3QI 1VQN1 3IFUA 1NUIA 1YITZ 4NBCA 3VTNA 1TWFI 4RVDA 5D1PA 3EEDA 2M6NA 3M4OI 4A3JI 3JAMf 3HKZA 2JR6A 2I3CA 2AYDA 3U50C 2QKDA 4Y7NI 4NFRA 1JJ2Z 3CC71 3I4NI 2NVYI 4EWCA 2E2HI 2R6MA 4RV9A 3CMEZ 5C44I 2QEX1 4E31A 4RVFA 1VQ51 1YI21 1Q7Y1 1KD11 4NOZA 3CC41 5C3EI 2NAPA 3LUSA 1TWGI 4NBGA 1Y1WI 3I55Z 3GTQI 1YIT1 5IP9I 1QVGZ 5FLMI 5D1OA 1Z01A 5AN9F 1YIJZ 4NBHA 5IP7I 1ZB9A 1M1K1 1WJ2A 5A2Qb 5IT9f 5FLXb 1N2FA 1TFIA 4BBRI 1WIIA 1K731 2IV2X 1VQ7Z 3P5JB 1ML8A 3G4S1 1YHQ1 1VQL1 1FDOA 1RQFA 4NH1C 2R7ZI 4BBSI 1KRLA 3CCL1 3GCFA 2RPRA 3M3YI 3GTMS 3S1RI 4AYBA 2K3RA 3KIFA 3G6EZ 2F4OA 1VQ91 4A3KI 1RLYA 3S17I 3KIHA 3S14I 4NBFA 3CC21 3D9XA 2VF1A 2QRDB 1NP6A 1S721 3I561 2VUMI 1VQPZ 1KQSZ 4E2YA 4BY1I 4X6AI 3CC7Z 1YIJ1 2GU2A 3MONA 1VQMZ 3OW2Y 2JA5I 4A3FI 3S1QI 2LFUA 4A3BI 1S72Z 1VQKZ 3CD6Z 3TE5B 1VQP1 1LQLA 1M1K2 1Y1VI 2P28A 3CCJZ 1VQM1 2YU9I 3NH4A 1YHQZ 2E7ZA 4E32A 1VQ71 2BJOA 2WAQA 2JIPA 2PK7A 3PO3I 4S1TA 4RVGA 1Q812 2GTHA 1VQ8Z 1RO2A 1TWCI 3CMA1 1K8A1 4MD8A 4NBBA 4QTUA 3S1MI 1SIWA 1Q822 4MXUA 3T4NB 1Q862 1RO0A 5CM2M 4A93I 5T64A 1Z02A 3J81f 2OTLZ 2PM9A 2QA4Z 3GTPI 2LIYA 3CCRZ 3I551 4A3CI 3I56Z 2JUBA 4DGLA 4RS4A 2M48A 4MRIA 3CD61 3CCVZ 1VQ4Z 3I4MI 3GTJI 5T67A 3J81b 3CCU1 2WB1A 3F3FC 2JIMA 3G6E1 4HGZA 1I50I 3OW2Z 3HOWI 3CXCY 5LL6f 4E30A 2O4HA 3NDIA 3K7AI 3HOZI 3S2DI 3FQQA 1I6HI 2DE7A 2OZKA 4A3LI 3F3PC 2G2KA 3BG0B 1VQ61 2QREB 3CCLZ 5T6BA 4E2WA 2RHBA 2JA8I 3HOXI 1N8R1 2JIOA 2VPXA 3G711 2OTL1 1AA6A 3IX0A 2E9HA 2F4MA 3G71Z 2JMOA 1YI2Z 1QVGY 3CCV1 2OOXB 1VQ41 1VQ5Z 1YJNZ 4DQYB 1RO4A 3CCM1 1QF8A 1VQNZ 1QVFY 2JIQA
chains in the Genus database with same CATH topology
3VMGA 3HOUI 3ESWA 3VMHA 2V8IA 3BG1B 3CME1 1QYPA 2JA7I 3S2HI 2QEXZ 1K83I 2VUGA 1S7MA 4HH4A 3CPWZ 1N8R2 3S1NI 4A3MI 1NJI2 2E2II 1YUKA 4TNUA 3NFZA 1KQSY 3CXCZ 2HF1A 1R9TI 3MZKB 3CCEZ 2QA41 3G4SZ 2W03A 3CCS1 1VLAA 5D1OB 3GTOI 1X0TA 2JNYA 2QRCB 3HOVI 2K5RA 1ZH1A 2Y0SA 1W2BY 2O53A 2E2JI 1QVFZ 3RZOI 1RNIA 4A3EI 4RVHA 4QTTA 3JAMb 4E2ZA 1VQ9Z 3NDJA 1VQO1 1K732 1L1OC 3CC2Z 1M902 2RT9A 1Q861 1KC81 1Q821 2R92I 2P3YA 3HOYI 2R93I 3S15I 2HU9A 3S16I 4BXXI 2JA6I 3CCJ1 1YJN1 1USPA 1JWHC 2OOYB 3CCMZ 3CCQ1 4A3DI 4XX2A 2QLVB 3CCE1 1YJW1 2J6AA 1YJ91 3FQMA 1WCMI 3I07A 3CCQZ 4CL1A 2AKLA 1KC82 3CMAZ 1X3ZA 3J80b 1TWHI 2QR1B 4HGYA 2DE6A 2Q4ZA 5A2Qf 4MD7A 5IT9b 2GTIA 4A3II 1VQOZ 3J80f 1DL6A 3RZDI 2V8KA 1PFTA 2W04A 4DK1A 4Y52I 2NVTI 3PO3S 1Q811 3GTMI 3CCSZ 4NB8A 4MONA 2Q51A 3PO2I 4BY7I 3EERA 3CCUZ 1Y1VS 1YJWZ 2RIQA 3TDHB 3NH5A 1YJ9Z 2B63I 1SFOI 3FKII 1VQK1 1Q7Y2 1KD12 1ZB8A 3IF8A 3GTKI 3CQZI 3GTGI 2DE5A 3VMIA 2JS4A 2IZ4A 1P9NA 1VQ6Z 5C4JI 2OTJ1 1X3WA 4NBDA 1M901 3CPWY 3H0GI 3QWUA 3CC4Z 1TWAI 1YUAA 1WW9A 2PMZA 1VQ81 2KI7B 3H3VJ 1K9M2 2H85A 3GTLI 3VB9A 2ZAEB 3MZLB 2IZ3A 3CCR1 1VQLZ 1JJ2Y 3J7A4 4E33A 2YADA 2V8JA 3GKQA 2RBLA 1USPB 3NH8A 1NJI1 4A3GI 2EGTA 3D6WA 4NBAA 1W2BZ 2KPIA 2NVXI 5C4XI 2NVQI 1K9M1 2OTJZ 4MH4A 4MD9A 4NBEA 5FLXf 1Z03A 4NB9A 3Q87A 4E2XA 1K8A2 1I3QI 1VQN1 3IFUA 1NUIA 1YITZ 4NBCA 3VTNA 1TWFI 4RVDA 5D1PA 3EEDA 2M6NA 3M4OI 4A3JI 3JAMf 3HKZA 2JR6A 2I3CA 3U50C 2QKDA 4Y7NI 4NFRA 1JJ2Z 3CC71 3I4NI 2NVYI 4EWCA 2E2HI 2R6MA 4RV9A 3CMEZ 5C44I 2QEX1 4E31A 4RVFA 1VQ51 1YI21 1Q7Y1 1KD11 4NOZA 3CC41 5C3EI 3LUSA 1TWGI 4NBGA 1Y1WI 3I55Z 3GTQI 1YIT1 5IP9I 1QVGZ 5FLMI 5D1OA 1Z01A 5AN9F 1YIJZ 4NBHA 5IP7I 1ZB9A 1M1K1 5A2Qb 5IT9f 5FLXb 1N2FA 1TFIA 4BBRI 1WIIA 1K731 1VQ7Z 3P5JB 1ML8A 3G4S1 1YHQ1 1VQL1 1RQFA 4NH1C 2R7ZI 4BBSI 1KRLA 3CCL1 3GCFA 2RPRA 3M3YI 3GTMS 3S1RI 4AYBA 2K3RA 3KIFA 3G6EZ 2F4OA 1VQ91 4A3KI 1RLYA 3S17I 3KIHA 3S14I 4NBFA 3CC21 3D9XA 2VF1A 2QRDB 1NP6A 1S721 3I561 2VUMI 1VQPZ 1KQSZ 4E2YA 4BY1I 4X6AI 3CC7Z 1YIJ1 2GU2A 3MONA 1VQMZ 3OW2Y 2JA5I 4A3FI 3S1QI 2LFUA 4A3BI 1S72Z 1VQKZ 3CD6Z 3TE5B 1VQP1 1LQLA 1M1K2 1Y1VI 2P28A 3CCJZ 1VQM1 2YU9I 3NH4A 1YHQZ 4E32A 1VQ71 2BJOA 2WAQA 2PK7A 3PO3I 4S1TA 4RVGA 1Q812 2GTHA 1VQ8Z 1RO2A 1TWCI 3CMA1 1K8A1 4MD8A 4NBBA 4QTUA 3S1MI 1Q822 4MXUA 3T4NB 1Q862 1RO0A 5CM2M 4A93I 5T64A 1Z02A 3J81f 2OTLZ 2PM9A 2QA4Z 3GTPI 2LIYA 3CCRZ 3I551 4A3CI 3I56Z 2JUBA 4DGLA 4RS4A 2M48A 4MRIA 3CD61 3CCVZ 1VQ4Z 3I4MI 3GTJI 5T67A 3J81b 3CCU1 2WB1A 3F3FC 3G6E1 4HGZA 1I50I 3OW2Z 3HOWI 3CXCY 5LL6f 4E30A 2O4HA 3NDIA 3K7AI 3HOZI 3S2DI 3FQQA 1I6HI 2DE7A 2OZKA 4A3LI 3F3PC 2G2KA 3BG0B 1VQ61 2QREB 3CCLZ 5T6BA 4E2WA 2RHBA 2JA8I 3HOXI 1N8R1 3G711 2OTL1 3IX0A 2E9HA 2F4MA 3G71Z 2JMOA 1QVGY 1YI2Z 3CCV1 2OOXB 1VQ41 1VQ5Z 1YJNZ 4DQYB 1RO4A 3CCM1 1QF8A 1VQNZ 1QVFY
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZD I;  1Y1V I;  3VMG A;  4A3J I;  2YU9 I;  3HOU I;  1PFT A;  3ESW A;  4Y52 I;  2JR6 A;  3U50 C;  3VMH A;  3S2H I;  1QYP A;  2JA7 I;  2NVT I;  4Y7N I;  1K83 I;  3PO3 S;  2BJO A;  3I4N I;  2PK7 A;  3PO3 I;  2NVY I;  3GTM I;  2E2H I;  3S1N I;  4A3M I;  4NB8 A;  5C44 I;  2E2I I;  3PO2 I;  1TWC I;  4BY7 I;  3EER A;  1Y1V S;  4NBB A;  4NOZ A;  4QTU A;  3S1M I;  5C3E I;  2HF1 A;  1R9T I;  2B63 I;  3LUS A;  1SFO I;  3FKI I;  4A93 I;  5CM2 M;  1ZB8 A;  1TWG I;  4NBG A;  1Y1W I;  3GTP I;  3GTK I;  3GTQ I;  3CQZ I;  5IP9 I;  2DE5 A;  3GTG I;  4A3C I;  1VLA A;  3VMI A;  2JS4 A;  3GTO I;  5FLM I;  2JNY A;  5C4J I;  1X3W A;  4NBD A;  3HOV I;  4NBH A;  2K5R A;  3I4M I;  2E2J I;  3GTJ I;  3H0G I;  3RZO I;  4A3E I;  1TWA I;  1YUA A;  1WW9 A;  4QTT A;  5IP7 I;  1ZB9 A;  3H3V J;  1L1O C;  1N2F A;  1TFI A;  4BBR I;  3GTL I;  1I50 I;  3VB9 A;  3HOW I;  3K7A I;  3HOZ I;  3S2D I;  1ML8 A;  2R92 I;  1I6H I;  2DE7 A;  2P3Y A;  3HOY I;  2R93 I;  4A3L I;  2R7Z I;  3S15 I;  4BBS I;  3GKQ A;  2RBL A;  3GCF A;  3S16 I;  4BXX I;  1USP B;  2JA6 I;  3M3Y I;  3GTM S;  4A3G I;  2JA8 I;  3HOX I;  4NBA A;  3D6W A;  3S1R I;  1USP A;  4A3D I;  2F4O A;  4XX2 A;  4A3K I;  1RLY A;  3S17 I;  2J6A A;  4NBF A;  3S14 I;  2KPI A;  2NVX I;  5C4X I;  2NVQ I;  2F4M A;  4MH4 A;  4NBE A;  4NB9 A;  1WCM I;  3Q87 A;  3I07 A;  2VUM I;  1I3Q I;  2AKL A;  4BY1 I;  4X6A I;  1NUI A;  4NBC A;  1X3Z A;  2JA5 I;  4A3F I;  1TWH I;  1TWF I;  1RO4 A;  2DE6 A;  3S1Q I;  4A3B I;  4A3I I;  3M4O I;  1LQL A;  1DL6 A; 
#chains in the Genus database with same CATH topology
 3VMG A;  3HOU I;  3ESW A;  3VMH A;  2V8I A;  3BG1 B;  2VPW A;  1QYP A;  3CME 1;  2JA7 I;  3S2H I;  2QEX Z;  1K83 I;  2VUG A;  1S7M A;  4HH4 A;  3CPW Z;  1N8R 2;  3S1N I;  4A3M I;  1NJI 2;  2E2I I;  1YUK A;  4TNU A;  3NFZ A;  1KQS Y;  3CXC Z;  2HF1 A;  1R9T I;  3MZK B;  3CCE Z;  2QA4 1;  3G4S Z;  2W03 A;  3CCS 1;  1VLA A;  5D1O B;  3GTO I;  1X0T A;  2JNY A;  2QRC B;  2LEX A;  3HOV I;  1QXF A;  2K5R A;  1ZH1 A;  2Y0S A;  1W2B Y;  2O53 A;  2E2J I;  1QVF Z;  3RZO I;  1RNI A;  4A3E I;  4RVH A;  4QTT A;  3JAM b;  4E2Z A;  1VQ9 Z;  3NDJ A;  3IR7 A;  1VQO 1;  1L1O C;  1K73 2;  3CC2 Z;  1WZN A;  1M90 2;  2RT9 A;  1Q86 1;  1KC8 1;  1Q82 1;  2R92 I;  2P3Y A;  3HOY I;  2R93 I;  3S15 I;  2HU9 A;  3S16 I;  4BXX I;  2JA6 I;  3CCJ 1;  1YJN 1;  1USP A;  1JWH C;  2OOY B;  3CCM Z;  3CCQ 1;  4A3D I;  4XX2 A;  2QLV B;  2V45 A;  3CCE 1;  1YJW 1;  2J6A A;  1Q16 A;  1YJ9 1;  3FQM A;  3D2L A;  1WCM I;  3I07 A;  3CCQ Z;  4CL1 A;  2AKL A;  1Y8C A;  3CMA Z;  1KC8 2;  1X3Z A;  3J80 b;  1TWH I;  2QR1 B;  4HGY A;  2DE6 A;  2Q4Z A;  5A2Q f;  4MD7 A;  5IT9 b;  2GTI A;  4A3I I;  2VPY A;  1VQO Z;  3J80 f;  1DL6 A;  3RZD I;  2V8K A;  1PFT A;  2W04 A;  4DK1 A;  4Y52 I;  2NVT I;  3PO3 S;  1Q81 1;  3GTM I;  3CCS Z;  4NB8 A;  4MON A;  2Q51 A;  3PO2 I;  4BY7 I;  3EER A;  3CCU Z;  1Y1V S;  1YJW Z;  2RIQ A;  2V3V A;  3TDH B;  3NH5 A;  1YJ9 Z;  2B63 I;  1SFO I;  3FKI I;  1VQK 1;  1Q7Y 2;  1KD1 2;  1ZB8 A;  3IF8 A;  3GTK I;  3CQZ I;  3GTG I;  2DE5 A;  1FDI A;  2JIR A;  2JS4 A;  3VMI A;  2IZ4 A;  1P9N A;  1VQ6 Z;  5C4J I;  2OTJ 1;  1X3W A;  4NBD A;  1M90 1;  3CPW Y;  3H0G I;  3QWU A;  3CC4 Z;  1TWA I;  1YUA A;  1WW9 A;  2PMZ A;  1VQ8 1;  2KI7 B;  3H3V J;  1K9M 2;  2H85 A;  3GTL I;  3VB9 A;  2ZAE B;  3MZL B;  2IZ3 A;  2VPZ A;  3CCR 1;  1VQL Z;  1JJ2 Y;  3J7A 4;  4E33 A;  2YAD A;  2V8J A;  3GKQ A;  2RBL A;  1USP B;  3NH8 A;  1NJI 1;  4A3G I;  2EGT A;  3D6W A;  4NBA A;  1W2B Z;  2KPI A;  2NVX I;  5C4X I;  2NVQ I;  1K9M 1;  2OTJ Z;  4MH4 A;  5FLX f;  4MD9 A;  4NBE A;  1Z03 A;  4NB9 A;  3Q87 A;  4E2X A;  1K8A 2;  1I3Q I;  1VQN 1;  3IFU A;  1NUI A;  1YIT Z;  4NBC A;  3VTN A;  1TWF I;  4RVD A;  5D1P A;  3EED A;  2M6N A;  3M4O I;  4A3J I;  3JAM f;  3HKZ A;  2JR6 A;  2I3C A;  2AYD A;  3U50 C;  2QKD A;  4Y7N I;  4NFR A;  1JJ2 Z;  3CC7 1;  3I4N I;  2NVY I;  4EWC A;  2E2H I;  2R6M A;  4RV9 A;  3CME Z;  5C44 I;  2QEX 1;  4E31 A;  4RVF A;  1VQ5 1;  1YI2 1;  1Q7Y 1;  1KD1 1;  4NOZ A;  3CC4 1;  5C3E I;  2NAP A;  3LUS A;  1TWG I;  4NBG A;  1Y1W I;  3I55 Z;  3GTQ I;  1YIT 1;  5IP9 I;  1QVG Z;  5FLM I;  5D1O A;  1Z01 A;  5AN9 F;  1YIJ Z;  4NBH A;  5IP7 I;  1ZB9 A;  1M1K 1;  1WJ2 A;  5A2Q b;  5IT9 f;  5FLX b;  1N2F A;  1TFI A;  4BBR I;  1WII A;  1K73 1;  2IV2 X;  1VQ7 Z;  3P5J B;  1ML8 A;  3G4S 1;  1YHQ 1;  1VQL 1;  1FDO A;  1RQF A;  4NH1 C;  2R7Z I;  4BBS I;  1KRL A;  3CCL 1;  3GCF A;  2RPR A;  3M3Y I;  3GTM S;  3S1R I;  4AYB A;  2K3R A;  3KIF A;  3G6E Z;  2F4O A;  1VQ9 1;  4A3K I;  1RLY A;  3S17 I;  3KIH A;  3S14 I;  4NBF A;  3CC2 1;  3D9X A;  2VF1 A;  2QRD B;  1NP6 A;  1S72 1;  3I56 1;  2VUM I;  1VQP Z;  1KQS Z;  4E2Y A;  4BY1 I;  4X6A I;  3CC7 Z;  1YIJ 1;  2GU2 A;  3MON A;  1VQM Z;  3OW2 Y;  2JA5 I;  4A3F I;  3S1Q I;  2LFU A;  4A3B I;  1S72 Z;  1VQK Z;  3CD6 Z;  3TE5 B;  1VQP 1;  1LQL A;  1M1K 2;  1Y1V I;  2P28 A;  3CCJ Z;  1VQM 1;  2YU9 I;  3NH4 A;  1YHQ Z;  2E7Z A;  4E32 A;  1VQ7 1;  2BJO A;  2WAQ A;  2JIP A;  2PK7 A;  3PO3 I;  4S1T A;  4RVG A;  1Q81 2;  2GTH A;  1VQ8 Z;  1RO2 A;  1TWC I;  3CMA 1;  1K8A 1;  4MD8 A;  4NBB A;  4QTU A;  3S1M I;  1SIW A;  1Q82 2;  4MXU A;  3T4N B;  1Q86 2;  1RO0 A;  5CM2 M;  4A93 I;  5T64 A;  1Z02 A;  3J81 f;  2OTL Z;  2PM9 A;  2QA4 Z;  3GTP I;  2LIY A;  3CCR Z;  3I55 1;  4A3C I;  3I56 Z;  2JUB A;  4DGL A;  4RS4 A;  2M48 A;  4MRI A;  3CD6 1;  3CCV Z;  1VQ4 Z;  3I4M I;  3GTJ I;  5T67 A;  3J81 b;  3CCU 1;  2WB1 A;  3F3F C;  2JIM A;  3G6E 1;  4HGZ A;  1I50 I;  3OW2 Z;  3HOW I;  3CXC Y;  5LL6 f;  4E30 A;  2O4H A;  3NDI A;  3K7A I;  3HOZ I;  3S2D I;  3FQQ A;  1I6H I;  2DE7 A;  2OZK A;  4A3L I;  3F3P C;  2G2K A;  3BG0 B;  1VQ6 1;  2QRE B;  3CCL Z;  5T6B A;  4E2W A;  2RHB A;  2JA8 I;  3HOX I;  1N8R 1;  2JIO A;  2VPX A;  3G71 1;  2OTL 1;  1AA6 A;  3IX0 A;  2E9H A;  2F4M A;  3G71 Z;  2JMO A;  1YI2 Z;  1QVG Y;  3CCV 1;  2OOX B;  1VQ4 1;  1VQ5 Z;  1YJN Z;  4DQY B;  1RO4 A;  3CCM 1;  1QF8 A;  1VQN Z;  1QVF Y;  2JIQ A; 
#chains in the Genus database with same CATH homology
 3VMG A;  3HOU I;  3ESW A;  3VMH A;  2V8I A;  3BG1 B;  3CME 1;  1QYP A;  2JA7 I;  3S2H I;  2QEX Z;  1K83 I;  2VUG A;  1S7M A;  4HH4 A;  3CPW Z;  1N8R 2;  3S1N I;  4A3M I;  1NJI 2;  2E2I I;  1YUK A;  4TNU A;  3NFZ A;  1KQS Y;  3CXC Z;  2HF1 A;  1R9T I;  3MZK B;  3CCE Z;  2QA4 1;  3G4S Z;  2W03 A;  3CCS 1;  1VLA A;  5D1O B;  3GTO I;  1X0T A;  2JNY A;  2QRC B;  3HOV I;  2K5R A;  1ZH1 A;  2Y0S A;  1W2B Y;  2O53 A;  2E2J I;  1QVF Z;  3RZO I;  1RNI A;  4A3E I;  4RVH A;  4QTT A;  3JAM b;  4E2Z A;  1VQ9 Z;  3NDJ A;  1VQO 1;  1K73 2;  1L1O C;  3CC2 Z;  1M90 2;  2RT9 A;  1Q86 1;  1KC8 1;  1Q82 1;  2R92 I;  2P3Y A;  3HOY I;  2R93 I;  3S15 I;  2HU9 A;  3S16 I;  4BXX I;  2JA6 I;  3CCJ 1;  1YJN 1;  1USP A;  1JWH C;  2OOY B;  3CCM Z;  3CCQ 1;  4A3D I;  4XX2 A;  2QLV B;  3CCE 1;  1YJW 1;  2J6A A;  1YJ9 1;  3FQM A;  1WCM I;  3I07 A;  3CCQ Z;  4CL1 A;  2AKL A;  1KC8 2;  3CMA Z;  1X3Z A;  3J80 b;  1TWH I;  2QR1 B;  4HGY A;  2DE6 A;  2Q4Z A;  5A2Q f;  4MD7 A;  5IT9 b;  2GTI A;  4A3I I;  1VQO Z;  3J80 f;  1DL6 A;  3RZD I;  2V8K A;  1PFT A;  2W04 A;  4DK1 A;  4Y52 I;  2NVT I;  3PO3 S;  1Q81 1;  3GTM I;  3CCS Z;  4NB8 A;  4MON A;  2Q51 A;  3PO2 I;  4BY7 I;  3EER A;  3CCU Z;  1Y1V S;  1YJW Z;  2RIQ A;  3TDH B;  3NH5 A;  1YJ9 Z;  2B63 I;  1SFO I;  3FKI I;  1VQK 1;  1Q7Y 2;  1KD1 2;  1ZB8 A;  3IF8 A;  3GTK I;  3CQZ I;  3GTG I;  2DE5 A;  3VMI A;  2JS4 A;  2IZ4 A;  1P9N A;  1VQ6 Z;  5C4J I;  2OTJ 1;  1X3W A;  4NBD A;  1M90 1;  3CPW Y;  3H0G I;  3QWU A;  3CC4 Z;  1TWA I;  1YUA A;  1WW9 A;  2PMZ A;  1VQ8 1;  2KI7 B;  3H3V J;  1K9M 2;  2H85 A;  3GTL I;  3VB9 A;  2ZAE B;  3MZL B;  2IZ3 A;  3CCR 1;  1VQL Z;  1JJ2 Y;  3J7A 4;  4E33 A;  2YAD A;  2V8J A;  3GKQ A;  2RBL A;  1USP B;  3NH8 A;  1NJI 1;  4A3G I;  2EGT A;  3D6W A;  4NBA A;  1W2B Z;  2KPI A;  2NVX I;  5C4X I;  2NVQ I;  1K9M 1;  2OTJ Z;  4MH4 A;  4MD9 A;  4NBE A;  5FLX f;  1Z03 A;  4NB9 A;  3Q87 A;  4E2X A;  1K8A 2;  1I3Q I;  1VQN 1;  3IFU A;  1NUI A;  1YIT Z;  4NBC A;  3VTN A;  1TWF I;  4RVD A;  5D1P A;  3EED A;  2M6N A;  3M4O I;  4A3J I;  3JAM f;  3HKZ A;  2JR6 A;  2I3C A;  3U50 C;  2QKD A;  4Y7N I;  4NFR A;  1JJ2 Z;  3CC7 1;  3I4N I;  2NVY I;  4EWC A;  2E2H I;  2R6M A;  4RV9 A;  3CME Z;  5C44 I;  2QEX 1;  4E31 A;  4RVF A;  1VQ5 1;  1YI2 1;  1Q7Y 1;  1KD1 1;  4NOZ A;  3CC4 1;  5C3E I;  3LUS A;  1TWG I;  4NBG A;  1Y1W I;  3I55 Z;  3GTQ I;  1YIT 1;  5IP9 I;  1QVG Z;  5FLM I;  5D1O A;  1Z01 A;  5AN9 F;  1YIJ Z;  4NBH A;  5IP7 I;  1ZB9 A;  1M1K 1;  5A2Q b;  5IT9 f;  5FLX b;  1N2F A;  1TFI A;  4BBR I;  1WII A;  1K73 1;  1VQ7 Z;  3P5J B;  1ML8 A;  3G4S 1;  1YHQ 1;  1VQL 1;  1RQF A;  4NH1 C;  2R7Z I;  4BBS I;  1KRL A;  3CCL 1;  3GCF A;  2RPR A;  3M3Y I;  3GTM S;  3S1R I;  4AYB A;  2K3R A;  3KIF A;  3G6E Z;  2F4O A;  1VQ9 1;  4A3K I;  1RLY A;  3S17 I;  3KIH A;  3S14 I;  4NBF A;  3CC2 1;  3D9X A;  2VF1 A;  2QRD B;  1NP6 A;  1S72 1;  3I56 1;  2VUM I;  1VQP Z;  1KQS Z;  4E2Y A;  4BY1 I;  4X6A I;  3CC7 Z;  1YIJ 1;  2GU2 A;  3MON A;  1VQM Z;  3OW2 Y;  2JA5 I;  4A3F I;  3S1Q I;  2LFU A;  4A3B I;  1S72 Z;  1VQK Z;  3CD6 Z;  3TE5 B;  1VQP 1;  1LQL A;  1M1K 2;  1Y1V I;  2P28 A;  3CCJ Z;  1VQM 1;  2YU9 I;  3NH4 A;  1YHQ Z;  4E32 A;  1VQ7 1;  2BJO A;  2WAQ A;  2PK7 A;  3PO3 I;  4S1T A;  4RVG A;  1Q81 2;  2GTH A;  1VQ8 Z;  1RO2 A;  1TWC I;  3CMA 1;  1K8A 1;  4MD8 A;  4NBB A;  4QTU A;  3S1M I;  1Q82 2;  4MXU A;  3T4N B;  1Q86 2;  1RO0 A;  5CM2 M;  4A93 I;  5T64 A;  1Z02 A;  3J81 f;  2OTL Z;  2PM9 A;  2QA4 Z;  3GTP I;  2LIY A;  3CCR Z;  3I55 1;  4A3C I;  3I56 Z;  2JUB A;  4DGL A;  4RS4 A;  2M48 A;  4MRI A;  3CD6 1;  3CCV Z;  1VQ4 Z;  3I4M I;  3GTJ I;  5T67 A;  3J81 b;  3CCU 1;  2WB1 A;  3F3F C;  3G6E 1;  4HGZ A;  1I50 I;  3OW2 Z;  3HOW I;  3CXC Y;  5LL6 f;  4E30 A;  2O4H A;  3NDI A;  3K7A I;  3HOZ I;  3S2D I;  3FQQ A;  1I6H I;  2DE7 A;  2OZK A;  4A3L I;  3F3P C;  2G2K A;  3BG0 B;  1VQ6 1;  2QRE B;  3CCL Z;  5T6B A;  4E2W A;  2RHB A;  2JA8 I;  3HOX I;  1N8R 1;  3G71 1;  2OTL 1;  3IX0 A;  2E9H A;  2F4M A;  3G71 Z;  2JMO A;  1QVG Y;  1YI2 Z;  3CCV 1;  2OOX B;  1VQ4 1;  1VQ5 Z;  1YJN Z;  4DQY B;  1RO4 A;  3CCM 1;  1QF8 A;  1VQN Z;  1QVF Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...