3GTPI

Backtracked rna polymerase ii complex with 24mer rna
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 8
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtpI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtpI02
4NBDA 1USPB 1ZB8A 4A3EI 3GTLI 3GTKI 1WCMI 2VUMI 3ESWA 5IP9I 1Y1WI 4BY7I 4NBHA 2JNYA 2K5RA 1RO4A 4NBBA 3HOYI 1NUIA 4A3MI 2JA6I 3S2DI 4NBEA 3GTPI 1WW9A 1TWAI 4BBSI 1TWGI 2E2II 4BY1I 5FLMI 4NB9A 5IP7I 3HOVI 3VMIA 1X3WA 1QYPA 2HF1A 4Y52I 2AKLA 3S1QI 1N2FA 2J6AA 3U50C 4MH4A 3VMGA 4BBRI 1TWHI 4A3LI 3GTMS 3S14I 3VB9A 2NVQI 4BXXI 3GTGI 4A3GI 3S15I 1LQLA 3LUSA 4NBAA 4NBFA 3HOWI 1TFIA 4QTUA 5CM2M 1SFOI 3S1NI 2RBLA 1R9TI 3RZDI 1ML8A 1I50I 3RZOI 3M4OI 4XX2A 3HOXI 3D6WA 3I4NI 4QTTA 5C4XI 3HOUI 4A3FI 4A93I 2NVXI 3H3VJ 4A3DI 5C44I 5C3EI 3VMHA 1I3QI 2F4OA 4Y7NI 1YUAA 2JR6A 1ZB9A 2NVYI 1Y1VS 1K83I 3PO3I 1TWFI 3PO3S 2KPIA 2JS4A 4NBCA 2F4MA 4A3JI 2R93I 4NOZA 2DE6A 1USPA 3EERA 2PK7A 2YU9I 3FKII 2R7ZI 2JA8I 3GKQA 3GTQI 1L1OC 2B63I 1PFTA 1I6HI 3S16I 3GTJI 2R92I 2P3YA 2BJOA 3S2HI 2E2HI 2E2JI 4NB8A 1Y1VI 2DE7A 4X6AI 2DE5A 2NVTI 1DL6A 3GCFA 3HOZI 3S1RI 1TWCI 1RLYA 4NBGA 2JA5I 1X3ZA 4A3KI 3H0GI 3Q87A 3GTMI 5C4JI 3M3YI 3S1MI 4A3CI 3K7AI 2JA7I 1VLAA 3CQZI 3I4MI 3I07A 3GTOI 4A3II 3S17I 3PO2I 4A3BI
chains in the Genus database with same CATH superfamily
4NBDA 3CC4Z 2ZAEB 3D9XA 3P5JB 3VTNA 2VUMI 3NDJA 4NBHA 5T67A 5FLXb 1YJW1 4NBBA 4A3MI 2JA6I 3S2DI 1ZH1A 3OW2Z 2G2KA 1WIIA 4HGZA 3CMEZ 2Q4ZA 3I55Z 3CCVZ 2OOYB 3S1QI 1Z02A 1VQ41 3U50C 2PM9A 4HH4A 1VQPZ 4E33A 4A3LI 1WZNA 3CCE1 2NVQI 2JIRA 4BXXI 1YHQ1 2RPRA 2VF1A 1TFIA 4TNUA 1KD11 3CPWZ 3S1NI 2GU2A 3KIFA 1RO0A 3HOXI 3CPWY 1W2BZ 3H3VJ 4A3DI 2V3VA 1VQL1 5T6BA 2QREB 3G6EZ 1YUAA 3CMA1 2JR6A 2NVYI 3J80b 1Y1VS 1VQ4Z 3CME1 2GTIA 1TWFI 2KPIA 2VPXA 4A3JI 4NOZA 1RO2A 1USPA 2R6MA 3NH8A 4RV9A 3G6E1 2IZ4A 1QXFA 1PFTA 3JAMf 3IF8A 2QA4Z 3GTJI 2QLVB 4E32A 4E2XA 2NVTI 3HOZI 5D1OB 1TWCI 2Q51A 2LEXA 2OTLZ 1X3ZA 4A3KI 5C4JI 4A3CI 2JA7I 4E2WA 5IT9b 1K732 1FDIA 4A3EI 3CCLZ 1NJI1 3GTKI 1WCMI 3ESWA 3F3FC 5IP9I 1AA6A 4RVHA 4BY7I 4MONA 4DGLA 5D1OA 5FLXf 3HOYI 1NUIA 1X0TA 4NBEA 1P9NA 3GTPI 3CC41 1VQ8Z 4RVGA 2YADA 1TWGI 4E2ZA 4BY1I 5FLMI 1YI2Z 1Q7Y2 1K9M1 1Z03A 3VMIA 1QYPA 3CCQZ 2JIPA 2JMOA 1S721 1VQKZ 1M1K1 3CC7Z 3CXCZ 2OOXB 2IV2X 3GTGI 4A3GI 4E30A 1LQLA 3LUSA 3I561 3CC21 1Q821 1QVFY 3S15I 1KRLA 3HOWI 4QTUA 3CCRZ 5CM2M 2RBLA 1YITZ 1R9TI 3CCL1 1K8A2 3RZOI 2E9HA 5C4XI 3NH5A 1YJN1 2KI7B 3CCEZ 2NAPA 4Y7NI 2F4OA 1YJNZ 3J81b 3JAMb 2RT9A 1K83I 3PO3S 2JIQA 2JS4A 1Q862 1Y8CA 4RS4A 1KC81 1RNIA 3CC71 3CC2Z 3TDHB 2Y0SA 1L1OC 2B63I 3OW2Y 4MRIA 3FQMA 1S72Z 1I6HI 3CCUZ 2OTJZ 1YJ9Z 1SIWA 3CCSZ 2P3YA 3S2HI 1YJ91 2E2JI 4X6AI 1VQ91 1VQP1 1RLYA 2JA5I 2H85A 4E31A 3CCR1 3H0GI 3Q87A 2O53A 1N8R1 1M902 3S1MI 2VPZA 1JWHC 1VQOZ 2PMZA 3I4MI 1VQM1 4A3II 4RVDA 3PO2I 3S17I 3NFZA 1USPB 1ZB8A 1Q16A 1VQK1 3GTLI 1Y1WI 1RO4A 3CCJ1 1VQLZ 2O4HA 1WW9A 1TWAI 4BBSI 2LFUA 4NB9A 5IP7I 1YIT1 3HOVI 1X3WA 3CCU1 2AKLA 3KIHA 2EGTA 1VQ7Z 2VUGA 1QVGY 2J6AA 4MH4A 2QEX1 1KQSZ 2JUBA 1S7MA 1TWHI 4BBRI 3CCMZ 1VQO1 3GTMS 2WB1A 3S14I 1QF8A 1Q7Y1 2K3RA 3HKZA 1VQ5Z 1SFOI 3CCQ1 3RZDI 1VQ51 1ML8A 4XX2A 3D6WA 1Q811 1NJI2 4A93I 2NVXI 5C44I 5C3EI 1VQ6Z 1I3QI 2W04A 1W2BY 1VQ61 4MXUA 2AYDA 3F3PC 3PO3I 1M901 2LIYA 2I3CA 1YUKA 2IZ3A 3CD61 2YU9I 3FKII 5T64A 2JA8I 3GKQA 3MZKB 3EEDA 1FDOA 2QR1B 3S16I 1VQNZ 4AYBA 2BJOA 2WAQA 4HGYA 3MONA 1Y1VI 1VQ81 1DL6A 5LL6f 4MD9A 4NH1C 1Z01A 3GTMI 3M3YI 2RIQA 3K7AI 2M6NA 3IR7A 1VLAA 2V8JA 3TE5B 1YJWZ 1NP6A 3I07A 3G71Z 3GTOI 1VQ71 5AN9F 3D2LA 2VPWA 3J81f 2JNYA 2K5RA 1VQN1 1QVGZ 2JIMA 1RQFA 5D1PA 4S1TA 2E2II 1JJ2Z 1YHQZ 1KC82 2HF1A 4Y52I 2QA41 3CXCY 1N2FA 4DK1A 3VMGA 3NH4A 1WJ2A 2OTL1 1K731 3VB9A 3QWUA 1VQ9Z 3I551 4NBAA 3CCS1 5IT9f 1N8R2 4NBFA 2JIOA 2V8KA 1Q812 5A2Qf 3FQQA 3G4S1 4NFRA 2W03A 1I50I 3M4OI 2V45A 1VQMZ 3I4NI 4QTTA 3CCM1 3HOUI 4A3FI 3J7A4 2QEXZ 3VMHA 2V8IA 2M48A 1ZB9A 3T4NB 4E2YA 4NBCA 2F4MA 3CCJZ 2R93I 2DE6A 4MD7A 3EERA 2PK7A 2QKDA 1Q861 2R7ZI 3GTQI 2GTHA 3IX0A 3CMAZ 2OTJ1 3J80f 3NDIA 3CCV1 3IFUA 1QVFZ 3G711 2E7ZA 2R92I 3I56Z 2QRCB 2QRDB 3BG1B 2E2HI 3CD6Z 5A2Qb 4NB8A 2DE7A 2VPYA 1K8A1 2DE5A 2RHBA 1KQSY 3GCFA 3S1RI 4MD8A 3G4SZ 2OZKA 4NBGA 1M1K2 1KD12 1JJ2Y 4RVFA 4CL1A 1Q822 3MZLB 1K9M2 3BG0B 2HU9A 3CQZI 2P28A 1YIJZ 1YI21 4DQYB 1YIJ1 4EWCA 4A3BI
chains in the Genus database with same CATH topology
4NBDA 3CC4Z 2ZAEB 3D9XA 3P5JB 3VTNA 2VUMI 3NDJA 4NBHA 5T67A 5FLXb 1YJW1 4NBBA 4A3MI 2JA6I 3S2DI 1ZH1A 3OW2Z 2G2KA 1WIIA 4HGZA 3CMEZ 2Q4ZA 3I55Z 3CCVZ 2OOYB 3S1QI 1Z02A 1VQ41 3U50C 2PM9A 4HH4A 1VQPZ 4E33A 4A3LI 3CCE1 2NVQI 4BXXI 1YHQ1 2RPRA 2VF1A 1TFIA 4TNUA 1KD11 3CPWZ 3S1NI 2GU2A 3KIFA 1RO0A 3HOXI 3CPWY 1W2BZ 3H3VJ 4A3DI 1VQL1 5T6BA 2QREB 3G6EZ 1YUAA 3CMA1 2JR6A 2NVYI 3J80b 1Y1VS 1VQ4Z 3CME1 2GTIA 1TWFI 2KPIA 4A3JI 4NOZA 1RO2A 1USPA 2R6MA 3NH8A 4RV9A 3G6E1 2IZ4A 1PFTA 3JAMf 3IF8A 2QA4Z 3GTJI 2QLVB 4E32A 4E2XA 2NVTI 3HOZI 5D1OB 1TWCI 2Q51A 2OTLZ 1X3ZA 4A3KI 5C4JI 4A3CI 2JA7I 4E2WA 5IT9b 1K732 4A3EI 3CCLZ 1NJI1 3GTKI 1WCMI 3ESWA 3F3FC 5IP9I 4RVHA 4BY7I 4MONA 4DGLA 5D1OA 5FLXf 3HOYI 1NUIA 1X0TA 4NBEA 1P9NA 3GTPI 3CC41 1VQ8Z 4RVGA 2YADA 1TWGI 4E2ZA 4BY1I 5FLMI 1YI2Z 1Q7Y2 1K9M1 1Z03A 3VMIA 1QYPA 3CCQZ 2JMOA 1S721 1VQKZ 1M1K1 3CC7Z 3CXCZ 2OOXB 3GTGI 4A3GI 4E30A 1LQLA 3LUSA 3I561 3CC21 1Q821 1QVFY 3S15I 1KRLA 3HOWI 4QTUA 3CCRZ 5CM2M 2RBLA 1YITZ 1R9TI 3CCL1 1K8A2 3RZOI 2E9HA 5C4XI 3NH5A 1YJN1 2KI7B 3CCEZ 4Y7NI 2F4OA 1YJNZ 3J81b 3JAMb 2RT9A 1K83I 3PO3S 2JS4A 1Q862 4RS4A 1KC81 1RNIA 3CC71 3CC2Z 3TDHB 2Y0SA 1L1OC 2B63I 3OW2Y 4MRIA 3FQMA 1S72Z 1I6HI 3CCUZ 2OTJZ 1YJ9Z 3CCSZ 2P3YA 3S2HI 1YJ91 2E2JI 4X6AI 1VQ91 1VQP1 1RLYA 2JA5I 2H85A 4E31A 3CCR1 3H0GI 3Q87A 2O53A 1N8R1 1M902 3S1MI 1JWHC 1VQOZ 2PMZA 3I4MI 1VQM1 4A3II 4RVDA 3PO2I 3S17I 3NFZA 1USPB 1ZB8A 1VQK1 3GTLI 1Y1WI 1RO4A 3CCJ1 1VQLZ 2O4HA 1WW9A 1TWAI 4BBSI 2LFUA 4NB9A 5IP7I 1YIT1 3HOVI 1X3WA 3CCU1 2AKLA 3KIHA 2EGTA 1VQ7Z 2VUGA 1QVGY 2J6AA 4MH4A 2QEX1 1KQSZ 2JUBA 1S7MA 1TWHI 4BBRI 3CCMZ 1VQO1 3GTMS 2WB1A 3S14I 1QF8A 1Q7Y1 2K3RA 3HKZA 1VQ5Z 1SFOI 3CCQ1 3RZDI 1VQ51 1ML8A 4XX2A 3D6WA 1Q811 1NJI2 4A93I 2NVXI 5C44I 5C3EI 1VQ6Z 1I3QI 2W04A 1W2BY 1VQ61 4MXUA 3F3PC 3PO3I 1M901 2LIYA 2I3CA 1YUKA 2IZ3A 3CD61 2YU9I 3FKII 5T64A 2JA8I 3GKQA 3MZKB 3EEDA 2QR1B 3S16I 1VQNZ 4AYBA 2BJOA 2WAQA 4HGYA 3MONA 1Y1VI 1VQ81 1DL6A 5LL6f 4MD9A 4NH1C 1Z01A 3GTMI 3M3YI 2RIQA 3K7AI 2M6NA 1VLAA 2V8JA 3TE5B 1YJWZ 1NP6A 3I07A 3G71Z 3GTOI 1VQ71 5AN9F 3J81f 2JNYA 2K5RA 1VQN1 1QVGZ 1RQFA 5D1PA 4S1TA 2E2II 1JJ2Z 1YHQZ 1KC82 2HF1A 4Y52I 2QA41 3CXCY 1N2FA 4DK1A 3VMGA 3NH4A 2OTL1 1K731 3VB9A 3QWUA 1VQ9Z 3I551 4NBAA 3CCS1 5IT9f 1N8R2 4NBFA 2V8KA 1Q812 5A2Qf 3FQQA 3G4S1 4NFRA 2W03A 1I50I 3M4OI 1VQMZ 3I4NI 4QTTA 3CCM1 3HOUI 4A3FI 3J7A4 2QEXZ 3VMHA 2V8IA 2M48A 1ZB9A 3T4NB 4E2YA 4NBCA 2F4MA 3CCJZ 2R93I 2DE6A 4MD7A 3EERA 2PK7A 2QKDA 1Q861 2R7ZI 3GTQI 2GTHA 3IX0A 3CMAZ 2OTJ1 3J80f 3NDIA 3CCV1 3IFUA 1QVFZ 3G711 2R92I 3I56Z 2QRCB 2QRDB 3BG1B 2E2HI 3CD6Z 5A2Qb 4NB8A 2DE7A 1K8A1 2DE5A 2RHBA 1KQSY 3GCFA 3S1RI 4MD8A 3G4SZ 2OZKA 4NBGA 1M1K2 1KD12 1JJ2Y 4RVFA 4CL1A 1Q822 3MZLB 1K9M2 3BG0B 2HU9A 3CQZI 2P28A 1YIJZ 1YI21 4DQYB 1YIJ1 4EWCA 4A3BI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NBD A;  1USP B;  1ZB8 A;  4A3E I;  3GTL I;  3GTK I;  1WCM I;  2VUM I;  3ESW A;  5IP9 I;  1Y1W I;  4BY7 I;  4NBH A;  2JNY A;  2K5R A;  1RO4 A;  4NBB A;  3HOY I;  1NUI A;  4A3M I;  2JA6 I;  3S2D I;  4NBE A;  3GTP I;  1WW9 A;  1TWA I;  4BBS I;  1TWG I;  2E2I I;  4BY1 I;  5FLM I;  4NB9 A;  5IP7 I;  3HOV I;  3VMI A;  1X3W A;  1QYP A;  2HF1 A;  4Y52 I;  2AKL A;  3S1Q I;  1N2F A;  2J6A A;  3U50 C;  4MH4 A;  3VMG A;  4BBR I;  1TWH I;  4A3L I;  3GTM S;  3S14 I;  3VB9 A;  2NVQ I;  4BXX I;  3GTG I;  4A3G I;  3S15 I;  1LQL A;  3LUS A;  4NBA A;  4NBF A;  3HOW I;  1TFI A;  4QTU A;  5CM2 M;  1SFO I;  3S1N I;  2RBL A;  1R9T I;  3RZD I;  1ML8 A;  1I50 I;  3RZO I;  3M4O I;  4XX2 A;  3HOX I;  3D6W A;  3I4N I;  4QTT A;  5C4X I;  3HOU I;  4A3F I;  4A93 I;  2NVX I;  3H3V J;  4A3D I;  5C44 I;  5C3E I;  3VMH A;  1I3Q I;  2F4O A;  4Y7N I;  1YUA A;  2JR6 A;  1ZB9 A;  2NVY I;  1Y1V S;  1K83 I;  3PO3 I;  1TWF I;  3PO3 S;  2KPI A;  2JS4 A;  4NBC A;  2F4M A;  4A3J I;  2R93 I;  4NOZ A;  2DE6 A;  1USP A;  3EER A;  2PK7 A;  2YU9 I;  3FKI I;  2R7Z I;  2JA8 I;  3GKQ A;  3GTQ I;  1L1O C;  2B63 I;  1PFT A;  1I6H I;  3S16 I;  3GTJ I;  2R92 I;  2P3Y A;  2BJO A;  3S2H I;  2E2H I;  2E2J I;  4NB8 A;  1Y1V I;  2DE7 A;  4X6A I;  2DE5 A;  2NVT I;  1DL6 A;  3GCF A;  3HOZ I;  3S1R I;  1TWC I;  1RLY A;  4NBG A;  2JA5 I;  1X3Z A;  4A3K I;  3H0G I;  3Q87 A;  3GTM I;  5C4J I;  3M3Y I;  3S1M I;  4A3C I;  3K7A I;  2JA7 I;  1VLA A;  3CQZ I;  3I4M I;  3I07 A;  3GTO I;  4A3I I;  3S17 I;  3PO2 I;  4A3B I; 
#chains in the Genus database with same CATH topology
 4NBD A;  3CC4 Z;  2ZAE B;  3D9X A;  3P5J B;  3VTN A;  2VUM I;  3NDJ A;  4NBH A;  5T67 A;  5FLX b;  1YJW 1;  4NBB A;  4A3M I;  2JA6 I;  3S2D I;  1ZH1 A;  3OW2 Z;  2G2K A;  1WII A;  4HGZ A;  3CME Z;  2Q4Z A;  3I55 Z;  3CCV Z;  2OOY B;  3S1Q I;  1Z02 A;  1VQ4 1;  3U50 C;  2PM9 A;  4HH4 A;  1VQP Z;  4E33 A;  4A3L I;  1WZN A;  3CCE 1;  2NVQ I;  2JIR A;  4BXX I;  1YHQ 1;  2RPR A;  2VF1 A;  1TFI A;  4TNU A;  1KD1 1;  3CPW Z;  3S1N I;  2GU2 A;  3KIF A;  1RO0 A;  3HOX I;  3CPW Y;  1W2B Z;  3H3V J;  4A3D I;  2V3V A;  1VQL 1;  5T6B A;  2QRE B;  3G6E Z;  1YUA A;  3CMA 1;  2JR6 A;  2NVY I;  3J80 b;  1Y1V S;  1VQ4 Z;  3CME 1;  2GTI A;  1TWF I;  2KPI A;  2VPX A;  4A3J I;  4NOZ A;  1RO2 A;  1USP A;  2R6M A;  3NH8 A;  4RV9 A;  3G6E 1;  2IZ4 A;  1QXF A;  1PFT A;  3JAM f;  3IF8 A;  2QA4 Z;  3GTJ I;  2QLV B;  4E32 A;  4E2X A;  2NVT I;  3HOZ I;  5D1O B;  1TWC I;  2Q51 A;  2LEX A;  2OTL Z;  1X3Z A;  4A3K I;  5C4J I;  4A3C I;  2JA7 I;  4E2W A;  5IT9 b;  1K73 2;  1FDI A;  4A3E I;  3CCL Z;  1NJI 1;  3GTK I;  1WCM I;  3ESW A;  3F3F C;  5IP9 I;  1AA6 A;  4RVH A;  4BY7 I;  4MON A;  4DGL A;  5D1O A;  5FLX f;  3HOY I;  1NUI A;  1X0T A;  4NBE A;  1P9N A;  3GTP I;  3CC4 1;  1VQ8 Z;  4RVG A;  2YAD A;  1TWG I;  4E2Z A;  4BY1 I;  5FLM I;  1YI2 Z;  1Q7Y 2;  1K9M 1;  1Z03 A;  3VMI A;  1QYP A;  3CCQ Z;  2JIP A;  2JMO A;  1S72 1;  1VQK Z;  1M1K 1;  3CC7 Z;  3CXC Z;  2OOX B;  2IV2 X;  3GTG I;  4A3G I;  4E30 A;  1LQL A;  3LUS A;  3I56 1;  3CC2 1;  1Q82 1;  1QVF Y;  3S15 I;  1KRL A;  3HOW I;  4QTU A;  3CCR Z;  5CM2 M;  2RBL A;  1YIT Z;  1R9T I;  3CCL 1;  1K8A 2;  3RZO I;  2E9H A;  5C4X I;  3NH5 A;  1YJN 1;  2KI7 B;  3CCE Z;  2NAP A;  4Y7N I;  2F4O A;  1YJN Z;  3J81 b;  3JAM b;  2RT9 A;  1K83 I;  3PO3 S;  2JIQ A;  2JS4 A;  1Q86 2;  1Y8C A;  4RS4 A;  1KC8 1;  1RNI A;  3CC7 1;  3CC2 Z;  3TDH B;  2Y0S A;  1L1O C;  2B63 I;  3OW2 Y;  4MRI A;  3FQM A;  1S72 Z;  1I6H I;  3CCU Z;  2OTJ Z;  1YJ9 Z;  1SIW A;  3CCS Z;  2P3Y A;  3S2H I;  1YJ9 1;  2E2J I;  4X6A I;  1VQ9 1;  1VQP 1;  1RLY A;  2JA5 I;  2H85 A;  4E31 A;  3CCR 1;  3H0G I;  3Q87 A;  2O53 A;  1N8R 1;  1M90 2;  3S1M I;  2VPZ A;  1JWH C;  1VQO Z;  2PMZ A;  3I4M I;  1VQM 1;  4A3I I;  4RVD A;  3PO2 I;  3S17 I;  3NFZ A;  1USP B;  1ZB8 A;  1Q16 A;  1VQK 1;  3GTL I;  1Y1W I;  1RO4 A;  3CCJ 1;  1VQL Z;  2O4H A;  1WW9 A;  1TWA I;  4BBS I;  2LFU A;  4NB9 A;  5IP7 I;  1YIT 1;  3HOV I;  1X3W A;  3CCU 1;  2AKL A;  3KIH A;  2EGT A;  1VQ7 Z;  2VUG A;  1QVG Y;  2J6A A;  4MH4 A;  2QEX 1;  1KQS Z;  2JUB A;  1S7M A;  1TWH I;  4BBR I;  3CCM Z;  1VQO 1;  3GTM S;  2WB1 A;  3S14 I;  1QF8 A;  1Q7Y 1;  2K3R A;  3HKZ A;  1VQ5 Z;  1SFO I;  3CCQ 1;  3RZD I;  1VQ5 1;  1ML8 A;  4XX2 A;  3D6W A;  1Q81 1;  1NJI 2;  4A93 I;  2NVX I;  5C44 I;  5C3E I;  1VQ6 Z;  1I3Q I;  2W04 A;  1W2B Y;  1VQ6 1;  4MXU A;  2AYD A;  3F3P C;  3PO3 I;  1M90 1;  2LIY A;  2I3C A;  1YUK A;  2IZ3 A;  3CD6 1;  2YU9 I;  3FKI I;  5T64 A;  2JA8 I;  3GKQ A;  3MZK B;  3EED A;  1FDO A;  2QR1 B;  3S16 I;  1VQN Z;  4AYB A;  2BJO A;  2WAQ A;  4HGY A;  3MON A;  1Y1V I;  1VQ8 1;  1DL6 A;  5LL6 f;  4MD9 A;  4NH1 C;  1Z01 A;  3GTM I;  3M3Y I;  2RIQ A;  3K7A I;  2M6N A;  3IR7 A;  1VLA A;  2V8J A;  3TE5 B;  1YJW Z;  1NP6 A;  3I07 A;  3G71 Z;  3GTO I;  1VQ7 1;  5AN9 F;  3D2L A;  2VPW A;  3J81 f;  2JNY A;  2K5R A;  1VQN 1;  1QVG Z;  2JIM A;  1RQF A;  5D1P A;  4S1T A;  2E2I I;  1JJ2 Z;  1YHQ Z;  1KC8 2;  2HF1 A;  4Y52 I;  2QA4 1;  3CXC Y;  1N2F A;  4DK1 A;  3VMG A;  3NH4 A;  1WJ2 A;  2OTL 1;  1K73 1;  3VB9 A;  3QWU A;  1VQ9 Z;  3I55 1;  4NBA A;  3CCS 1;  5IT9 f;  1N8R 2;  4NBF A;  2JIO A;  2V8K A;  1Q81 2;  5A2Q f;  3FQQ A;  3G4S 1;  4NFR A;  2W03 A;  1I50 I;  3M4O I;  2V45 A;  1VQM Z;  3I4N I;  4QTT A;  3CCM 1;  3HOU I;  4A3F I;  3J7A 4;  2QEX Z;  3VMH A;  2V8I A;  2M48 A;  1ZB9 A;  3T4N B;  4E2Y A;  4NBC A;  2F4M A;  3CCJ Z;  2R93 I;  2DE6 A;  4MD7 A;  3EER A;  2PK7 A;  2QKD A;  1Q86 1;  2R7Z I;  3GTQ I;  2GTH A;  3IX0 A;  3CMA Z;  2OTJ 1;  3J80 f;  3NDI A;  3CCV 1;  3IFU A;  1QVF Z;  3G71 1;  2E7Z A;  2R92 I;  3I56 Z;  2QRC B;  2QRD B;  3BG1 B;  2E2H I;  3CD6 Z;  5A2Q b;  4NB8 A;  2DE7 A;  2VPY A;  1K8A 1;  2DE5 A;  2RHB A;  1KQS Y;  3GCF A;  3S1R I;  4MD8 A;  3G4S Z;  2OZK A;  4NBG A;  1M1K 2;  1KD1 2;  1JJ2 Y;  4RVF A;  4CL1 A;  1Q82 2;  3MZL B;  1K9M 2;  3BG0 B;  2HU9 A;  3CQZ I;  2P28 A;  1YIJ Z;  1YI2 1;  4DQY B;  1YIJ 1;  4EWC A;  4A3B I; 
#chains in the Genus database with same CATH homology
 4NBD A;  3CC4 Z;  2ZAE B;  3D9X A;  3P5J B;  3VTN A;  2VUM I;  3NDJ A;  4NBH A;  5T67 A;  5FLX b;  1YJW 1;  4NBB A;  4A3M I;  2JA6 I;  3S2D I;  1ZH1 A;  3OW2 Z;  2G2K A;  1WII A;  4HGZ A;  3CME Z;  2Q4Z A;  3I55 Z;  3CCV Z;  2OOY B;  3S1Q I;  1Z02 A;  1VQ4 1;  3U50 C;  2PM9 A;  4HH4 A;  1VQP Z;  4E33 A;  4A3L I;  3CCE 1;  2NVQ I;  4BXX I;  1YHQ 1;  2RPR A;  2VF1 A;  1TFI A;  4TNU A;  1KD1 1;  3CPW Z;  3S1N I;  2GU2 A;  3KIF A;  1RO0 A;  3HOX I;  3CPW Y;  1W2B Z;  3H3V J;  4A3D I;  1VQL 1;  5T6B A;  2QRE B;  3G6E Z;  1YUA A;  3CMA 1;  2JR6 A;  2NVY I;  3J80 b;  1Y1V S;  1VQ4 Z;  3CME 1;  2GTI A;  1TWF I;  2KPI A;  4A3J I;  4NOZ A;  1RO2 A;  1USP A;  2R6M A;  3NH8 A;  4RV9 A;  3G6E 1;  2IZ4 A;  1PFT A;  3JAM f;  3IF8 A;  2QA4 Z;  3GTJ I;  2QLV B;  4E32 A;  4E2X A;  2NVT I;  3HOZ I;  5D1O B;  1TWC I;  2Q51 A;  2OTL Z;  1X3Z A;  4A3K I;  5C4J I;  4A3C I;  2JA7 I;  4E2W A;  5IT9 b;  1K73 2;  4A3E I;  3CCL Z;  1NJI 1;  3GTK I;  1WCM I;  3ESW A;  3F3F C;  5IP9 I;  4RVH A;  4BY7 I;  4MON A;  4DGL A;  5D1O A;  5FLX f;  3HOY I;  1NUI A;  1X0T A;  4NBE A;  1P9N A;  3GTP I;  3CC4 1;  1VQ8 Z;  4RVG A;  2YAD A;  1TWG I;  4E2Z A;  4BY1 I;  5FLM I;  1YI2 Z;  1Q7Y 2;  1K9M 1;  1Z03 A;  3VMI A;  1QYP A;  3CCQ Z;  2JMO A;  1S72 1;  1VQK Z;  1M1K 1;  3CC7 Z;  3CXC Z;  2OOX B;  3GTG I;  4A3G I;  4E30 A;  1LQL A;  3LUS A;  3I56 1;  3CC2 1;  1Q82 1;  1QVF Y;  3S15 I;  1KRL A;  3HOW I;  4QTU A;  3CCR Z;  5CM2 M;  2RBL A;  1YIT Z;  1R9T I;  3CCL 1;  1K8A 2;  3RZO I;  2E9H A;  5C4X I;  3NH5 A;  1YJN 1;  2KI7 B;  3CCE Z;  4Y7N I;  2F4O A;  1YJN Z;  3J81 b;  3JAM b;  2RT9 A;  1K83 I;  3PO3 S;  2JS4 A;  1Q86 2;  4RS4 A;  1KC8 1;  1RNI A;  3CC7 1;  3CC2 Z;  3TDH B;  2Y0S A;  1L1O C;  2B63 I;  3OW2 Y;  4MRI A;  3FQM A;  1S72 Z;  1I6H I;  3CCU Z;  2OTJ Z;  1YJ9 Z;  3CCS Z;  2P3Y A;  3S2H I;  1YJ9 1;  2E2J I;  4X6A I;  1VQ9 1;  1VQP 1;  1RLY A;  2JA5 I;  2H85 A;  4E31 A;  3CCR 1;  3H0G I;  3Q87 A;  2O53 A;  1N8R 1;  1M90 2;  3S1M I;  1JWH C;  1VQO Z;  2PMZ A;  3I4M I;  1VQM 1;  4A3I I;  4RVD A;  3PO2 I;  3S17 I;  3NFZ A;  1USP B;  1ZB8 A;  1VQK 1;  3GTL I;  1Y1W I;  1RO4 A;  3CCJ 1;  1VQL Z;  2O4H A;  1WW9 A;  1TWA I;  4BBS I;  2LFU A;  4NB9 A;  5IP7 I;  1YIT 1;  3HOV I;  1X3W A;  3CCU 1;  2AKL A;  3KIH A;  2EGT A;  1VQ7 Z;  2VUG A;  1QVG Y;  2J6A A;  4MH4 A;  2QEX 1;  1KQS Z;  2JUB A;  1S7M A;  1TWH I;  4BBR I;  3CCM Z;  1VQO 1;  3GTM S;  2WB1 A;  3S14 I;  1QF8 A;  1Q7Y 1;  2K3R A;  3HKZ A;  1VQ5 Z;  1SFO I;  3CCQ 1;  3RZD I;  1VQ5 1;  1ML8 A;  4XX2 A;  3D6W A;  1Q81 1;  1NJI 2;  4A93 I;  2NVX I;  5C44 I;  5C3E I;  1VQ6 Z;  1I3Q I;  2W04 A;  1W2B Y;  1VQ6 1;  4MXU A;  3F3P C;  3PO3 I;  1M90 1;  2LIY A;  2I3C A;  1YUK A;  2IZ3 A;  3CD6 1;  2YU9 I;  3FKI I;  5T64 A;  2JA8 I;  3GKQ A;  3MZK B;  3EED A;  2QR1 B;  3S16 I;  1VQN Z;  4AYB A;  2BJO A;  2WAQ A;  4HGY A;  3MON A;  1Y1V I;  1VQ8 1;  1DL6 A;  5LL6 f;  4MD9 A;  4NH1 C;  1Z01 A;  3GTM I;  3M3Y I;  2RIQ A;  3K7A I;  2M6N A;  1VLA A;  2V8J A;  3TE5 B;  1YJW Z;  1NP6 A;  3I07 A;  3G71 Z;  3GTO I;  1VQ7 1;  5AN9 F;  3J81 f;  2JNY A;  2K5R A;  1VQN 1;  1QVG Z;  1RQF A;  5D1P A;  4S1T A;  2E2I I;  1JJ2 Z;  1YHQ Z;  1KC8 2;  2HF1 A;  4Y52 I;  2QA4 1;  3CXC Y;  1N2F A;  4DK1 A;  3VMG A;  3NH4 A;  2OTL 1;  1K73 1;  3VB9 A;  3QWU A;  1VQ9 Z;  3I55 1;  4NBA A;  3CCS 1;  5IT9 f;  1N8R 2;  4NBF A;  2V8K A;  1Q81 2;  5A2Q f;  3FQQ A;  3G4S 1;  4NFR A;  2W03 A;  1I50 I;  3M4O I;  1VQM Z;  3I4N I;  4QTT A;  3CCM 1;  3HOU I;  4A3F I;  3J7A 4;  2QEX Z;  3VMH A;  2V8I A;  2M48 A;  1ZB9 A;  3T4N B;  4E2Y A;  4NBC A;  2F4M A;  3CCJ Z;  2R93 I;  2DE6 A;  4MD7 A;  3EER A;  2PK7 A;  2QKD A;  1Q86 1;  2R7Z I;  3GTQ I;  2GTH A;  3IX0 A;  3CMA Z;  2OTJ 1;  3J80 f;  3NDI A;  3CCV 1;  3IFU A;  1QVF Z;  3G71 1;  2R92 I;  3I56 Z;  2QRC B;  2QRD B;  3BG1 B;  2E2H I;  3CD6 Z;  5A2Q b;  4NB8 A;  2DE7 A;  1K8A 1;  2DE5 A;  2RHB A;  1KQS Y;  3GCF A;  3S1R I;  4MD8 A;  3G4S Z;  2OZK A;  4NBG A;  1M1K 2;  1KD1 2;  1JJ2 Y;  4RVF A;  4CL1 A;  1Q82 2;  3MZL B;  1K9M 2;  3BG0 B;  2HU9 A;  3CQZ I;  2P28 A;  1YIJ Z;  1YI2 1;  4DQY B;  1YIJ 1;  4EWC A;  4A3B I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...