3GTPI

Backtracked rna polymerase ii complex with 24mer rna
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
119
structure length
119
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
total genus 8
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtpI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtpI02
5C3EI 1SFOI 4A3EI 3GTOI 1USPA 4NBEA 2NVTI 2JNYA 4X6AI 1RO4A 3EERA 3K7AI 2PK7A 1LQLA 3HOVI 3S1MI 4NB9A 5C4JI 1TWGI 1USPB 4NBGA 2R92I 5C4XI 4XX2A 3I07A 2HF1A 3S1RI 1R9TI 3HOWI 1N2FA 3S1QI 5IP7I 2KPIA 2BJOA 1X3ZA 4BY7I 3GKQA 2K5RA 1K83I 1DL6A 1RLYA 3GTLI 3H0GI 4BXXI 2R93I 3M4OI 1ZB8A 2JR6A 4A93I 2NVXI 2DE7A 3RZOI 3S16I 4NBDA 3GCFA 4A3GI 4NBCA 3GTMI 3GTMS 1Y1VI 1Y1VS 3HOUI 3S15I 4A3CI 2JS4A 1I3QI 3HOYI 3I4MI 3Q87A 4NBBA 4QTUA 3PO2I 4A3DI 4A3BI 1TFIA 4BY1I 3I4NI 3RZDI 3GTPI 2R7ZI 4MH4A 1NUIA 2DE6A 3GTQI 3S2DI 3S14I 4QTTA 2JA6I 1YUAA 1VLAA 3VMGA 3M3YI 4Y7NI 1ML8A 2NVYI 2F4MA 3LUSA 4A3FI 3U50C 3GTKI 1TWHI 1WW9A 2JA5I 5CM2M 4A3LI 3FKII 3GTGI 2B63I 2VUMI 2P3YA 1TWFI 4NB8A 4NBHA 4A3JI 1X3WA 3PO3I 3PO3S 1L1OC 2J6AA 1ZB9A 4NBAA 2JA7I 2JA8I 4A3KI 5C44I 2E2II 4NBFA 2RBLA 3VMHA 1QYPA 1TWCI 3CQZI 1PFTA 3GTJI 4BBSI 2E2JI 4A3II 1WCMI 3H3VJ 1I50I 3S2HI 2F4OA 5IP9I 3HOZI 2DE5A 1I6HI 4A3MI 4NOZA 3ESWA 3D6WA 3VB9A 3S17I 3S1NI 3HOXI 1Y1WI 2YU9I 2E2HI 2AKLA 4Y52I 3VMIA 1TWAI 2NVQI 4BBRI 5FLMI
chains in the Genus database with same CATH superfamily
3I55Z 4A3EI 3CMAZ 2LFUA 2JIOA 2JNYA 4X6AI 1RO4A 3EERA 1Q821 2PK7A 1K8A1 1KRLA 3S1MI 4NBGA 3CCUZ 5C4XI 3HOWI 3S1RI 2VPXA 2KPIA 4E2WA 1X3ZA 1M901 4HGYA 1K83I 2KI7B 2GU2A 1YI21 4BXXI 2R93I 5FLXb 3CXCY 1VQP1 1KD11 2QA41 3CPWZ 4NBDA 3BG0B 1QF8A 3IFUA 1Y8CA 3CC41 3HOUI 3S15I 1Y1VS 2JS4A 3TDHB 1VQ71 5FLXf 2RIQA 2RHBA 1Z03A 2YADA 1AA6A 3CXCZ 3CME1 1KC82 1TFIA 4RV9A 3I4NI 4MH4A 3S2DI 4TNUA 1YUAA 3VMGA 3M3YI 2OTLZ 1Q7Y2 2NVYI 3CD6Z 3KIFA 1SIWA 4A3FI 3IR7A 2NAPA 1Q811 3U50C 3J81f 1TWHI 2JA5I 3MONA 3NFZA 1YJN1 5CM2M 3CCV1 3T4NB 3G6EZ 3FKII 3CCQZ 2EGTA 2VUMI 1TWFI 1Q862 3CCMZ 3OW2Y 5IT9b 3PO3S 1YIJ1 1S72Z 1YITZ 5C44I 2VF1A 4E32A 2RBLA 2O4HA 1VQ61 1VQM1 1KQSZ 1VQ4Z 4E31A 1JJ2Z 4CL1A 4A3II 2W04A 3HOZI 1YJ91 2IZ3A 4S1TA 1Y1WI 1YHQZ 3P5JB 1Z02A 1TWAI 2NVQI 1NJI1 1VQ91 1K732 3CC71 2H85A 3CCJ1 1YJWZ 4NB9A 5C4JI 1TWGI 2R92I 1VQL1 2OOYB 1R9TI 1ZH1A 2LIYA 3I56Z 2QEX1 3S1QI 4DGLA 2HU9A 3GKQA 4MRIA 5A2Qb 1DL6A 1RO0A 3MZKB 1ZB8A 3CCL1 2JR6A 4HH4A 1M1K2 2NVXI 3RZOI 1VQK1 2JUBA 3GCFA 3GTMI 4E33A 5A2Qf 3NH4A 1WIIA 1VQO1 4A3BI 1VQ51 1K9M2 2IV2X 1VQ7Z 4DK1A 4E2ZA 3GTQI 2PMZA 3IF8A 3S14I 2M6NA 4NH1C 1VLAA 1ML8A 3G4SZ 2V8JA 1N8R1 4RS4A 5D1OB 3J80b 3I551 1W2BY 2K3RA 3CMA1 2JIRA 3CCEZ 3G71Z 4NBHA 4A3JI 3D2LA 1ZB9A 4NBAA 3J81b 2LEXA 3J80f 2E2II 1NP6A 2QR1B 4NBFA 1TWCI 1W2BZ 1PFTA 3GTJI 3CCRZ 2AYDA 2R6MA 4EWCA 2VPWA 4RVGA 2VPYA 1I50I 3S2HI 4HGZA 1I6HI 1Q16A 1QVGY 1Q822 4A3MI 4NOZA 3VB9A 1K8A2 1YUKA 3S1NI 3HOXI 5T6BA 2E2HI 2AKLA 3CCSZ 2VPZA 1VQ8Z 5FLMI 5D1PA 2QREB 2O53A 4NFRA 3GTOI 1USPA 2I3CA 1YJ9Z 1KD12 2NVTI 3K7AI 1LQLA 3OW2Z 2M48A 2OTJ1 1USPB 3F3PC 3I07A 4E2XA 1VQNZ 1VQ9Z 3NDIA 2E7ZA 5IP7I 1WZNA 2BJOA 4BY7I 3CC2Z 3JAMf 3GTLI 4DQYB 2JIMA 2RPRA 3S16I 4MONA 1QVFY 4NBCA 3GTMS 4A3CI 1RO2A 1S721 2QEXZ 1I3QI 3VTNA 1K9M1 1Q812 3PO2I 3CCLZ 1VQ41 1VQKZ 4E2YA 2WAQA 2QKDA 4AYBA 3RZDI 1QVFZ 1NUIA 2JA6I 2Y0SA 3LUSA 2Q51A 1YHQ1 3GTKI 1KC81 5AN9F 1JWHC 2JIQA 4A3LI 1YI2Z 2B63I 3NH5A 2P3YA 4NB8A 1VQPZ 2QA4Z 1X3WA 2GTIA 2G2KA 3IX0A 1L1OC 3CC4Z 4RVFA 1Q7Y1 2JA7I 3F3FC 2ZAEB 3VMHA 5T67A 3I561 3J7A4 1QYPA 5D1OA 3CQZI 4MD8A 2PM9A 4RVHA 3CMEZ 4BBSI 1Q861 1NJI2 2E2JI 3CPWY 2Q4ZA 1WCMI 3H3VJ 5IP9I 2P28A 2DE5A 4RVDA 4MXUA 3ESWA 2V8IA 3S17I 2YU9I 2V45A 1RNIA 2VUGA 1YJNZ 3CCU1 3CCVZ 4BBRI 5C3EI 2QLVB 2WB1A 1SFOI 4NBEA 1YIJZ 3HOVI 2QRDB 3G4S1 3EEDA 4XX2A 2HF1A 2E9HA 1S7MA 1N2FA 2V8KA 1VQ6Z 2JIPA 4MD9A 1VQMZ 2K5RA 1K731 1RLYA 3H0GI 3M4OI 1WJ2A 3QWUA 3CCE1 4A93I 3G711 2OTJZ 2DE7A 2OZKA 1Z01A 1M902 1FDIA 4A3GI 1Y1VI 3FQMA 3HOYI 3I4MI 3FQQA 3D9XA 1QVGZ 3Q87A 1KQSY 4NBBA 1N8R2 5LL6f 3JAMb 4QTUA 2OTL1 4A3DI 3CD61 1JJ2Y 1M1K1 3CCR1 4BY1I 3GTPI 2R7ZI 2DE6A 3TE5B 3G6E1 2OOXB 3CC7Z 3CCQ1 4QTTA 3CCJZ 2QRCB 5IT9f 4Y7NI 3CCM1 2F4MA 1VQLZ 2V3VA 1WW9A 3CCS1 2W03A 4E30A 1YIT1 3NH8A 1VQ81 1P9NA 3GTGI 1RQFA 2IZ4A 2GTHA 1X0TA 3NDJA 3PO3I 2J6AA 2JA8I 4A3KI 1VQN1 1QXFA 3BG1B 3CC21 1VQOZ 5T64A 1VQ5Z 3KIHA 2F4OA 3MZLB 3HKZA 3D6WA 2RT9A 1FDOA 1YJW1 2JMOA 4Y52I 3VMIA 4MD7A
chains in the Genus database with same CATH topology
3I55Z 4A3EI 3CMAZ 2LFUA 2JNYA 4X6AI 1RO4A 3EERA 1Q821 2PK7A 1K8A1 1KRLA 3S1MI 4NBGA 3CCUZ 5C4XI 3HOWI 3S1RI 2KPIA 4E2WA 1X3ZA 1M901 4HGYA 1K83I 2KI7B 2GU2A 1YI21 4BXXI 2R93I 5FLXb 3CXCY 1VQP1 1KD11 2QA41 3CPWZ 4NBDA 3BG0B 1QF8A 3IFUA 3CC41 3HOUI 3S15I 1Y1VS 2JS4A 3TDHB 1VQ71 5FLXf 2RIQA 2RHBA 1Z03A 2YADA 3CXCZ 3CME1 1KC82 1TFIA 4RV9A 3I4NI 4MH4A 3S2DI 4TNUA 1YUAA 3VMGA 3M3YI 2OTLZ 1Q7Y2 2NVYI 3CD6Z 3KIFA 1Q811 4A3FI 3U50C 3J81f 1TWHI 2JA5I 3MONA 3NFZA 1YJN1 5CM2M 3CCV1 3T4NB 3G6EZ 3FKII 3CCQZ 2EGTA 2VUMI 1TWFI 1Q862 3CCMZ 3OW2Y 5IT9b 3PO3S 1YIJ1 1S72Z 1YITZ 5C44I 2VF1A 4E32A 2RBLA 2O4HA 1VQ61 1VQM1 1KQSZ 1VQ4Z 4E31A 1JJ2Z 4CL1A 4A3II 2W04A 3HOZI 1YJ91 2IZ3A 4S1TA 1Y1WI 1YHQZ 3P5JB 1Z02A 1TWAI 2NVQI 1NJI1 1VQ91 1K732 3CC71 2H85A 3CCJ1 1YJWZ 4NB9A 5C4JI 1TWGI 2R92I 1VQL1 2OOYB 1R9TI 1ZH1A 2LIYA 3I56Z 2QEX1 3S1QI 4DGLA 2HU9A 3GKQA 4MRIA 5A2Qb 1DL6A 1RO0A 3MZKB 1ZB8A 3CCL1 2JR6A 4HH4A 1M1K2 2NVXI 3RZOI 1VQK1 2JUBA 3GCFA 3GTMI 4E33A 5A2Qf 3NH4A 1WIIA 1VQO1 4A3BI 1VQ51 1K9M2 1VQ7Z 4DK1A 4E2ZA 3GTQI 2PMZA 3IF8A 3S14I 2M6NA 4NH1C 1VLAA 1ML8A 3G4SZ 2V8JA 1N8R1 4RS4A 5D1OB 3J80b 3I551 1W2BY 2K3RA 3CMA1 3CCEZ 4NBHA 3G71Z 4A3JI 1ZB9A 4NBAA 3J81b 3J80f 2E2II 1NP6A 2QR1B 4NBFA 1TWCI 1W2BZ 1PFTA 3GTJI 3CCRZ 2R6MA 4EWCA 4RVGA 1I50I 3S2HI 4HGZA 1I6HI 1QVGY 1Q822 4A3MI 4NOZA 3VB9A 1K8A2 1YUKA 3S1NI 3HOXI 5T6BA 2E2HI 2AKLA 3CCSZ 1VQ8Z 5FLMI 5D1PA 2QREB 2O53A 4NFRA 3GTOI 1USPA 2I3CA 1YJ9Z 1KD12 2NVTI 3K7AI 1LQLA 3OW2Z 2M48A 2OTJ1 1USPB 3F3PC 3I07A 4E2XA 1VQNZ 1VQ9Z 3NDIA 5IP7I 2BJOA 4BY7I 3CC2Z 3JAMf 3GTLI 4DQYB 3S16I 2RPRA 4MONA 1QVFY 4NBCA 3GTMS 4A3CI 1RO2A 1S721 2QEXZ 1I3QI 3VTNA 1K9M1 1Q812 3PO2I 3CCLZ 1VQ41 1VQKZ 4E2YA 2WAQA 2QKDA 4AYBA 3RZDI 1QVFZ 1NUIA 2JA6I 2Y0SA 3LUSA 2Q51A 1YHQ1 3GTKI 1KC81 5AN9F 1JWHC 4A3LI 1YI2Z 2B63I 3NH5A 2P3YA 4NB8A 1VQPZ 2QA4Z 1X3WA 2GTIA 2G2KA 3IX0A 1L1OC 3CC4Z 4RVFA 1Q7Y1 2JA7I 3F3FC 2ZAEB 3VMHA 5T67A 3I561 3J7A4 1QYPA 5D1OA 3CQZI 4MD8A 2PM9A 4RVHA 3CMEZ 4BBSI 1Q861 1NJI2 2E2JI 3CPWY 2Q4ZA 1WCMI 3H3VJ 5IP9I 2P28A 2DE5A 4RVDA 4MXUA 3ESWA 2V8IA 3S17I 2YU9I 1RNIA 2VUGA 1YJNZ 3CCU1 3CCVZ 4BBRI 5C3EI 2QLVB 2WB1A 1SFOI 4NBEA 1YIJZ 3HOVI 2QRDB 3G4S1 3EEDA 4XX2A 2HF1A 2E9HA 1S7MA 1N2FA 2V8KA 1VQ6Z 1VQMZ 4MD9A 2K5RA 1K731 1RLYA 3H0GI 3M4OI 3QWUA 3CCE1 4A93I 3G711 2OTJZ 2DE7A 2OZKA 1Z01A 1M902 4A3GI 1Y1VI 3FQMA 3HOYI 3I4MI 3FQQA 3D9XA 1QVGZ 3Q87A 1KQSY 4NBBA 1N8R2 5LL6f 3JAMb 4QTUA 2OTL1 4A3DI 3CD61 1JJ2Y 1M1K1 3CCR1 4BY1I 3GTPI 2R7ZI 2DE6A 3TE5B 3G6E1 2OOXB 3CC7Z 3CCQ1 4QTTA 3CCJZ 2QRCB 5IT9f 4Y7NI 3CCM1 2F4MA 1VQLZ 1WW9A 3CCS1 2W03A 4E30A 1YIT1 3NH8A 1VQ81 1P9NA 3GTGI 1RQFA 2IZ4A 2GTHA 1X0TA 3NDJA 3PO3I 2J6AA 2JA8I 4A3KI 1VQN1 3BG1B 3CC21 1VQOZ 5T64A 1VQ5Z 3KIHA 2F4OA 3MZLB 3HKZA 3D6WA 2RT9A 1YJW1 2JMOA 4Y52I 3VMIA 4MD7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C3E I;  1SFO I;  4A3E I;  3GTO I;  1USP A;  4NBE A;  2NVT I;  2JNY A;  4X6A I;  1RO4 A;  3EER A;  3K7A I;  2PK7 A;  1LQL A;  3HOV I;  3S1M I;  4NB9 A;  5C4J I;  1TWG I;  1USP B;  4NBG A;  2R92 I;  5C4X I;  4XX2 A;  3I07 A;  2HF1 A;  3S1R I;  1R9T I;  3HOW I;  1N2F A;  3S1Q I;  5IP7 I;  2KPI A;  2BJO A;  1X3Z A;  4BY7 I;  3GKQ A;  2K5R A;  1K83 I;  1DL6 A;  1RLY A;  3GTL I;  3H0G I;  4BXX I;  2R93 I;  3M4O I;  1ZB8 A;  2JR6 A;  4A93 I;  2NVX I;  2DE7 A;  3RZO I;  3S16 I;  4NBD A;  3GCF A;  4A3G I;  4NBC A;  3GTM I;  3GTM S;  1Y1V I;  1Y1V S;  3HOU I;  3S15 I;  4A3C I;  2JS4 A;  1I3Q I;  3HOY I;  3I4M I;  3Q87 A;  4NBB A;  4QTU A;  3PO2 I;  4A3D I;  4A3B I;  1TFI A;  4BY1 I;  3I4N I;  3RZD I;  3GTP I;  2R7Z I;  4MH4 A;  1NUI A;  2DE6 A;  3GTQ I;  3S2D I;  3S14 I;  4QTT A;  2JA6 I;  1YUA A;  1VLA A;  3VMG A;  3M3Y I;  4Y7N I;  1ML8 A;  2NVY I;  2F4M A;  3LUS A;  4A3F I;  3U50 C;  3GTK I;  1TWH I;  1WW9 A;  2JA5 I;  5CM2 M;  4A3L I;  3FKI I;  3GTG I;  2B63 I;  2VUM I;  2P3Y A;  1TWF I;  4NB8 A;  4NBH A;  4A3J I;  1X3W A;  3PO3 I;  3PO3 S;  1L1O C;  2J6A A;  1ZB9 A;  4NBA A;  2JA7 I;  2JA8 I;  4A3K I;  5C44 I;  2E2I I;  4NBF A;  2RBL A;  3VMH A;  1QYP A;  1TWC I;  3CQZ I;  1PFT A;  3GTJ I;  4BBS I;  2E2J I;  4A3I I;  1WCM I;  3H3V J;  1I50 I;  3S2H I;  2F4O A;  5IP9 I;  3HOZ I;  2DE5 A;  1I6H I;  4A3M I;  4NOZ A;  3ESW A;  3D6W A;  3VB9 A;  3S17 I;  3S1N I;  3HOX I;  1Y1W I;  2YU9 I;  2E2H I;  2AKL A;  4Y52 I;  3VMI A;  1TWA I;  2NVQ I;  4BBR I;  5FLM I; 
#chains in the Genus database with same CATH topology
 3I55 Z;  4A3E I;  3CMA Z;  2LFU A;  2JIO A;  2JNY A;  4X6A I;  1RO4 A;  3EER A;  1Q82 1;  2PK7 A;  1K8A 1;  1KRL A;  3S1M I;  4NBG A;  3CCU Z;  5C4X I;  3HOW I;  3S1R I;  2VPX A;  2KPI A;  4E2W A;  1X3Z A;  1M90 1;  4HGY A;  1K83 I;  2KI7 B;  2GU2 A;  1YI2 1;  4BXX I;  2R93 I;  5FLX b;  3CXC Y;  1VQP 1;  1KD1 1;  2QA4 1;  3CPW Z;  4NBD A;  3BG0 B;  1QF8 A;  3IFU A;  1Y8C A;  3CC4 1;  3HOU I;  3S15 I;  1Y1V S;  2JS4 A;  3TDH B;  1VQ7 1;  5FLX f;  2RIQ A;  2RHB A;  1Z03 A;  2YAD A;  1AA6 A;  3CXC Z;  3CME 1;  1KC8 2;  1TFI A;  4RV9 A;  3I4N I;  4MH4 A;  3S2D I;  4TNU A;  1YUA A;  3VMG A;  3M3Y I;  2OTL Z;  1Q7Y 2;  2NVY I;  3CD6 Z;  3KIF A;  1SIW A;  4A3F I;  3IR7 A;  2NAP A;  1Q81 1;  3U50 C;  3J81 f;  1TWH I;  2JA5 I;  3MON A;  3NFZ A;  1YJN 1;  5CM2 M;  3CCV 1;  3T4N B;  3G6E Z;  3FKI I;  3CCQ Z;  2EGT A;  2VUM I;  1TWF I;  1Q86 2;  3CCM Z;  3OW2 Y;  5IT9 b;  3PO3 S;  1YIJ 1;  1S72 Z;  1YIT Z;  5C44 I;  2VF1 A;  4E32 A;  2RBL A;  2O4H A;  1VQ6 1;  1VQM 1;  1KQS Z;  1VQ4 Z;  4E31 A;  1JJ2 Z;  4CL1 A;  4A3I I;  2W04 A;  3HOZ I;  1YJ9 1;  2IZ3 A;  4S1T A;  1Y1W I;  1YHQ Z;  3P5J B;  1Z02 A;  1TWA I;  2NVQ I;  1NJI 1;  1VQ9 1;  1K73 2;  3CC7 1;  2H85 A;  3CCJ 1;  1YJW Z;  4NB9 A;  5C4J I;  1TWG I;  2R92 I;  1VQL 1;  2OOY B;  1R9T I;  1ZH1 A;  2LIY A;  3I56 Z;  2QEX 1;  3S1Q I;  4DGL A;  2HU9 A;  3GKQ A;  4MRI A;  5A2Q b;  1DL6 A;  1RO0 A;  3MZK B;  1ZB8 A;  3CCL 1;  2JR6 A;  4HH4 A;  1M1K 2;  2NVX I;  3RZO I;  1VQK 1;  2JUB A;  3GCF A;  3GTM I;  4E33 A;  5A2Q f;  3NH4 A;  1WII A;  1VQO 1;  4A3B I;  1VQ5 1;  1K9M 2;  2IV2 X;  1VQ7 Z;  4DK1 A;  4E2Z A;  3GTQ I;  2PMZ A;  3IF8 A;  3S14 I;  2M6N A;  4NH1 C;  1VLA A;  1ML8 A;  3G4S Z;  2V8J A;  1N8R 1;  4RS4 A;  5D1O B;  3J80 b;  3I55 1;  1W2B Y;  2K3R A;  3CMA 1;  2JIR A;  3CCE Z;  3G71 Z;  4NBH A;  4A3J I;  3D2L A;  1ZB9 A;  4NBA A;  3J81 b;  2LEX A;  3J80 f;  2E2I I;  1NP6 A;  2QR1 B;  4NBF A;  1TWC I;  1W2B Z;  1PFT A;  3GTJ I;  3CCR Z;  2AYD A;  2R6M A;  4EWC A;  2VPW A;  4RVG A;  2VPY A;  1I50 I;  3S2H I;  4HGZ A;  1I6H I;  1Q16 A;  1QVG Y;  1Q82 2;  4A3M I;  4NOZ A;  3VB9 A;  1K8A 2;  1YUK A;  3S1N I;  3HOX I;  5T6B A;  2E2H I;  2AKL A;  3CCS Z;  2VPZ A;  1VQ8 Z;  5FLM I;  5D1P A;  2QRE B;  2O53 A;  4NFR A;  3GTO I;  1USP A;  2I3C A;  1YJ9 Z;  1KD1 2;  2NVT I;  3K7A I;  1LQL A;  3OW2 Z;  2M48 A;  2OTJ 1;  1USP B;  3F3P C;  3I07 A;  4E2X A;  1VQN Z;  1VQ9 Z;  3NDI A;  2E7Z A;  5IP7 I;  1WZN A;  2BJO A;  4BY7 I;  3CC2 Z;  3JAM f;  3GTL I;  4DQY B;  2JIM A;  2RPR A;  3S16 I;  4MON A;  1QVF Y;  4NBC A;  3GTM S;  4A3C I;  1RO2 A;  1S72 1;  2QEX Z;  1I3Q I;  3VTN A;  1K9M 1;  1Q81 2;  3PO2 I;  3CCL Z;  1VQ4 1;  1VQK Z;  4E2Y A;  2WAQ A;  2QKD A;  4AYB A;  3RZD I;  1QVF Z;  1NUI A;  2JA6 I;  2Y0S A;  3LUS A;  2Q51 A;  1YHQ 1;  3GTK I;  1KC8 1;  5AN9 F;  1JWH C;  2JIQ A;  4A3L I;  1YI2 Z;  2B63 I;  3NH5 A;  2P3Y A;  4NB8 A;  1VQP Z;  2QA4 Z;  1X3W A;  2GTI A;  2G2K A;  3IX0 A;  1L1O C;  3CC4 Z;  4RVF A;  1Q7Y 1;  2JA7 I;  3F3F C;  2ZAE B;  3VMH A;  5T67 A;  3I56 1;  3J7A 4;  1QYP A;  5D1O A;  3CQZ I;  4MD8 A;  2PM9 A;  4RVH A;  3CME Z;  4BBS I;  1Q86 1;  1NJI 2;  2E2J I;  3CPW Y;  2Q4Z A;  1WCM I;  3H3V J;  5IP9 I;  2P28 A;  2DE5 A;  4RVD A;  4MXU A;  3ESW A;  2V8I A;  3S17 I;  2YU9 I;  2V45 A;  1RNI A;  2VUG A;  1YJN Z;  3CCU 1;  3CCV Z;  4BBR I;  5C3E I;  2QLV B;  2WB1 A;  1SFO I;  4NBE A;  1YIJ Z;  3HOV I;  2QRD B;  3G4S 1;  3EED A;  4XX2 A;  2HF1 A;  2E9H A;  1S7M A;  1N2F A;  2V8K A;  1VQ6 Z;  2JIP A;  4MD9 A;  1VQM Z;  2K5R A;  1K73 1;  1RLY A;  3H0G I;  3M4O I;  1WJ2 A;  3QWU A;  3CCE 1;  4A93 I;  3G71 1;  2OTJ Z;  2DE7 A;  2OZK A;  1Z01 A;  1M90 2;  1FDI A;  4A3G I;  1Y1V I;  3FQM A;  3HOY I;  3I4M I;  3FQQ A;  3D9X A;  1QVG Z;  3Q87 A;  1KQS Y;  4NBB A;  1N8R 2;  5LL6 f;  3JAM b;  4QTU A;  2OTL 1;  4A3D I;  3CD6 1;  1JJ2 Y;  1M1K 1;  3CCR 1;  4BY1 I;  3GTP I;  2R7Z I;  2DE6 A;  3TE5 B;  3G6E 1;  2OOX B;  3CC7 Z;  3CCQ 1;  4QTT A;  3CCJ Z;  2QRC B;  5IT9 f;  4Y7N I;  3CCM 1;  2F4M A;  1VQL Z;  2V3V A;  1WW9 A;  3CCS 1;  2W03 A;  4E30 A;  1YIT 1;  3NH8 A;  1VQ8 1;  1P9N A;  3GTG I;  1RQF A;  2IZ4 A;  2GTH A;  1X0T A;  3NDJ A;  3PO3 I;  2J6A A;  2JA8 I;  4A3K I;  1VQN 1;  1QXF A;  3BG1 B;  3CC2 1;  1VQO Z;  5T64 A;  1VQ5 Z;  3KIH A;  2F4O A;  3MZL B;  3HKZ A;  3D6W A;  2RT9 A;  1FDO A;  1YJW 1;  2JMO A;  4Y52 I;  3VMI A;  4MD7 A; 
#chains in the Genus database with same CATH homology
 3I55 Z;  4A3E I;  3CMA Z;  2LFU A;  2JNY A;  4X6A I;  1RO4 A;  3EER A;  1Q82 1;  2PK7 A;  1K8A 1;  1KRL A;  3S1M I;  4NBG A;  3CCU Z;  5C4X I;  3HOW I;  3S1R I;  2KPI A;  4E2W A;  1X3Z A;  1M90 1;  4HGY A;  1K83 I;  2KI7 B;  2GU2 A;  1YI2 1;  4BXX I;  2R93 I;  5FLX b;  3CXC Y;  1VQP 1;  1KD1 1;  2QA4 1;  3CPW Z;  4NBD A;  3BG0 B;  1QF8 A;  3IFU A;  3CC4 1;  3HOU I;  3S15 I;  1Y1V S;  2JS4 A;  3TDH B;  1VQ7 1;  5FLX f;  2RIQ A;  2RHB A;  1Z03 A;  2YAD A;  3CXC Z;  3CME 1;  1KC8 2;  1TFI A;  4RV9 A;  3I4N I;  4MH4 A;  3S2D I;  4TNU A;  1YUA A;  3VMG A;  3M3Y I;  2OTL Z;  1Q7Y 2;  2NVY I;  3CD6 Z;  3KIF A;  1Q81 1;  4A3F I;  3U50 C;  3J81 f;  1TWH I;  2JA5 I;  3MON A;  3NFZ A;  1YJN 1;  5CM2 M;  3CCV 1;  3T4N B;  3G6E Z;  3FKI I;  3CCQ Z;  2EGT A;  2VUM I;  1TWF I;  1Q86 2;  3CCM Z;  3OW2 Y;  5IT9 b;  3PO3 S;  1YIJ 1;  1S72 Z;  1YIT Z;  5C44 I;  2VF1 A;  4E32 A;  2RBL A;  2O4H A;  1VQ6 1;  1VQM 1;  1KQS Z;  1VQ4 Z;  4E31 A;  1JJ2 Z;  4CL1 A;  4A3I I;  2W04 A;  3HOZ I;  1YJ9 1;  2IZ3 A;  4S1T A;  1Y1W I;  1YHQ Z;  3P5J B;  1Z02 A;  1TWA I;  2NVQ I;  1NJI 1;  1VQ9 1;  1K73 2;  3CC7 1;  2H85 A;  3CCJ 1;  1YJW Z;  4NB9 A;  5C4J I;  1TWG I;  2R92 I;  1VQL 1;  2OOY B;  1R9T I;  1ZH1 A;  2LIY A;  3I56 Z;  2QEX 1;  3S1Q I;  4DGL A;  2HU9 A;  3GKQ A;  4MRI A;  5A2Q b;  1DL6 A;  1RO0 A;  3MZK B;  1ZB8 A;  3CCL 1;  2JR6 A;  4HH4 A;  1M1K 2;  2NVX I;  3RZO I;  1VQK 1;  2JUB A;  3GCF A;  3GTM I;  4E33 A;  5A2Q f;  3NH4 A;  1WII A;  1VQO 1;  4A3B I;  1VQ5 1;  1K9M 2;  1VQ7 Z;  4DK1 A;  4E2Z A;  3GTQ I;  2PMZ A;  3IF8 A;  3S14 I;  2M6N A;  4NH1 C;  1VLA A;  1ML8 A;  3G4S Z;  2V8J A;  1N8R 1;  4RS4 A;  5D1O B;  3J80 b;  3I55 1;  1W2B Y;  2K3R A;  3CMA 1;  3CCE Z;  4NBH A;  3G71 Z;  4A3J I;  1ZB9 A;  4NBA A;  3J81 b;  3J80 f;  2E2I I;  1NP6 A;  2QR1 B;  4NBF A;  1TWC I;  1W2B Z;  1PFT A;  3GTJ I;  3CCR Z;  2R6M A;  4EWC A;  4RVG A;  1I50 I;  3S2H I;  4HGZ A;  1I6H I;  1QVG Y;  1Q82 2;  4A3M I;  4NOZ A;  3VB9 A;  1K8A 2;  1YUK A;  3S1N I;  3HOX I;  5T6B A;  2E2H I;  2AKL A;  3CCS Z;  1VQ8 Z;  5FLM I;  5D1P A;  2QRE B;  2O53 A;  4NFR A;  3GTO I;  1USP A;  2I3C A;  1YJ9 Z;  1KD1 2;  2NVT I;  3K7A I;  1LQL A;  3OW2 Z;  2M48 A;  2OTJ 1;  1USP B;  3F3P C;  3I07 A;  4E2X A;  1VQN Z;  1VQ9 Z;  3NDI A;  5IP7 I;  2BJO A;  4BY7 I;  3CC2 Z;  3JAM f;  3GTL I;  4DQY B;  3S16 I;  2RPR A;  4MON A;  1QVF Y;  4NBC A;  3GTM S;  4A3C I;  1RO2 A;  1S72 1;  2QEX Z;  1I3Q I;  3VTN A;  1K9M 1;  1Q81 2;  3PO2 I;  3CCL Z;  1VQ4 1;  1VQK Z;  4E2Y A;  2WAQ A;  2QKD A;  4AYB A;  3RZD I;  1QVF Z;  1NUI A;  2JA6 I;  2Y0S A;  3LUS A;  2Q51 A;  1YHQ 1;  3GTK I;  1KC8 1;  5AN9 F;  1JWH C;  4A3L I;  1YI2 Z;  2B63 I;  3NH5 A;  2P3Y A;  4NB8 A;  1VQP Z;  2QA4 Z;  1X3W A;  2GTI A;  2G2K A;  3IX0 A;  1L1O C;  3CC4 Z;  4RVF A;  1Q7Y 1;  2JA7 I;  3F3F C;  2ZAE B;  3VMH A;  5T67 A;  3I56 1;  3J7A 4;  1QYP A;  5D1O A;  3CQZ I;  4MD8 A;  2PM9 A;  4RVH A;  3CME Z;  4BBS I;  1Q86 1;  1NJI 2;  2E2J I;  3CPW Y;  2Q4Z A;  1WCM I;  3H3V J;  5IP9 I;  2P28 A;  2DE5 A;  4RVD A;  4MXU A;  3ESW A;  2V8I A;  3S17 I;  2YU9 I;  1RNI A;  2VUG A;  1YJN Z;  3CCU 1;  3CCV Z;  4BBR I;  5C3E I;  2QLV B;  2WB1 A;  1SFO I;  4NBE A;  1YIJ Z;  3HOV I;  2QRD B;  3G4S 1;  3EED A;  4XX2 A;  2HF1 A;  2E9H A;  1S7M A;  1N2F A;  2V8K A;  1VQ6 Z;  1VQM Z;  4MD9 A;  2K5R A;  1K73 1;  1RLY A;  3H0G I;  3M4O I;  3QWU A;  3CCE 1;  4A93 I;  3G71 1;  2OTJ Z;  2DE7 A;  2OZK A;  1Z01 A;  1M90 2;  4A3G I;  1Y1V I;  3FQM A;  3HOY I;  3I4M I;  3FQQ A;  3D9X A;  1QVG Z;  3Q87 A;  1KQS Y;  4NBB A;  1N8R 2;  5LL6 f;  3JAM b;  4QTU A;  2OTL 1;  4A3D I;  3CD6 1;  1JJ2 Y;  1M1K 1;  3CCR 1;  4BY1 I;  3GTP I;  2R7Z I;  2DE6 A;  3TE5 B;  3G6E 1;  2OOX B;  3CC7 Z;  3CCQ 1;  4QTT A;  3CCJ Z;  2QRC B;  5IT9 f;  4Y7N I;  3CCM 1;  2F4M A;  1VQL Z;  1WW9 A;  3CCS 1;  2W03 A;  4E30 A;  1YIT 1;  3NH8 A;  1VQ8 1;  1P9N A;  3GTG I;  1RQF A;  2IZ4 A;  2GTH A;  1X0T A;  3NDJ A;  3PO3 I;  2J6A A;  2JA8 I;  4A3K I;  1VQN 1;  3BG1 B;  3CC2 1;  1VQO Z;  5T64 A;  1VQ5 Z;  3KIH A;  2F4O A;  3MZL B;  3HKZ A;  3D6W A;  2RT9 A;  1YJW 1;  2JMO A;  4Y52 I;  3VMI A;  4MD7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...