3CC7Z

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2487u
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 13
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cc7Z00
1KQSY 3CME1 2QA41 1Q861 1VQ61 1QVFZ 1S721 1M1K1 3I561 1Q7Y1 3CCUZ 1VQN1 3CCSZ 1K731 1VQ7Z 3G711 3CMA1 3CCE1 1YJW1 1QVGY 1Q812 1JJ2Z 1Q822 3CPWZ 1W2BY 1VQ41 3CC71 1NJI1 3G6E1 1YJNZ 1VQKZ 3CXCZ 1YIJZ 1VQ91 1N8R1 1M901 3CCVZ 1YHQZ 1VQL1 3CCR1 1YJ91 1VQMZ 1KD11 3CD6Z 3CC4Z 2QEXZ 1YIT1 1JJ2Y 3CCQZ 3CMEZ 2QA4Z 1VQ6Z 1VQO1 1S72Z 1K8A1 3CC2Z 3I56Z 1Q862 1VQNZ 3CCJ1 3CXCY 1K9M1 1M1K2 3CMAZ 1Q7Y2 3CCEZ 3G4S1 1YJWZ 1VQP1 1YI21 1K732 1KQSZ 1VQ81 1QVFY 2OTLZ 3I55Z 1VQ4Z 3CCM1 3CCL1 1KC81 2OTJZ 1VQK1 3G6EZ 1VQ5Z 1YHQ1 1QVGZ 1VQ9Z 1NJI2 1K9M2 3CPWY 1VQM1 1W2BZ 3OW2Z 1VQLZ 3CD61 3CCRZ 3CCU1 1N8R2 3CCS1 1M902 1VQ71 3G71Z 1YITZ 1KD12 3CC21 1VQOZ 3CC7Z 1YJN1 3CCJZ 1YIJ1 1K8A2 3CCV1 3I551 3G4SZ 1VQPZ 2OTL1 1YI2Z 3OW2Y 1VQ8Z 2OTJ1 3CCMZ 1YJ9Z 3CCLZ 1VQ51 3CC41 1Q811 1Q821 2QEX1 3CCQ1 1KC82
chains in the Genus database with same CATH superfamily
3NDIA 1KQSY 1Q861 1VQ61 2JIOA 3NH5A 4NBBA 1K731 3H0GI 4Y7NI 3CMA1 3CCE1 3IX0A 4A3FI 4HGYA 2Q51A 3GKQA 4A3EI 1USPB 3CPWZ 1W2BY 2E9HA 4NOZA 4RS4A 2GTHA 3J81f 2V45A 3CXCZ 1VQ91 3S1NI 3GTKI 1YHQZ 3S2DI 2QREB 2E2HI 2RBLA 3CD6Z 4HGZA 3GTPI 2LFUA 3CMEZ 2QA4Z 1X3ZA 3EERA 5C44I 2OOYB 5A2Qb 4A3KI 3J80f 3PO2I 3J7A4 1Q7Y2 3G4S1 2P28A 3EEDA 4E33A 4NBEA 1YI21 4A3LI 1VQ81 3GTLI 1VQ4Z 4RV9A 1Z03A 3H3VJ 1QVGZ 2QKDA 3CPWY 4NBDA 2F4OA 2ZAEB 4MD7A 2WB1A 3CCRZ 2DE7A 1Q16A 3T4NB 3S1MI 3K7AI 1YITZ 1KD12 3Q87A 2NVYI 4E30A 5C4XI 3CCJZ 1WZNA 2OOXB 2IZ3A 4DGLA 4MD9A 1Y1VI 4RVHA 3OW2Y 2JA6I 2R92I 2GU2A 4E32A 3CCMZ 1ZB8A 1VQ51 1I3QI 4HH4A 3J81b 2VUGA 1WJ2A 4E2YA 1Z01A 2EGTA 3CME1 2QA41 2V8JA 2JA5I 2G2KA 3CCUZ 3RZOI 1QVGY 1Q812 2E7ZA 3LUSA 2B63I 1VQ41 3M3YI 2PM9A 1KRLA 3GTOI 1YJNZ 4E31A 5T6BA 2O53A 2HF1A 3J80b 1N8R1 1M901 1NP6A 3CCR1 1YJ91 5C3EI 3FQQA 1LQLA 2V8IA 2JIQA 3I4NI 4RVFA 1YIT1 2JUBA 2E2II 1RO2A 1R9TI 4BBRI 2J6AA 2F4MA 3IF8A 1K8A1 2IV2X 3F3FC 2K5RA 3BG0B 3I56Z 2IZ4A 3CCJ1 1M1K2 2Q4ZA 2DE6A 1YJWZ 3KIHA 2NVQI 5T64A 4MRIA 2Y0SA 4RVGA 3CCM1 4MONA 3VTNA 3RZDI 4BY7I 1KC81 3G6EZ 1VQ5Z 3U50C 3S16I 2OZKA 3MZKB 1NJI2 3NFZA 1VQM1 1RLYA 3OW2Z 1ML8A 3JAMf 1YUAA 5FLXf 3CCU1 2JNYA 3I4MI 4A93I 4NBFA 4DQYB 2JIPA 3HOXI 4X6AI 5IT9b 2BJOA 2RPRA 3S15I 2K3RA 3NH4A 2JIMA 1RQFA 4A3DI 2V3VA 1P9NA 1YJN1 2LEXA 3F3PC 2RIQA 4NBGA 2OTL1 1VQPZ 2O4HA 1QF8A 1ZB9A 2QRCB 1YJ9Z 3CCLZ 1TWGI 5FLMI 1WCMI 1Q821 3S14I 2KPIA 1QVFZ 2W03A 4A3BI 1SFOI 3I561 1Q7Y1 3IR7A 3CCSZ 2RT9A 3GTQI 1VQ7Z 3G711 5AN9F 1YJW1 3NH8A 1FDOA 3HKZA 3TE5B 4A3MI 3D9XA 3G6E1 2I3CA 3GCFA 1N2FA 1Y1VS 3HOUI 1Y8CA 4QTTA 1VQMZ 1KD11 5D1OA 2QEXZ 1JJ2Y 2VPWA 4E2ZA 3S1QI 1ZH1A 1S72Z 3JAMb 4DK1A 1Q862 4E2WA 3D2LA 5FLXb 4A3CI 1JWHC 1VQNZ 3PO3I 3D6WA 1K9M1 3GTMI 4A3GI 1VQP1 1K732 3CQZI 1QVFY 4CL1A 2OTLZ 4NFRA 3MZLB 2QLVB 3CCL1 1VQK1 1TWCI 2GTIA 4Y52I 1TWAI 3QWUA 4BBSI 2VPZA 3HOWI 1VQLZ 3CCS1 1FDIA 4A3II 1SIWA 3IFUA 1VQ71 1VLAA 3G71Z 2AKLA 3I07A 1QXFA 2WAQA 5D1OB 3CC21 4MXUA 3S17I 1VQOZ 1I50I 1TFIA 2VF1A 2R7ZI 2M6NA 2E2JI 4NBHA 3I551 2R93I 2OTJ1 2V8KA 4NH1C 2QEX1 2JMOA 4NB8A 1AA6A 5CM2M 1L1OC 2PK7A 4BY1I 2RHBA 3HOYI 3HOVI 4RVDA 1S721 1M1K1 1VQN1 2YADA 2JS4A 1JJ2Z 1Q822 1Z02A 2JA8I 3ESWA 2DE5A 3CC71 2P3YA 5IP7I 1NJI1 2JA7I 3MONA 1RNIA 1TWFI 4AYBA 2YU9I 1VQKZ 1YIJZ 2VPYA 3S2HI 1NUIA 4QTUA 3CCVZ 3VMHA 1TWHI 2R6MA 3GTGI 1VQL1 2JIRA 2VUMI 2VPXA 5IP9I 5LL6f 3CC4Z 3S1RI 5D1PA 3CCQZ 2HU9A 2LIYA 2JR6A 1VQ6Z 3P5JB 1DL6A 1VQO1 3FKII 4A3JI 2QRDB 1Y1WI 1PFTA 3CC2Z 4E2XA 2PMZA 1YUKA 3CXCY 1QYPA 3CMAZ 2QR1B 3TDHB 3CCEZ 4BXXI 1KQSZ 4TNUA 2NVTI 3I55Z 3KIFA 1WIIA 4NBCA 2OTJZ 2KI7B 1K83I 1X0TA 3HOZI 1X3WA 2M48A 1YHQ1 3M4OI 5C4JI 1VQ9Z 1K9M2 3FQMA 4MH4A 1W2BZ 5A2Qf 2AYDA 1S7MA 3CD61 1N8R2 1M902 4EWCA 1USPA 5IT9f 5T67A 2H85A 1RO4A 4NB9A 1WW9A 3CC7Z 2W04A 4NBAA 3VMIA 3VMGA 1YIJ1 4XX2A 3VB9A 1K8A2 3PO3S 3CCV1 3G4SZ 3NDJA 4S1TA 1YI2Z 3GTMS 1VQ8Z 3GTJI 2NVXI 3CC41 1Q811 1I6HI 4MD8A 1RO0A 3BG1B 3CCQ1 1KC82 2NAPA
chains in the Genus database with same CATH topology
3NDIA 1KQSY 1Q861 1VQ61 3NH5A 4NBBA 1K731 3H0GI 4Y7NI 3CMA1 3CCE1 3IX0A 4A3FI 4HGYA 2Q51A 3GKQA 4A3EI 1USPB 3CPWZ 1W2BY 2E9HA 4NOZA 4RS4A 2GTHA 3J81f 3CXCZ 1VQ91 3S1NI 3GTKI 1YHQZ 3S2DI 2QREB 2E2HI 2RBLA 3CD6Z 4HGZA 3GTPI 2LFUA 3CMEZ 2QA4Z 1X3ZA 3EERA 5C44I 2OOYB 5A2Qb 4A3KI 3J80f 3PO2I 3J7A4 1Q7Y2 3G4S1 2P28A 3EEDA 4E33A 4NBEA 1YI21 4A3LI 1VQ81 3GTLI 1VQ4Z 4RV9A 1Z03A 3H3VJ 1QVGZ 2QKDA 3CPWY 4NBDA 2F4OA 2ZAEB 4MD7A 2WB1A 3CCRZ 2DE7A 3T4NB 3S1MI 3K7AI 1YITZ 1KD12 3Q87A 2NVYI 4E30A 5C4XI 3CCJZ 2OOXB 2IZ3A 4DGLA 4MD9A 1Y1VI 4RVHA 3OW2Y 2JA6I 2R92I 2GU2A 4E32A 3CCMZ 1ZB8A 1VQ51 1I3QI 4HH4A 3J81b 2VUGA 4E2YA 1Z01A 2EGTA 3CME1 2QA41 2V8JA 2JA5I 2G2KA 3CCUZ 3RZOI 1QVGY 1Q812 3LUSA 2B63I 1VQ41 3M3YI 2PM9A 1KRLA 3GTOI 1YJNZ 4E31A 5T6BA 2O53A 2HF1A 3J80b 1N8R1 1M901 1NP6A 3CCR1 1YJ91 5C3EI 3FQQA 1LQLA 2V8IA 3I4NI 4RVFA 1YIT1 2JUBA 2E2II 1RO2A 1R9TI 4BBRI 2J6AA 2F4MA 3IF8A 1K8A1 3I56Z 3F3FC 2K5RA 3BG0B 2IZ4A 3CCJ1 1M1K2 2Q4ZA 2DE6A 1YJWZ 3KIHA 2NVQI 5T64A 4MRIA 2Y0SA 4RVGA 3CCM1 4MONA 3VTNA 3RZDI 4BY7I 1KC81 3G6EZ 1VQ5Z 3U50C 3S16I 2OZKA 3MZKB 1NJI2 3NFZA 1VQM1 3OW2Z 1RLYA 1ML8A 3JAMf 1YUAA 5FLXf 3CCU1 2JNYA 3I4MI 4A93I 4NBFA 4DQYB 3HOXI 4X6AI 5IT9b 2BJOA 2RPRA 3S15I 2K3RA 3NH4A 1RQFA 4A3DI 1P9NA 1YJN1 3F3PC 2RIQA 4NBGA 2OTL1 1VQPZ 2O4HA 1QF8A 1ZB9A 2QRCB 1YJ9Z 3CCLZ 1TWGI 5FLMI 1WCMI 1Q821 3S14I 2KPIA 1QVFZ 2W03A 4A3BI 1SFOI 3I561 1Q7Y1 3CCSZ 2RT9A 3GTQI 1VQ7Z 3G711 5AN9F 1YJW1 3NH8A 3HKZA 3TE5B 4A3MI 3D9XA 3G6E1 2I3CA 3GCFA 1N2FA 1Y1VS 3HOUI 4QTTA 1VQMZ 1KD11 5D1OA 2QEXZ 1JJ2Y 4E2ZA 3S1QI 1ZH1A 1S72Z 3JAMb 4DK1A 1Q862 5FLXb 4E2WA 4A3CI 1JWHC 1VQNZ 3PO3I 3D6WA 1K9M1 3GTMI 4A3GI 1VQP1 1K732 3CQZI 1QVFY 4CL1A 2OTLZ 4NFRA 3MZLB 2QLVB 3CCL1 1VQK1 1TWCI 2GTIA 4Y52I 1TWAI 3QWUA 4BBSI 3HOWI 1VQLZ 3CCS1 4A3II 3IFUA 1VQ71 1VLAA 3G71Z 2AKLA 3I07A 2WAQA 5D1OB 3CC21 4MXUA 3S17I 1VQOZ 1I50I 1TFIA 2VF1A 2R7ZI 2M6NA 2E2JI 4NBHA 3I551 2R93I 2OTJ1 2V8KA 4NH1C 2QEX1 2JMOA 4NB8A 4BY1I 5CM2M 1L1OC 2PK7A 2RHBA 3HOYI 3HOVI 4RVDA 1S721 1M1K1 1VQN1 2YADA 2JS4A 1JJ2Z 1Q822 1Z02A 2JA8I 3ESWA 2DE5A 3CC71 2P3YA 5IP7I 1NJI1 2JA7I 3MONA 1RNIA 1TWFI 4AYBA 2YU9I 1VQKZ 1YIJZ 3S2HI 1NUIA 4QTUA 3CCVZ 3VMHA 1TWHI 2R6MA 3GTGI 1VQL1 2VUMI 5IP9I 5LL6f 3CC4Z 3S1RI 5D1PA 3CCQZ 2HU9A 2LIYA 2JR6A 1VQ6Z 3P5JB 1DL6A 1VQO1 3FKII 4A3JI 2QRDB 1Y1WI 1PFTA 3CC2Z 4E2XA 2PMZA 1YUKA 3CXCY 1QYPA 3CMAZ 2QR1B 3TDHB 3CCEZ 4BXXI 1KQSZ 4TNUA 2NVTI 3I55Z 3KIFA 1WIIA 4NBCA 2OTJZ 2KI7B 1K83I 1X0TA 3HOZI 1X3WA 2M48A 1YHQ1 3M4OI 5C4JI 1VQ9Z 1K9M2 3FQMA 4MH4A 1W2BZ 5A2Qf 1S7MA 3CD61 1N8R2 1M902 4EWCA 1USPA 5IT9f 5T67A 2H85A 1RO4A 4NB9A 1WW9A 3CC7Z 2W04A 4NBAA 3VMIA 3VMGA 1YIJ1 4XX2A 3VB9A 1K8A2 3PO3S 3CCV1 3G4SZ 3NDJA 4S1TA 1YI2Z 3GTMS 1VQ8Z 3GTJI 2NVXI 3CC41 1Q811 1I6HI 4MD8A 1RO0A 3BG1B 3CCQ1 1KC82
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQS Y;  3CME 1;  2QA4 1;  1Q86 1;  1VQ6 1;  1QVF Z;  1S72 1;  1M1K 1;  3I56 1;  1Q7Y 1;  3CCU Z;  1VQN 1;  3CCS Z;  1K73 1;  1VQ7 Z;  3G71 1;  3CMA 1;  3CCE 1;  1YJW 1;  1QVG Y;  1Q81 2;  1JJ2 Z;  1Q82 2;  3CPW Z;  1W2B Y;  1VQ4 1;  3CC7 1;  1NJI 1;  3G6E 1;  1YJN Z;  1VQK Z;  3CXC Z;  1YIJ Z;  1VQ9 1;  1N8R 1;  1M90 1;  3CCV Z;  1YHQ Z;  1VQL 1;  3CCR 1;  1YJ9 1;  1VQM Z;  1KD1 1;  3CD6 Z;  3CC4 Z;  2QEX Z;  1YIT 1;  1JJ2 Y;  3CCQ Z;  3CME Z;  2QA4 Z;  1VQ6 Z;  1VQO 1;  1S72 Z;  1K8A 1;  3CC2 Z;  3I56 Z;  1Q86 2;  1VQN Z;  3CCJ 1;  3CXC Y;  1K9M 1;  1M1K 2;  3CMA Z;  1Q7Y 2;  3CCE Z;  3G4S 1;  1YJW Z;  1VQP 1;  1YI2 1;  1K73 2;  1KQS Z;  1VQ8 1;  1QVF Y;  2OTL Z;  3I55 Z;  1VQ4 Z;  3CCM 1;  3CCL 1;  1KC8 1;  2OTJ Z;  1VQK 1;  3G6E Z;  1VQ5 Z;  1YHQ 1;  1QVG Z;  1VQ9 Z;  1NJI 2;  1K9M 2;  3CPW Y;  1VQM 1;  1W2B Z;  3OW2 Z;  1VQL Z;  3CD6 1;  3CCR Z;  3CCU 1;  1N8R 2;  3CCS 1;  1M90 2;  1VQ7 1;  3G71 Z;  1YIT Z;  1KD1 2;  3CC2 1;  1VQO Z;  3CC7 Z;  1YJN 1;  3CCJ Z;  1YIJ 1;  1K8A 2;  3CCV 1;  3I55 1;  3G4S Z;  1VQP Z;  2OTL 1;  1YI2 Z;  3OW2 Y;  1VQ8 Z;  2OTJ 1;  3CCM Z;  1YJ9 Z;  3CCL Z;  1VQ5 1;  3CC4 1;  1Q81 1;  1Q82 1;  2QEX 1;  3CCQ 1;  1KC8 2; 
#chains in the Genus database with same CATH topology
 3NDI A;  1KQS Y;  1Q86 1;  1VQ6 1;  2JIO A;  3NH5 A;  4NBB A;  1K73 1;  3H0G I;  4Y7N I;  3CMA 1;  3CCE 1;  3IX0 A;  4A3F I;  4HGY A;  2Q51 A;  3GKQ A;  4A3E I;  1USP B;  3CPW Z;  1W2B Y;  2E9H A;  4NOZ A;  4RS4 A;  2GTH A;  3J81 f;  2V45 A;  3CXC Z;  1VQ9 1;  3S1N I;  3GTK I;  1YHQ Z;  3S2D I;  2QRE B;  2E2H I;  2RBL A;  3CD6 Z;  4HGZ A;  3GTP I;  2LFU A;  3CME Z;  2QA4 Z;  1X3Z A;  3EER A;  5C44 I;  2OOY B;  5A2Q b;  4A3K I;  3J80 f;  3PO2 I;  3J7A 4;  1Q7Y 2;  3G4S 1;  2P28 A;  3EED A;  4E33 A;  4NBE A;  1YI2 1;  4A3L I;  1VQ8 1;  3GTL I;  1VQ4 Z;  4RV9 A;  1Z03 A;  3H3V J;  1QVG Z;  2QKD A;  3CPW Y;  4NBD A;  2F4O A;  2ZAE B;  4MD7 A;  2WB1 A;  3CCR Z;  2DE7 A;  1Q16 A;  3T4N B;  3S1M I;  3K7A I;  1YIT Z;  1KD1 2;  3Q87 A;  2NVY I;  4E30 A;  5C4X I;  3CCJ Z;  1WZN A;  2OOX B;  2IZ3 A;  4DGL A;  4MD9 A;  1Y1V I;  4RVH A;  3OW2 Y;  2JA6 I;  2R92 I;  2GU2 A;  4E32 A;  3CCM Z;  1ZB8 A;  1VQ5 1;  1I3Q I;  4HH4 A;  3J81 b;  2VUG A;  1WJ2 A;  4E2Y A;  1Z01 A;  2EGT A;  3CME 1;  2QA4 1;  2V8J A;  2JA5 I;  2G2K A;  3CCU Z;  3RZO I;  1QVG Y;  1Q81 2;  2E7Z A;  3LUS A;  2B63 I;  1VQ4 1;  3M3Y I;  2PM9 A;  1KRL A;  3GTO I;  1YJN Z;  4E31 A;  5T6B A;  2O53 A;  2HF1 A;  3J80 b;  1N8R 1;  1M90 1;  1NP6 A;  3CCR 1;  1YJ9 1;  5C3E I;  3FQQ A;  1LQL A;  2V8I A;  2JIQ A;  3I4N I;  4RVF A;  1YIT 1;  2JUB A;  2E2I I;  1RO2 A;  1R9T I;  4BBR I;  2J6A A;  2F4M A;  3IF8 A;  1K8A 1;  2IV2 X;  3F3F C;  2K5R A;  3BG0 B;  3I56 Z;  2IZ4 A;  3CCJ 1;  1M1K 2;  2Q4Z A;  2DE6 A;  1YJW Z;  3KIH A;  2NVQ I;  5T64 A;  4MRI A;  2Y0S A;  4RVG A;  3CCM 1;  4MON A;  3VTN A;  3RZD I;  4BY7 I;  1KC8 1;  3G6E Z;  1VQ5 Z;  3U50 C;  3S16 I;  2OZK A;  3MZK B;  1NJI 2;  3NFZ A;  1VQM 1;  1RLY A;  3OW2 Z;  1ML8 A;  3JAM f;  1YUA A;  5FLX f;  3CCU 1;  2JNY A;  3I4M I;  4A93 I;  4NBF A;  4DQY B;  2JIP A;  3HOX I;  4X6A I;  5IT9 b;  2BJO A;  2RPR A;  3S15 I;  2K3R A;  3NH4 A;  2JIM A;  1RQF A;  4A3D I;  2V3V A;  1P9N A;  1YJN 1;  2LEX A;  3F3P C;  2RIQ A;  4NBG A;  2OTL 1;  1VQP Z;  2O4H A;  1QF8 A;  1ZB9 A;  2QRC B;  1YJ9 Z;  3CCL Z;  1TWG I;  5FLM I;  1WCM I;  1Q82 1;  3S14 I;  2KPI A;  1QVF Z;  2W03 A;  4A3B I;  1SFO I;  3I56 1;  1Q7Y 1;  3IR7 A;  3CCS Z;  2RT9 A;  3GTQ I;  1VQ7 Z;  3G71 1;  5AN9 F;  1YJW 1;  3NH8 A;  1FDO A;  3HKZ A;  3TE5 B;  4A3M I;  3D9X A;  3G6E 1;  2I3C A;  3GCF A;  1N2F A;  1Y1V S;  3HOU I;  1Y8C A;  4QTT A;  1VQM Z;  1KD1 1;  5D1O A;  2QEX Z;  1JJ2 Y;  2VPW A;  4E2Z A;  3S1Q I;  1ZH1 A;  1S72 Z;  3JAM b;  4DK1 A;  1Q86 2;  4E2W A;  3D2L A;  5FLX b;  4A3C I;  1JWH C;  1VQN Z;  3PO3 I;  3D6W A;  1K9M 1;  3GTM I;  4A3G I;  1VQP 1;  1K73 2;  3CQZ I;  1QVF Y;  4CL1 A;  2OTL Z;  4NFR A;  3MZL B;  2QLV B;  3CCL 1;  1VQK 1;  1TWC I;  2GTI A;  4Y52 I;  1TWA I;  3QWU A;  4BBS I;  2VPZ A;  3HOW I;  1VQL Z;  3CCS 1;  1FDI A;  4A3I I;  1SIW A;  3IFU A;  1VQ7 1;  1VLA A;  3G71 Z;  2AKL A;  3I07 A;  1QXF A;  2WAQ A;  5D1O B;  3CC2 1;  4MXU A;  3S17 I;  1VQO Z;  1I50 I;  1TFI A;  2VF1 A;  2R7Z I;  2M6N A;  2E2J I;  4NBH A;  3I55 1;  2R93 I;  2OTJ 1;  2V8K A;  4NH1 C;  2QEX 1;  2JMO A;  4NB8 A;  1AA6 A;  5CM2 M;  1L1O C;  2PK7 A;  4BY1 I;  2RHB A;  3HOY I;  3HOV I;  4RVD A;  1S72 1;  1M1K 1;  1VQN 1;  2YAD A;  2JS4 A;  1JJ2 Z;  1Q82 2;  1Z02 A;  2JA8 I;  3ESW A;  2DE5 A;  3CC7 1;  2P3Y A;  5IP7 I;  1NJI 1;  2JA7 I;  3MON A;  1RNI A;  1TWF I;  4AYB A;  2YU9 I;  1VQK Z;  1YIJ Z;  2VPY A;  3S2H I;  1NUI A;  4QTU A;  3CCV Z;  3VMH A;  1TWH I;  2R6M A;  3GTG I;  1VQL 1;  2JIR A;  2VUM I;  2VPX A;  5IP9 I;  5LL6 f;  3CC4 Z;  3S1R I;  5D1P A;  3CCQ Z;  2HU9 A;  2LIY A;  2JR6 A;  1VQ6 Z;  3P5J B;  1DL6 A;  1VQO 1;  3FKI I;  4A3J I;  2QRD B;  1Y1W I;  1PFT A;  3CC2 Z;  4E2X A;  2PMZ A;  1YUK A;  3CXC Y;  1QYP A;  3CMA Z;  2QR1 B;  3TDH B;  3CCE Z;  4BXX I;  1KQS Z;  4TNU A;  2NVT I;  3I55 Z;  3KIF A;  1WII A;  4NBC A;  2OTJ Z;  2KI7 B;  1K83 I;  1X0T A;  3HOZ I;  1X3W A;  2M48 A;  1YHQ 1;  3M4O I;  5C4J I;  1VQ9 Z;  1K9M 2;  3FQM A;  4MH4 A;  1W2B Z;  5A2Q f;  2AYD A;  1S7M A;  3CD6 1;  1N8R 2;  1M90 2;  4EWC A;  1USP A;  5IT9 f;  5T67 A;  2H85 A;  1RO4 A;  4NB9 A;  1WW9 A;  3CC7 Z;  2W04 A;  4NBA A;  3VMI A;  3VMG A;  1YIJ 1;  4XX2 A;  3VB9 A;  1K8A 2;  3PO3 S;  3CCV 1;  3G4S Z;  3NDJ A;  4S1T A;  1YI2 Z;  3GTM S;  1VQ8 Z;  3GTJ I;  2NVX I;  3CC4 1;  1Q81 1;  1I6H I;  4MD8 A;  1RO0 A;  3BG1 B;  3CCQ 1;  1KC8 2;  2NAP A; 
#chains in the Genus database with same CATH homology
 3NDI A;  1KQS Y;  1Q86 1;  1VQ6 1;  3NH5 A;  4NBB A;  1K73 1;  3H0G I;  4Y7N I;  3CMA 1;  3CCE 1;  3IX0 A;  4A3F I;  4HGY A;  2Q51 A;  3GKQ A;  4A3E I;  1USP B;  3CPW Z;  1W2B Y;  2E9H A;  4NOZ A;  4RS4 A;  2GTH A;  3J81 f;  3CXC Z;  1VQ9 1;  3S1N I;  3GTK I;  1YHQ Z;  3S2D I;  2QRE B;  2E2H I;  2RBL A;  3CD6 Z;  4HGZ A;  3GTP I;  2LFU A;  3CME Z;  2QA4 Z;  1X3Z A;  3EER A;  5C44 I;  2OOY B;  5A2Q b;  4A3K I;  3J80 f;  3PO2 I;  3J7A 4;  1Q7Y 2;  3G4S 1;  2P28 A;  3EED A;  4E33 A;  4NBE A;  1YI2 1;  4A3L I;  1VQ8 1;  3GTL I;  1VQ4 Z;  4RV9 A;  1Z03 A;  3H3V J;  1QVG Z;  2QKD A;  3CPW Y;  4NBD A;  2F4O A;  2ZAE B;  4MD7 A;  2WB1 A;  3CCR Z;  2DE7 A;  3T4N B;  3S1M I;  3K7A I;  1YIT Z;  1KD1 2;  3Q87 A;  2NVY I;  4E30 A;  5C4X I;  3CCJ Z;  2OOX B;  2IZ3 A;  4DGL A;  4MD9 A;  1Y1V I;  4RVH A;  3OW2 Y;  2JA6 I;  2R92 I;  2GU2 A;  4E32 A;  3CCM Z;  1ZB8 A;  1VQ5 1;  1I3Q I;  4HH4 A;  3J81 b;  2VUG A;  4E2Y A;  1Z01 A;  2EGT A;  3CME 1;  2QA4 1;  2V8J A;  2JA5 I;  2G2K A;  3CCU Z;  3RZO I;  1QVG Y;  1Q81 2;  3LUS A;  2B63 I;  1VQ4 1;  3M3Y I;  2PM9 A;  1KRL A;  3GTO I;  1YJN Z;  4E31 A;  5T6B A;  2O53 A;  2HF1 A;  3J80 b;  1N8R 1;  1M90 1;  1NP6 A;  3CCR 1;  1YJ9 1;  5C3E I;  3FQQ A;  1LQL A;  2V8I A;  3I4N I;  4RVF A;  1YIT 1;  2JUB A;  2E2I I;  1RO2 A;  1R9T I;  4BBR I;  2J6A A;  2F4M A;  3IF8 A;  1K8A 1;  3I56 Z;  3F3F C;  2K5R A;  3BG0 B;  2IZ4 A;  3CCJ 1;  1M1K 2;  2Q4Z A;  2DE6 A;  1YJW Z;  3KIH A;  2NVQ I;  5T64 A;  4MRI A;  2Y0S A;  4RVG A;  3CCM 1;  4MON A;  3VTN A;  3RZD I;  4BY7 I;  1KC8 1;  3G6E Z;  1VQ5 Z;  3U50 C;  3S16 I;  2OZK A;  3MZK B;  1NJI 2;  3NFZ A;  1VQM 1;  3OW2 Z;  1RLY A;  1ML8 A;  3JAM f;  1YUA A;  5FLX f;  3CCU 1;  2JNY A;  3I4M I;  4A93 I;  4NBF A;  4DQY B;  3HOX I;  4X6A I;  5IT9 b;  2BJO A;  2RPR A;  3S15 I;  2K3R A;  3NH4 A;  1RQF A;  4A3D I;  1P9N A;  1YJN 1;  3F3P C;  2RIQ A;  4NBG A;  2OTL 1;  1VQP Z;  2O4H A;  1QF8 A;  1ZB9 A;  2QRC B;  1YJ9 Z;  3CCL Z;  1TWG I;  5FLM I;  1WCM I;  1Q82 1;  3S14 I;  2KPI A;  1QVF Z;  2W03 A;  4A3B I;  1SFO I;  3I56 1;  1Q7Y 1;  3CCS Z;  2RT9 A;  3GTQ I;  1VQ7 Z;  3G71 1;  5AN9 F;  1YJW 1;  3NH8 A;  3HKZ A;  3TE5 B;  4A3M I;  3D9X A;  3G6E 1;  2I3C A;  3GCF A;  1N2F A;  1Y1V S;  3HOU I;  4QTT A;  1VQM Z;  1KD1 1;  5D1O A;  2QEX Z;  1JJ2 Y;  4E2Z A;  3S1Q I;  1ZH1 A;  1S72 Z;  3JAM b;  4DK1 A;  1Q86 2;  5FLX b;  4E2W A;  4A3C I;  1JWH C;  1VQN Z;  3PO3 I;  3D6W A;  1K9M 1;  3GTM I;  4A3G I;  1VQP 1;  1K73 2;  3CQZ I;  1QVF Y;  4CL1 A;  2OTL Z;  4NFR A;  3MZL B;  2QLV B;  3CCL 1;  1VQK 1;  1TWC I;  2GTI A;  4Y52 I;  1TWA I;  3QWU A;  4BBS I;  3HOW I;  1VQL Z;  3CCS 1;  4A3I I;  3IFU A;  1VQ7 1;  1VLA A;  3G71 Z;  2AKL A;  3I07 A;  2WAQ A;  5D1O B;  3CC2 1;  4MXU A;  3S17 I;  1VQO Z;  1I50 I;  1TFI A;  2VF1 A;  2R7Z I;  2M6N A;  2E2J I;  4NBH A;  3I55 1;  2R93 I;  2OTJ 1;  2V8K A;  4NH1 C;  2QEX 1;  2JMO A;  4NB8 A;  4BY1 I;  5CM2 M;  1L1O C;  2PK7 A;  2RHB A;  3HOY I;  3HOV I;  4RVD A;  1S72 1;  1M1K 1;  1VQN 1;  2YAD A;  2JS4 A;  1JJ2 Z;  1Q82 2;  1Z02 A;  2JA8 I;  3ESW A;  2DE5 A;  3CC7 1;  2P3Y A;  5IP7 I;  1NJI 1;  2JA7 I;  3MON A;  1RNI A;  1TWF I;  4AYB A;  2YU9 I;  1VQK Z;  1YIJ Z;  3S2H I;  1NUI A;  4QTU A;  3CCV Z;  3VMH A;  1TWH I;  2R6M A;  3GTG I;  1VQL 1;  2VUM I;  5IP9 I;  5LL6 f;  3CC4 Z;  3S1R I;  5D1P A;  3CCQ Z;  2HU9 A;  2LIY A;  2JR6 A;  1VQ6 Z;  3P5J B;  1DL6 A;  1VQO 1;  3FKI I;  4A3J I;  2QRD B;  1Y1W I;  1PFT A;  3CC2 Z;  4E2X A;  2PMZ A;  1YUK A;  3CXC Y;  1QYP A;  3CMA Z;  2QR1 B;  3TDH B;  3CCE Z;  4BXX I;  1KQS Z;  4TNU A;  2NVT I;  3I55 Z;  3KIF A;  1WII A;  4NBC A;  2OTJ Z;  2KI7 B;  1K83 I;  1X0T A;  3HOZ I;  1X3W A;  2M48 A;  1YHQ 1;  3M4O I;  5C4J I;  1VQ9 Z;  1K9M 2;  3FQM A;  4MH4 A;  1W2B Z;  5A2Q f;  1S7M A;  3CD6 1;  1N8R 2;  1M90 2;  4EWC A;  1USP A;  5IT9 f;  5T67 A;  2H85 A;  1RO4 A;  4NB9 A;  1WW9 A;  3CC7 Z;  2W04 A;  4NBA A;  3VMI A;  3VMG A;  1YIJ 1;  4XX2 A;  3VB9 A;  1K8A 2;  3PO3 S;  3CCV 1;  3G4S Z;  3NDJ A;  4S1T A;  1YI2 Z;  3GTM S;  1VQ8 Z;  3GTJ I;  2NVX I;  3CC4 1;  1Q81 1;  1I6H I;  4MD8 A;  1RO0 A;  3BG1 B;  3CCQ 1;  1KC8 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...