3GTPI

Backtracked rna polymerase ii complex with 24mer rna
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
total genus 8
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtpI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtpI02
1Y1VS 1LQLA 4NBBA 3RZDI 3M3YI 2F4OA 4NBCA 1PFTA 1QYPA 5C3EI 3S2DI 3HOUI 1DL6A 3H0GI 1N2FA 4NOZA 4XX2A 1ZB8A 2VUMI 2K5RA 1TWCI 3S17I 5CM2M 2B63I 3GTQI 2R7ZI 4A3CI 3VMHA 1USPA 3VMGA 1TWFI 4NBGA 4QTUA 4BY1I 3GTMS 3GTJI 2PK7A 4A3BI 4A3JI 4Y52I 1Y1VI 2NVYI 2HF1A 3S1NI 1Y1WI 3S2HI 3GTPI 4X6AI 4NBHA 4A3EI 4NBEA 4A3KI 4BY7I 3I4NI 3PO2I 3VMIA 1TWHI 4A3II 3D6WA 2E2II 2JA8I 1X3WA 4QTTA 1YUAA 3S15I 3HOVI 3M4OI 1VLAA 2DE5A 3GTMI 3HOZI 2JS4A 4MH4A 5IP7I 1K83I 3S16I 1TWAI 3K7AI 2E2JI 1X3ZA 3GKQA 3HOYI 2NVQI 2NVTI 1ZB9A 3LUSA 1RO4A 3GTKI 1WW9A 4A3FI 5C4XI 2JNYA 5C4JI 1I50I 1ML8A 4NBAA 4Y7NI 2JA5I 3GTOI 2E2HI 1RLYA 4A3LI 2P3YA 1TFIA 3VB9A 3ESWA 3HOWI 3S1RI 3EERA 4A3DI 4A3MI 3I4MI 2JR6A 2YU9I 3RZOI 2NVXI 3PO3I 4BBSI 2DE7A 2F4MA 1SFOI 4NBFA 5IP9I 3FKII 3S1QI 3PO3S 1R9TI 3U50C 3HOXI 4A3GI 2DE6A 2J6AA 3GCFA 5FLMI 4NB8A 2BJOA 2JA7I 1I6HI 4BBRI 2RBLA 3I07A 5C44I 2AKLA 2JA6I 2R92I 3GTLI 4A93I 3GTGI 4BXXI 2KPIA 3Q87A 3CQZI 1I3QI 3H3VJ 1NUIA 2R93I 4NB9A 3S1MI 3S14I 4NBDA 1L1OC 1WCMI 1TWGI 1USPB
chains in the Genus database with same CATH superfamily
3CD6Z 4NBBA 1VQOZ 3M3YI 2IZ4A 3IX0A 1PFTA 3H0GI 4XX2A 4NOZA 3G6EZ 4RVGA 2OTL1 1K8A2 2LFUA 3GTQI 2R7ZI 4A3CI 3VMHA 4NBGA 1KC81 4Y52I 1KD12 2NVYI 2HF1A 1RO0A 4X6AI 2R6MA 1M1K2 4A3KI 3I4NI 3CD61 2AYDA 1VQO1 4A3II 5IT9f 3CCMZ 4RVFA 2WAQA 2JIQA 1YUAA 3J7A4 2OOXB 1VQ51 3M4OI 3G6E1 3S16I 1VQPZ 3J80f 2QRCB 3J81b 3IFUA 1JWHC 2O4HA 3HKZA 2JIMA 2IZ3A 1QXFA 3MZLB 2JA5I 1QVFZ 4E2XA 1RLYA 2QA4Z 1VQM1 3JAMf 3VB9A 1X0TA 3ESWA 2W03A 2GU2A 1VQP1 3EERA 4HH4A 1VQ8Z 1QVFY 3RZOI 2NVXI 4BBSI 2V8KA 1K8A1 2F4MA 4NBFA 3S1QI 3U50C 1Q16A 4A3GI 1RQFA 2BJOA 2LEXA 4BBRI 2VPZA 3KIHA 3GTLI 1YJ91 2QA41 3GTGI 2K3RA 1KC82 3FQQA 3BG0B 1S7MA 1NUIA 2R93I 2QEX1 1YJN1 1WCMI 2OTJ1 1K731 5FLXb 1W2BZ 3VTNA 1LQLA 1DL6A 1W2BY 2RHBA 4MD8A 1VQLZ 2GTHA 2K5RA 1TWCI 4DK1A 2V45A 2P28A 1Z02A 2E7ZA 4NFRA 4BY1I 4QTUA 4S1TA 4A3BI 3CC2Z 1YIJ1 1S72Z 3NDJA 3S2HI 2VUGA 3GTPI 3P5JB 4NBHA 4A3EI 4NBEA 4BY7I 2OOYB 3CCEZ 3EEDA 2JA8I 2PM9A 1M901 3J81f 1Q861 2JIRA 3I551 1Z03A 1VQ7Z 3K7AI 3I56Z 1NP6A 1X3ZA 3GKQA 3HOYI 3CC21 1YITZ 2QR1B 1VQKZ 1S721 2QKDA 1WW9A 2O53A 5T6BA 3CCE1 5LL6f 2OZKA 4NBAA 2GTIA 3GTOI 2E2HI 4A3LI 1VQ6Z 3D9XA 3S1RI 3I561 1RNIA 2JIPA 3PO3I 2QREB 1YIT1 1K732 2DE7A 4HGYA 4AYBA 1VQK1 1R9TI 3NH8A 5A2Qb 2DE6A 1VQ9Z 4NB8A 1WIIA 4RVDA 1YUKA 5C44I 3CCM1 2AKLA 2JA6I 5FLXf 4A93I 4BXXI 2KPIA 1Q821 2RPRA 2Y0SA 4NB9A 1YI2Z 1K9M1 3S1MI 2Q4ZA 3S14I 1KRLA 2V8IA 4MONA 3CC7Z 1M902 1USPB 2JUBA 1VQ91 1Q862 1YJWZ 2F4OA 3S2DI 3CCQZ 3IF8A 1N2FA 3MONA 3S17I 2KI7B 5CM2M 2B63I 1VQ81 3VMGA 1TWFI 1RO2A 3GTJI 2JIOA 2VPYA 3CMAZ 2QLVB 1Y1WI 3G4SZ 1FDIA 3CC71 3IR7A 1Q7Y2 3PO2I 1TWHI 1YJW1 3CCQ1 5D1OA 1P9NA 1X3WA 4QTTA 4E2ZA 1VLAA 3CMEZ 2JS4A 5IP7I 1K83I 1TWAI 1NJI1 3CCUZ 5D1OB 2NVQI 3TE5B 2NVTI 3CMA1 5D1PA 1ZB9A 4EWCA 1RO4A 4RS4A 3G4S1 2VF1A 4E32A 3GTKI 2ZAEB 2JNYA 5C4JI 1QF8A 3G71Z 2M6NA 1VQ4Z 4E2YA 1YHQZ 1TFIA 1Y8CA 5A2Qf 3CME1 1Q822 1VQL1 3HOWI 1K9M2 4A3DI 3F3PC 3I4MI 2JR6A 4MRIA 1Z01A 2QRDB 5IP9I 1VQNZ 3PO3S 3HOXI 4MD9A 3QWUA 4E30A 4E2WA 2LIYA 1Q811 2JA7I 3G711 1I6HI 1Q7Y1 3I07A 1VQ41 1VQ5Z 1YHQ1 2W04A 2NAPA 3CQZI 3Q87A 3OW2Z 1VQ71 3H3VJ 2JMOA 1WJ2A 2RT9A 2WB1A 1L1OC 4CL1A 3CCSZ 1KQSZ 5T64A 4E33A 3OW2Y 1VQN1 2G2KA 2R92I 1Y1VS 1KQSY 3RZDI 4NBCA 2E9HA 1QYPA 2VPWA 3NFZA 5C3EI 3HOUI 5T67A 1VQMZ 1ZB8A 2V3VA 2VUMI 3CCVZ 1NJI2 1VQ61 4RV9A 1USPA 2VPXA 3GTMS 2PK7A 4A3JI 3CCS1 1Y1VI 3S1NI 3MZKB 1N8R1 3VMIA 1SIWA 2RIQA 3CCLZ 3D6WA 2E2II 1YJ9Z 3S15I 3HOVI 4NH1C 1ZH1A 3BG1B 2DE5A 3GTMI 3HOZI 3CCV1 4MH4A 3CPWZ 2E2JI 2M48A 3CXCZ 2QEXZ 1YJNZ 2IV2X 3CC4Z 1WZNA 1YI21 3LUSA 5IT9b 3CPWY 2OTJZ 3TDHB 3CXCY 3CCJZ 4A3FI 5C4XI 1Q812 1KD11 3J80b 1I50I 3CCL1 1ML8A 1AA6A 4Y7NI 1M1K1 2P3YA 2EGTA 1FDOA 4MXUA 5AN9F 2PMZA 4A3MI 3NH4A 2YU9I 2YADA 1YIJZ 4HGZA 3CC41 3FQMA 1SFOI 3CCRZ 3FKII 3CCJ1 3JAMb 3NH5A 4RVHA 2J6AA 3F3FC 3GCFA 5FLMI 2RBLA 1QVGZ 3KIFA 3I55Z 1JJ2Z 4MD7A 3NDIA 2V8JA 4E31A 2OTLZ 2H85A 1I3QI 2I3CA 4TNUA 1QVGY 4DGLA 2HU9A 2Q51A 1JJ2Y 3CCU1 4NBDA 1N8R2 1TWGI 4DQYB 3T4NB 3CCR1 3D2LA
chains in the Genus database with same CATH topology
3CD6Z 4NBBA 1VQOZ 3M3YI 2IZ4A 3IX0A 1PFTA 3H0GI 4XX2A 4NOZA 3G6EZ 4RVGA 2OTL1 1K8A2 2LFUA 3GTQI 2R7ZI 4A3CI 3VMHA 4NBGA 1KC81 4Y52I 1KD12 2NVYI 2HF1A 1RO0A 4X6AI 2R6MA 1M1K2 4A3KI 3I4NI 3CD61 1VQO1 4A3II 5IT9f 3CCMZ 4RVFA 2WAQA 1YUAA 3J7A4 2OOXB 1VQ51 3M4OI 3G6E1 3S16I 1VQPZ 3J80f 2QRCB 3J81b 3IFUA 1JWHC 2O4HA 3HKZA 2IZ3A 3MZLB 2JA5I 1QVFZ 4E2XA 1RLYA 2QA4Z 1VQM1 3JAMf 3VB9A 1X0TA 3ESWA 2W03A 2GU2A 1VQP1 3EERA 4HH4A 1VQ8Z 1QVFY 3RZOI 2NVXI 4BBSI 2V8KA 1K8A1 2F4MA 4NBFA 3S1QI 3U50C 4A3GI 1RQFA 2BJOA 4BBRI 3KIHA 3GTLI 1YJ91 2QA41 3GTGI 2K3RA 1KC82 3FQQA 3BG0B 1S7MA 1NUIA 2R93I 2QEX1 1YJN1 1WCMI 2OTJ1 1K731 5FLXb 1W2BZ 3VTNA 1LQLA 1DL6A 1W2BY 2RHBA 4MD8A 1VQLZ 2GTHA 2K5RA 1TWCI 4DK1A 2P28A 1Z02A 4NFRA 4BY1I 4QTUA 4S1TA 4A3BI 3CC2Z 1YIJ1 1S72Z 3NDJA 3S2HI 2VUGA 3GTPI 3P5JB 4NBHA 4A3EI 4NBEA 4BY7I 2OOYB 3CCEZ 3EEDA 2JA8I 2PM9A 1M901 3J81f 1Q861 3I551 1Z03A 1VQ7Z 3K7AI 3I56Z 1NP6A 1X3ZA 3GKQA 3HOYI 3CC21 1YITZ 2QR1B 1VQKZ 1S721 2QKDA 1WW9A 2O53A 5T6BA 3CCE1 5LL6f 2OZKA 4NBAA 2GTIA 3GTOI 2E2HI 4A3LI 1VQ6Z 3S1RI 3D9XA 3I561 1RNIA 3PO3I 2QREB 1YIT1 1K732 2DE7A 4HGYA 4AYBA 1VQK1 1R9TI 3NH8A 5A2Qb 2DE6A 1VQ9Z 4NB8A 1WIIA 4RVDA 1YUKA 5C44I 3CCM1 2AKLA 2JA6I 5FLXf 4A93I 4BXXI 2KPIA 1Q821 2RPRA 2Y0SA 4NB9A 1YI2Z 1K9M1 3S1MI 2Q4ZA 3S14I 1KRLA 2V8IA 4MONA 3CC7Z 1M902 1USPB 2JUBA 1VQ91 1Q862 1YJWZ 2F4OA 3S2DI 3CCQZ 3IF8A 1N2FA 3MONA 3S17I 2KI7B 5CM2M 2B63I 1VQ81 3VMGA 1TWFI 1RO2A 3GTJI 3CMAZ 2QLVB 1Y1WI 3G4SZ 3CC71 1Q7Y2 3PO2I 1TWHI 1YJW1 3CCQ1 5D1OA 1P9NA 1X3WA 4QTTA 4E2ZA 1VLAA 3CMEZ 2JS4A 5IP7I 1K83I 1TWAI 1NJI1 3CCUZ 5D1OB 2NVQI 3TE5B 2NVTI 3CMA1 5D1PA 1ZB9A 4EWCA 1RO4A 4RS4A 3G4S1 2VF1A 4E32A 3GTKI 2ZAEB 2JNYA 5C4JI 1QF8A 3G71Z 2M6NA 1VQ4Z 4E2YA 1YHQZ 1TFIA 5A2Qf 1Q822 3CME1 1VQL1 3HOWI 1K9M2 4A3DI 3F3PC 3I4MI 2JR6A 4MRIA 1Z01A 2QRDB 5IP9I 1VQNZ 3PO3S 3HOXI 4MD9A 3QWUA 4E30A 4E2WA 2LIYA 1Q811 2JA7I 3G711 1I6HI 1Q7Y1 3I07A 1VQ41 1VQ5Z 1YHQ1 2W04A 3Q87A 3CQZI 3OW2Z 1VQ71 3H3VJ 2JMOA 2RT9A 2WB1A 1L1OC 4CL1A 3CCSZ 1KQSZ 5T64A 4E33A 3OW2Y 1VQN1 2G2KA 2R92I 1Y1VS 1KQSY 3RZDI 4NBCA 2E9HA 1QYPA 3NFZA 5C3EI 3HOUI 5T67A 1VQMZ 1ZB8A 2VUMI 3CCVZ 1NJI2 1VQ61 4RV9A 1USPA 3GTMS 2PK7A 4A3JI 3CCS1 1Y1VI 3S1NI 3MZKB 1N8R1 3VMIA 3CCLZ 2RIQA 3D6WA 2E2II 1YJ9Z 3S15I 3HOVI 4NH1C 1ZH1A 3BG1B 2DE5A 3GTMI 3HOZI 3CCV1 4MH4A 3CPWZ 2E2JI 2M48A 3CXCZ 2QEXZ 1YJNZ 3CC4Z 1YI21 3LUSA 5IT9b 3CPWY 2OTJZ 3TDHB 3CXCY 3CCJZ 4A3FI 5C4XI 1Q812 1KD11 3J80b 1I50I 3CCL1 1ML8A 4Y7NI 1M1K1 2P3YA 2EGTA 4MXUA 5AN9F 2PMZA 4A3MI 3NH4A 2YU9I 2YADA 1YIJZ 4HGZA 3CC41 3FQMA 1SFOI 3CCRZ 3FKII 3CCJ1 3JAMb 3NH5A 4RVHA 2J6AA 3F3FC 3GCFA 5FLMI 2RBLA 1QVGZ 3KIFA 3I55Z 1JJ2Z 4MD7A 3NDIA 2V8JA 4E31A 2OTLZ 2H85A 1I3QI 2I3CA 4TNUA 1QVGY 4DGLA 2HU9A 2Q51A 1JJ2Y 3CCU1 4NBDA 1N8R2 1TWGI 4DQYB 3T4NB 3CCR1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1V S;  1LQL A;  4NBB A;  3RZD I;  3M3Y I;  2F4O A;  4NBC A;  1PFT A;  1QYP A;  5C3E I;  3S2D I;  3HOU I;  1DL6 A;  3H0G I;  1N2F A;  4NOZ A;  4XX2 A;  1ZB8 A;  2VUM I;  2K5R A;  1TWC I;  3S17 I;  5CM2 M;  2B63 I;  3GTQ I;  2R7Z I;  4A3C I;  3VMH A;  1USP A;  3VMG A;  1TWF I;  4NBG A;  4QTU A;  4BY1 I;  3GTM S;  3GTJ I;  2PK7 A;  4A3B I;  4A3J I;  4Y52 I;  1Y1V I;  2NVY I;  2HF1 A;  3S1N I;  1Y1W I;  3S2H I;  3GTP I;  4X6A I;  4NBH A;  4A3E I;  4NBE A;  4A3K I;  4BY7 I;  3I4N I;  3PO2 I;  3VMI A;  1TWH I;  4A3I I;  3D6W A;  2E2I I;  2JA8 I;  1X3W A;  4QTT A;  1YUA A;  3S15 I;  3HOV I;  3M4O I;  1VLA A;  2DE5 A;  3GTM I;  3HOZ I;  2JS4 A;  4MH4 A;  5IP7 I;  1K83 I;  3S16 I;  1TWA I;  3K7A I;  2E2J I;  1X3Z A;  3GKQ A;  3HOY I;  2NVQ I;  2NVT I;  1ZB9 A;  3LUS A;  1RO4 A;  3GTK I;  1WW9 A;  4A3F I;  5C4X I;  2JNY A;  5C4J I;  1I50 I;  1ML8 A;  4NBA A;  4Y7N I;  2JA5 I;  3GTO I;  2E2H I;  1RLY A;  4A3L I;  2P3Y A;  1TFI A;  3VB9 A;  3ESW A;  3HOW I;  3S1R I;  3EER A;  4A3D I;  4A3M I;  3I4M I;  2JR6 A;  2YU9 I;  3RZO I;  2NVX I;  3PO3 I;  4BBS I;  2DE7 A;  2F4M A;  1SFO I;  4NBF A;  5IP9 I;  3FKI I;  3S1Q I;  3PO3 S;  1R9T I;  3U50 C;  3HOX I;  4A3G I;  2DE6 A;  2J6A A;  3GCF A;  5FLM I;  4NB8 A;  2BJO A;  2JA7 I;  1I6H I;  4BBR I;  2RBL A;  3I07 A;  5C44 I;  2AKL A;  2JA6 I;  2R92 I;  3GTL I;  4A93 I;  3GTG I;  4BXX I;  2KPI A;  3Q87 A;  3CQZ I;  1I3Q I;  3H3V J;  1NUI A;  2R93 I;  4NB9 A;  3S1M I;  3S14 I;  4NBD A;  1L1O C;  1WCM I;  1TWG I;  1USP B; 
#chains in the Genus database with same CATH topology
 3CD6 Z;  4NBB A;  1VQO Z;  3M3Y I;  2IZ4 A;  3IX0 A;  1PFT A;  3H0G I;  4XX2 A;  4NOZ A;  3G6E Z;  4RVG A;  2OTL 1;  1K8A 2;  2LFU A;  3GTQ I;  2R7Z I;  4A3C I;  3VMH A;  4NBG A;  1KC8 1;  4Y52 I;  1KD1 2;  2NVY I;  2HF1 A;  1RO0 A;  4X6A I;  2R6M A;  1M1K 2;  4A3K I;  3I4N I;  3CD6 1;  2AYD A;  1VQO 1;  4A3I I;  5IT9 f;  3CCM Z;  4RVF A;  2WAQ A;  2JIQ A;  1YUA A;  3J7A 4;  2OOX B;  1VQ5 1;  3M4O I;  3G6E 1;  3S16 I;  1VQP Z;  3J80 f;  2QRC B;  3J81 b;  3IFU A;  1JWH C;  2O4H A;  3HKZ A;  2JIM A;  2IZ3 A;  1QXF A;  3MZL B;  2JA5 I;  1QVF Z;  4E2X A;  1RLY A;  2QA4 Z;  1VQM 1;  3JAM f;  3VB9 A;  1X0T A;  3ESW A;  2W03 A;  2GU2 A;  1VQP 1;  3EER A;  4HH4 A;  1VQ8 Z;  1QVF Y;  3RZO I;  2NVX I;  4BBS I;  2V8K A;  1K8A 1;  2F4M A;  4NBF A;  3S1Q I;  3U50 C;  1Q16 A;  4A3G I;  1RQF A;  2BJO A;  2LEX A;  4BBR I;  2VPZ A;  3KIH A;  3GTL I;  1YJ9 1;  2QA4 1;  3GTG I;  2K3R A;  1KC8 2;  3FQQ A;  3BG0 B;  1S7M A;  1NUI A;  2R93 I;  2QEX 1;  1YJN 1;  1WCM I;  2OTJ 1;  1K73 1;  5FLX b;  1W2B Z;  3VTN A;  1LQL A;  1DL6 A;  1W2B Y;  2RHB A;  4MD8 A;  1VQL Z;  2GTH A;  2K5R A;  1TWC I;  4DK1 A;  2V45 A;  2P28 A;  1Z02 A;  2E7Z A;  4NFR A;  4BY1 I;  4QTU A;  4S1T A;  4A3B I;  3CC2 Z;  1YIJ 1;  1S72 Z;  3NDJ A;  3S2H I;  2VUG A;  3GTP I;  3P5J B;  4NBH A;  4A3E I;  4NBE A;  4BY7 I;  2OOY B;  3CCE Z;  3EED A;  2JA8 I;  2PM9 A;  1M90 1;  3J81 f;  1Q86 1;  2JIR A;  3I55 1;  1Z03 A;  1VQ7 Z;  3K7A I;  3I56 Z;  1NP6 A;  1X3Z A;  3GKQ A;  3HOY I;  3CC2 1;  1YIT Z;  2QR1 B;  1VQK Z;  1S72 1;  2QKD A;  1WW9 A;  2O53 A;  5T6B A;  3CCE 1;  5LL6 f;  2OZK A;  4NBA A;  2GTI A;  3GTO I;  2E2H I;  4A3L I;  1VQ6 Z;  3D9X A;  3S1R I;  3I56 1;  1RNI A;  2JIP A;  3PO3 I;  2QRE B;  1YIT 1;  1K73 2;  2DE7 A;  4HGY A;  4AYB A;  1VQK 1;  1R9T I;  3NH8 A;  5A2Q b;  2DE6 A;  1VQ9 Z;  4NB8 A;  1WII A;  4RVD A;  1YUK A;  5C44 I;  3CCM 1;  2AKL A;  2JA6 I;  5FLX f;  4A93 I;  4BXX I;  2KPI A;  1Q82 1;  2RPR A;  2Y0S A;  4NB9 A;  1YI2 Z;  1K9M 1;  3S1M I;  2Q4Z A;  3S14 I;  1KRL A;  2V8I A;  4MON A;  3CC7 Z;  1M90 2;  1USP B;  2JUB A;  1VQ9 1;  1Q86 2;  1YJW Z;  2F4O A;  3S2D I;  3CCQ Z;  3IF8 A;  1N2F A;  3MON A;  3S17 I;  2KI7 B;  5CM2 M;  2B63 I;  1VQ8 1;  3VMG A;  1TWF I;  1RO2 A;  3GTJ I;  2JIO A;  2VPY A;  3CMA Z;  2QLV B;  1Y1W I;  3G4S Z;  1FDI A;  3CC7 1;  3IR7 A;  1Q7Y 2;  3PO2 I;  1TWH I;  1YJW 1;  3CCQ 1;  5D1O A;  1P9N A;  1X3W A;  4QTT A;  4E2Z A;  1VLA A;  3CME Z;  2JS4 A;  5IP7 I;  1K83 I;  1TWA I;  1NJI 1;  3CCU Z;  5D1O B;  2NVQ I;  3TE5 B;  2NVT I;  3CMA 1;  5D1P A;  1ZB9 A;  4EWC A;  1RO4 A;  4RS4 A;  3G4S 1;  2VF1 A;  4E32 A;  3GTK I;  2ZAE B;  2JNY A;  5C4J I;  1QF8 A;  3G71 Z;  2M6N A;  1VQ4 Z;  4E2Y A;  1YHQ Z;  1TFI A;  1Y8C A;  5A2Q f;  3CME 1;  1Q82 2;  1VQL 1;  3HOW I;  1K9M 2;  4A3D I;  3F3P C;  3I4M I;  2JR6 A;  4MRI A;  1Z01 A;  2QRD B;  5IP9 I;  1VQN Z;  3PO3 S;  3HOX I;  4MD9 A;  3QWU A;  4E30 A;  4E2W A;  2LIY A;  1Q81 1;  2JA7 I;  3G71 1;  1I6H I;  1Q7Y 1;  3I07 A;  1VQ4 1;  1VQ5 Z;  1YHQ 1;  2W04 A;  2NAP A;  3CQZ I;  3Q87 A;  3OW2 Z;  1VQ7 1;  3H3V J;  2JMO A;  1WJ2 A;  2RT9 A;  2WB1 A;  1L1O C;  4CL1 A;  3CCS Z;  1KQS Z;  5T64 A;  4E33 A;  3OW2 Y;  1VQN 1;  2G2K A;  2R92 I;  1Y1V S;  1KQS Y;  3RZD I;  4NBC A;  2E9H A;  1QYP A;  2VPW A;  3NFZ A;  5C3E I;  3HOU I;  5T67 A;  1VQM Z;  1ZB8 A;  2V3V A;  2VUM I;  3CCV Z;  1NJI 2;  1VQ6 1;  4RV9 A;  1USP A;  2VPX A;  3GTM S;  2PK7 A;  4A3J I;  3CCS 1;  1Y1V I;  3S1N I;  3MZK B;  1N8R 1;  3VMI A;  1SIW A;  2RIQ A;  3CCL Z;  3D6W A;  2E2I I;  1YJ9 Z;  3S15 I;  3HOV I;  4NH1 C;  1ZH1 A;  3BG1 B;  2DE5 A;  3GTM I;  3HOZ I;  3CCV 1;  4MH4 A;  3CPW Z;  2E2J I;  2M48 A;  3CXC Z;  2QEX Z;  1YJN Z;  2IV2 X;  3CC4 Z;  1WZN A;  1YI2 1;  3LUS A;  5IT9 b;  3CPW Y;  2OTJ Z;  3TDH B;  3CXC Y;  3CCJ Z;  4A3F I;  5C4X I;  1Q81 2;  1KD1 1;  3J80 b;  1I50 I;  3CCL 1;  1ML8 A;  1AA6 A;  4Y7N I;  1M1K 1;  2P3Y A;  2EGT A;  1FDO A;  4MXU A;  5AN9 F;  2PMZ A;  4A3M I;  3NH4 A;  2YU9 I;  2YAD A;  1YIJ Z;  4HGZ A;  3CC4 1;  3FQM A;  1SFO I;  3CCR Z;  3FKI I;  3CCJ 1;  3JAM b;  3NH5 A;  4RVH A;  2J6A A;  3F3F C;  3GCF A;  5FLM I;  2RBL A;  1QVG Z;  3KIF A;  3I55 Z;  1JJ2 Z;  4MD7 A;  3NDI A;  2V8J A;  4E31 A;  2OTL Z;  2H85 A;  1I3Q I;  2I3C A;  4TNU A;  1QVG Y;  4DGL A;  2HU9 A;  2Q51 A;  1JJ2 Y;  3CCU 1;  4NBD A;  1N8R 2;  1TWG I;  4DQY B;  3T4N B;  3CCR 1;  3D2L A; 
#chains in the Genus database with same CATH homology
 3CD6 Z;  4NBB A;  1VQO Z;  3M3Y I;  2IZ4 A;  3IX0 A;  1PFT A;  3H0G I;  4XX2 A;  4NOZ A;  3G6E Z;  4RVG A;  2OTL 1;  1K8A 2;  2LFU A;  3GTQ I;  2R7Z I;  4A3C I;  3VMH A;  4NBG A;  1KC8 1;  4Y52 I;  1KD1 2;  2NVY I;  2HF1 A;  1RO0 A;  4X6A I;  2R6M A;  1M1K 2;  4A3K I;  3I4N I;  3CD6 1;  1VQO 1;  4A3I I;  5IT9 f;  3CCM Z;  4RVF A;  2WAQ A;  1YUA A;  3J7A 4;  2OOX B;  1VQ5 1;  3M4O I;  3G6E 1;  3S16 I;  1VQP Z;  3J80 f;  2QRC B;  3J81 b;  3IFU A;  1JWH C;  2O4H A;  3HKZ A;  2IZ3 A;  3MZL B;  2JA5 I;  1QVF Z;  4E2X A;  1RLY A;  2QA4 Z;  1VQM 1;  3JAM f;  3VB9 A;  1X0T A;  3ESW A;  2W03 A;  2GU2 A;  1VQP 1;  3EER A;  4HH4 A;  1VQ8 Z;  1QVF Y;  3RZO I;  2NVX I;  4BBS I;  2V8K A;  1K8A 1;  2F4M A;  4NBF A;  3S1Q I;  3U50 C;  4A3G I;  1RQF A;  2BJO A;  4BBR I;  3KIH A;  3GTL I;  1YJ9 1;  2QA4 1;  3GTG I;  2K3R A;  1KC8 2;  3FQQ A;  3BG0 B;  1S7M A;  1NUI A;  2R93 I;  2QEX 1;  1YJN 1;  1WCM I;  2OTJ 1;  1K73 1;  5FLX b;  1W2B Z;  3VTN A;  1LQL A;  1DL6 A;  1W2B Y;  2RHB A;  4MD8 A;  1VQL Z;  2GTH A;  2K5R A;  1TWC I;  4DK1 A;  2P28 A;  1Z02 A;  4NFR A;  4BY1 I;  4QTU A;  4S1T A;  4A3B I;  3CC2 Z;  1YIJ 1;  1S72 Z;  3NDJ A;  3S2H I;  2VUG A;  3GTP I;  3P5J B;  4NBH A;  4A3E I;  4NBE A;  4BY7 I;  2OOY B;  3CCE Z;  3EED A;  2JA8 I;  2PM9 A;  1M90 1;  3J81 f;  1Q86 1;  3I55 1;  1Z03 A;  1VQ7 Z;  3K7A I;  3I56 Z;  1NP6 A;  1X3Z A;  3GKQ A;  3HOY I;  3CC2 1;  1YIT Z;  2QR1 B;  1VQK Z;  1S72 1;  2QKD A;  1WW9 A;  2O53 A;  5T6B A;  3CCE 1;  5LL6 f;  2OZK A;  4NBA A;  2GTI A;  3GTO I;  2E2H I;  4A3L I;  1VQ6 Z;  3S1R I;  3D9X A;  3I56 1;  1RNI A;  3PO3 I;  2QRE B;  1YIT 1;  1K73 2;  2DE7 A;  4HGY A;  4AYB A;  1VQK 1;  1R9T I;  3NH8 A;  5A2Q b;  2DE6 A;  1VQ9 Z;  4NB8 A;  1WII A;  4RVD A;  1YUK A;  5C44 I;  3CCM 1;  2AKL A;  2JA6 I;  5FLX f;  4A93 I;  4BXX I;  2KPI A;  1Q82 1;  2RPR A;  2Y0S A;  4NB9 A;  1YI2 Z;  1K9M 1;  3S1M I;  2Q4Z A;  3S14 I;  1KRL A;  2V8I A;  4MON A;  3CC7 Z;  1M90 2;  1USP B;  2JUB A;  1VQ9 1;  1Q86 2;  1YJW Z;  2F4O A;  3S2D I;  3CCQ Z;  3IF8 A;  1N2F A;  3MON A;  3S17 I;  2KI7 B;  5CM2 M;  2B63 I;  1VQ8 1;  3VMG A;  1TWF I;  1RO2 A;  3GTJ I;  3CMA Z;  2QLV B;  1Y1W I;  3G4S Z;  3CC7 1;  1Q7Y 2;  3PO2 I;  1TWH I;  1YJW 1;  3CCQ 1;  5D1O A;  1P9N A;  1X3W A;  4QTT A;  4E2Z A;  1VLA A;  3CME Z;  2JS4 A;  5IP7 I;  1K83 I;  1TWA I;  1NJI 1;  3CCU Z;  5D1O B;  2NVQ I;  3TE5 B;  2NVT I;  3CMA 1;  5D1P A;  1ZB9 A;  4EWC A;  1RO4 A;  4RS4 A;  3G4S 1;  2VF1 A;  4E32 A;  3GTK I;  2ZAE B;  2JNY A;  5C4J I;  1QF8 A;  3G71 Z;  2M6N A;  1VQ4 Z;  4E2Y A;  1YHQ Z;  1TFI A;  5A2Q f;  1Q82 2;  3CME 1;  1VQL 1;  3HOW I;  1K9M 2;  4A3D I;  3F3P C;  3I4M I;  2JR6 A;  4MRI A;  1Z01 A;  2QRD B;  5IP9 I;  1VQN Z;  3PO3 S;  3HOX I;  4MD9 A;  3QWU A;  4E30 A;  4E2W A;  2LIY A;  1Q81 1;  2JA7 I;  3G71 1;  1I6H I;  1Q7Y 1;  3I07 A;  1VQ4 1;  1VQ5 Z;  1YHQ 1;  2W04 A;  3Q87 A;  3CQZ I;  3OW2 Z;  1VQ7 1;  3H3V J;  2JMO A;  2RT9 A;  2WB1 A;  1L1O C;  4CL1 A;  3CCS Z;  1KQS Z;  5T64 A;  4E33 A;  3OW2 Y;  1VQN 1;  2G2K A;  2R92 I;  1Y1V S;  1KQS Y;  3RZD I;  4NBC A;  2E9H A;  1QYP A;  3NFZ A;  5C3E I;  3HOU I;  5T67 A;  1VQM Z;  1ZB8 A;  2VUM I;  3CCV Z;  1NJI 2;  1VQ6 1;  4RV9 A;  1USP A;  3GTM S;  2PK7 A;  4A3J I;  3CCS 1;  1Y1V I;  3S1N I;  3MZK B;  1N8R 1;  3VMI A;  3CCL Z;  2RIQ A;  3D6W A;  2E2I I;  1YJ9 Z;  3S15 I;  3HOV I;  4NH1 C;  1ZH1 A;  3BG1 B;  2DE5 A;  3GTM I;  3HOZ I;  3CCV 1;  4MH4 A;  3CPW Z;  2E2J I;  2M48 A;  3CXC Z;  2QEX Z;  1YJN Z;  3CC4 Z;  1YI2 1;  3LUS A;  5IT9 b;  3CPW Y;  2OTJ Z;  3TDH B;  3CXC Y;  3CCJ Z;  4A3F I;  5C4X I;  1Q81 2;  1KD1 1;  3J80 b;  1I50 I;  3CCL 1;  1ML8 A;  4Y7N I;  1M1K 1;  2P3Y A;  2EGT A;  4MXU A;  5AN9 F;  2PMZ A;  4A3M I;  3NH4 A;  2YU9 I;  2YAD A;  1YIJ Z;  4HGZ A;  3CC4 1;  3FQM A;  1SFO I;  3CCR Z;  3FKI I;  3CCJ 1;  3JAM b;  3NH5 A;  4RVH A;  2J6A A;  3F3F C;  3GCF A;  5FLM I;  2RBL A;  1QVG Z;  3KIF A;  3I55 Z;  1JJ2 Z;  4MD7 A;  3NDI A;  2V8J A;  4E31 A;  2OTL Z;  2H85 A;  1I3Q I;  2I3C A;  4TNU A;  1QVG Y;  4DGL A;  2HU9 A;  2Q51 A;  1JJ2 Y;  3CCU 1;  4NBD A;  1N8R 2;  1TWG I;  4DQY B;  3T4N B;  3CCR 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...