3CC7Z

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2487u
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
b'SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cc7Z00
3CCL1 1VQ71 1Q812 1VQNZ 1VQN1 3OW2Z 3CCJZ 1S721 1W2BZ 2OTLZ 1K731 1VQ4Z 2OTL1 1VQ41 3CMAZ 2QA4Z 1NJI2 1VQKZ 1M1K1 2QA41 1VQK1 3CCQZ 1YHQZ 3CCQ1 1YHQ1 1VQ8Z 1Q7Y1 3CD6Z 3CD61 1K9M1 3CCLZ 1JJ2Z 1N8R2 1KC81 1Q862 1S72Z 1K8A2 1YI21 3CCSZ 1M901 1Q822 1KD11 1QVGY 3CCS1 1VQP1 1YJN1 1Q811 3CC4Z 1YITZ 3CC41 1YIT1 1QVFY 3I56Z 3CCVZ 3CCUZ 3I561 3CCV1 3CCU1 1NJI1 2OTJ1 1K732 3CCR1 1M1K2 1YI2Z 1VQMZ 3CPWY 3CXCY 1VQM1 1YJNZ 1VQPZ 1VQ9Z 1VQ5Z 3G6EZ 1VQ91 1QVGZ 1KQSY 1VQ51 3G6E1 1YJWZ 3I551 1N8R1 1Q7Y2 1Q861 1KQSZ 1YJW1 2QEXZ 3OW2Y 3CMEZ 2QEX1 1K8A1 1K9M2 1VQ6Z 3CME1 1W2BY 1YJ9Z 3CCMZ 3G71Z 1VQOZ 1VQ61 3CCJ1 1YJ91 1QVFZ 1KC82 3CCM1 3G711 1VQO1 2OTJZ 3G4SZ 1VQLZ 3G4S1 3CMA1 1VQL1 1YIJZ 3CCRZ 1YIJ1 1Q821 3CC2Z 3CC7Z 3CC21 3CC71 3CCEZ 1VQ81 1M902 3CPWZ 3CCE1 1KD12 3CXCZ 3I55Z 1JJ2Y 1VQ7Z
chains in the Genus database with same CATH superfamily
4S1TA 1ML8A 2JIOA 3I4MI 1VQ71 3VMIA 1L1OC 2JIMA 4NH1C 2OOXB 2OTLZ 2OTL1 4NOZA 1VQKZ 4RV9A 5A2Qb 1VQK1 1TWGI 5C4XI 3GTLI 2QRCB 2QR1B 3HKZA 4A3MI 3BG0B 3S2DI 2JMOA 3GTOI 2Y0SA 2HF1A 1X0TA 1JWHC 4NB9A 1K9M1 3CCLZ 2V8JA 2NVTI 1JJ2Z 1N8R2 2PM9A 5FLMI 4NBHA 1K8A2 4CL1A 2V3VA 4A3FI 1PFTA 4HGYA 3KIHA 1TFIA 5FLXf 1WCMI 4MRIA 4MXUA 1YI21 3CCSZ 1Q822 3M4OI 3CCS1 1YUKA 3P5JB 2JIRA 1Q811 2RIQA 4E2WA 4A3DI 3F3FC 4Y52I 2JA5I 1YITZ 2GTHA 4RVFA 1YIT1 2QRDB 3LUSA 3GTMS 2OOYB 3CCVZ 2RHBA 3CCV1 1NJI1 4HGZA 2VUGA 1K732 1TWHI 3GTMI 1VQPZ 1YJNZ 3D9XA 5IT9f 4E30A 2HU9A 3CMEZ 3CME1 3IR7A 1YJ9Z 2JR6A 1X3WA 4A3KI 1YJ91 4E31A 4XX2A 2NVXI 2OTJZ 1SIWA 4E32A 5IP9I 2YU9I 3HOVI 5IP7I 1M902 5D1PA 3I4NI 3S17I 2JIQA 1JJ2Y 4MH4A 3H3VJ 1DL6A 3ESWA 1S721 3HOUI 2F4MA 1P9NA 1NP6A 2VPYA 3VTNA 1M1K1 1FDIA 1RNIA 3CCQZ 1I6HI 3NDJA 4TNUA 3CCQ1 1X3ZA 4RVGA 1Q7Y1 2RPRA 5D1OB 3HOZI 2O4HA 1I3QI 2WB1A 1KC81 4A3BI 5C44I 3S2HI 1QXFA 3GCFA 1VLAA 1Z01A 2F4OA 2B63I 3M3YI 3FKII 5C3EI 2V8IA 2R7ZI 2M48A 1Z03A 1I50I 3U50C 5C4JI 3S14I 4MD9A 5T64A 5CM2M 3Q87A 3QWUA 3IF8A 3GTQI 4E2ZA 2JIPA 3FQQA 3GTPI 2W04A 2KI7B 3CCR1 5A2Qf 3NH5A 1USPA 1YI2Z 2G2KA 2O53A 1Y1WI 1QVGZ 3I551 1YJWZ 4EWCA 1Q861 1KQSZ 1YJW1 2H85A 3JAMb 1SFOI 3D2LA 3J7A4 1K9M2 1VQ6Z 4NBCA 3VMGA 1VQ61 4MD8A 3CCJ1 3G4SZ 3G4S1 3CQZI 1K83I 1Y8CA 2PMZA 4RS4A 3CMA1 2RBLA 2IV2X 3S1NI 3NH4A 3IFUA 3MONA 2P3YA 4NBAA 2V8KA 3S1QI 2JA7I 1Y1VS 1WW9A 3NDIA 1VQ81 1KRLA 4DGLA 3CPWZ 3S1MI 3CXCZ 1RLYA 1Q812 1VQNZ 1VQN1 4E2XA 3T4NB 2R92I 1VQ4Z 3J80b 1TWFI 2NVYI 1Y1VI 4A3JI 3F3PC 1VQ41 4NBFA 1LQLA 2QA4Z 1NJI2 2DE5A 4NFRA 2QA41 2VF1A 1RO0A 3GTGI 1YHQZ 4A3II 1YHQ1 3J81b 1USPB 4RVDA 4E2YA 3FQMA 3PO3I 4A3EI 1S72Z 4NBEA 1WIIA 3MZKB 5T67A 2E2HI 5T6BA 1KD11 1QVGY 2P28A 2VPZA 3S1RI 3CC4Z 3PO2I 3CC41 3I56Z 4AYBA 4BXXI 3CCUZ 3I561 3CCU1 2LFUA 4NBGA 4BBSI 2R93I 2QLVB 3VB9A 2AKLA 2LIYA 1M1K2 1RO4A 1QYPA 1VQMZ 3CPWY 3CXCY 1VQM1 4Y7NI 1N8R1 1Q7Y2 2QEXZ 2VPWA 2JS4A 1FDOA 2QEX1 1K8A1 2R6MA 2JA8I 1VQOZ 3NH8A 4E33A 1ZB9A 1QVFZ 1KC82 1ZB8A 1VQO1 1WJ2A 5LL6f 3TE5B 2QKDA 3K7AI 1N2FA 5FLXb 2DE7A 3CCRZ 2K3RA 1Q821 3CC2Z 3CC7Z 3MZLB 2K5RA 2V45A 3CC21 3HOYI 3CC71 4A3LI 4MONA 1AA6A 2KPIA 2AYDA 2WAQA 1RO2A 2NAPA 3I55Z 3GTKI 4A3GI 2J6AA 3CCL1 3VMHA 4BBRI 4A3CI 3OW2Z 2PK7A 3CCJZ 4DQYB 3S15I 1RQFA 1W2BZ 3EERA 1K731 1TWCI 2VPXA 2GTIA 3CMAZ 4HH4A 1YUAA 4MD7A 3NFZA 3I07A 5IT9b 1VQ8Z 3D6WA 3CD6Z 4A93I 1ZH1A 2IZ4A 3CD61 3TDHB 4DK1A 2LEXA 1Q862 3JAMf 1R9TI 3BG1B 5AN9F 2JNYA 1TWAI 2RT9A 3PO3S 4NBDA 3GTJI 3EEDA 2IZ3A 4X6AI 2ZAEB 4BY1I 5D1OA 1M901 2BJOA 1VQP1 1YJN1 2W03A 1Q16A 2JA6I 1Z02A 4RVHA 2E2JI 1QVFY 3RZOI 2OZKA 4BY7I 3KIFA 2JUBA 2OTJ1 2E2II 3GKQA 2M6NA 2E7ZA 3J80f 2E9HA 2DE6A 2EGTA 4NBBA 3HOWI 2VUMI 4NB8A 1VQ9Z 1VQ5Z 3H0GI 3J81f 3G6EZ 1VQ91 3IX0A 1KQSY 1VQ51 3G6E1 3RZDI 3OW2Y 1S7MA 2Q4ZA 2QREB 1W2BY 2I3CA 2Q51A 3CCMZ 3G71Z 4QTUA 3CCM1 3G711 3S16I 3HOXI 2YADA 1QF8A 1VQLZ 2NVQI 1VQL1 1YIJZ 1YIJ1 1NUIA 1WZNA 3CCEZ 4QTTA 3CCE1 1KD12 2GU2A 1VQ7Z
chains in the Genus database with same CATH topology
4S1TA 1ML8A 3I4MI 1VQ71 3VMIA 1L1OC 4NH1C 2OOXB 2OTLZ 2OTL1 4NOZA 1VQKZ 4RV9A 5A2Qb 1VQK1 1TWGI 5C4XI 3GTLI 2QRCB 2QR1B 3HKZA 4A3MI 3BG0B 3S2DI 2JMOA 3GTOI 2Y0SA 2HF1A 1X0TA 1JWHC 4NB9A 1K9M1 3CCLZ 2V8JA 2NVTI 1JJ2Z 1N8R2 2PM9A 5FLMI 4NBHA 1K8A2 4CL1A 4A3FI 1PFTA 4HGYA 3KIHA 1TFIA 5FLXf 1WCMI 4MRIA 4MXUA 1YI21 3CCSZ 1Q822 3M4OI 3CCS1 1YUKA 3P5JB 1Q811 2RIQA 4E2WA 4A3DI 3F3FC 4Y52I 2JA5I 1YITZ 2GTHA 4RVFA 1YIT1 2QRDB 3LUSA 3GTMS 2OOYB 3CCVZ 2RHBA 3CCV1 1NJI1 4HGZA 2VUGA 1K732 1TWHI 3GTMI 1VQPZ 1YJNZ 3D9XA 5IT9f 4E30A 2HU9A 3CMEZ 3CME1 1YJ9Z 2JR6A 4A3KI 1X3WA 1YJ91 4E31A 4XX2A 2NVXI 2OTJZ 4E32A 5IP9I 2YU9I 3HOVI 5IP7I 1M902 5D1PA 3I4NI 3S17I 1JJ2Y 4MH4A 3H3VJ 1DL6A 3ESWA 1S721 3HOUI 2F4MA 1P9NA 1NP6A 3VTNA 1M1K1 1RNIA 3CCQZ 1I6HI 3NDJA 4TNUA 3CCQ1 1X3ZA 4RVGA 1Q7Y1 2RPRA 5D1OB 3HOZI 2O4HA 1I3QI 2WB1A 1KC81 4A3BI 5C44I 3S2HI 3GCFA 1VLAA 1Z01A 2F4OA 2B63I 3M3YI 3FKII 5C3EI 2V8IA 2R7ZI 2M48A 1Z03A 1I50I 3U50C 5C4JI 3S14I 4MD9A 5T64A 5CM2M 3Q87A 3QWUA 3IF8A 3GTQI 4E2ZA 3GTPI 3FQQA 2W04A 2KI7B 3CCR1 5A2Qf 3NH5A 1USPA 1YI2Z 2G2KA 2O53A 1Y1WI 1QVGZ 3I551 1YJWZ 4EWCA 1Q861 1KQSZ 1YJW1 2H85A 3JAMb 1SFOI 3J7A4 1K9M2 1VQ6Z 4NBCA 3VMGA 1VQ61 4MD8A 3CCJ1 3G4SZ 3G4S1 3CQZI 1K83I 2PMZA 4RS4A 3CMA1 3S1NI 2RBLA 3NH4A 3IFUA 3MONA 2P3YA 4NBAA 2V8KA 3S1QI 2JA7I 1Y1VS 1WW9A 3NDIA 1VQ81 1KRLA 4DGLA 3CPWZ 3S1MI 3CXCZ 1RLYA 1Q812 1VQNZ 1VQN1 4E2XA 3T4NB 2R92I 1VQ4Z 3J80b 1TWFI 2NVYI 1Y1VI 4A3JI 3F3PC 1VQ41 4NBFA 1LQLA 2QA4Z 1NJI2 2DE5A 4NFRA 2QA41 2VF1A 1RO0A 3GTGI 1YHQZ 4A3II 1YHQ1 3J81b 1USPB 4RVDA 4E2YA 3FQMA 3PO3I 4A3EI 1S72Z 4NBEA 1WIIA 3MZKB 5T67A 2E2HI 5T6BA 1KD11 1QVGY 2P28A 3S1RI 3CC4Z 3PO2I 3CC41 3I56Z 4AYBA 4BXXI 3CCUZ 3I561 3CCU1 2LFUA 4NBGA 4BBSI 2R93I 2QLVB 3VB9A 2AKLA 2LIYA 1M1K2 1RO4A 1QYPA 1VQMZ 3CPWY 3CXCY 1VQM1 4Y7NI 1N8R1 1Q7Y2 2QEXZ 2JS4A 2QEX1 1K8A1 2R6MA 2JA8I 1VQOZ 3NH8A 4E33A 1ZB9A 1QVFZ 1KC82 1VQO1 1ZB8A 5LL6f 3TE5B 2QKDA 3K7AI 1N2FA 5FLXb 2DE7A 3CCRZ 2K3RA 1Q821 3CC2Z 3CC7Z 3MZLB 2K5RA 3CC21 3HOYI 3CC71 4A3LI 4MONA 2KPIA 2WAQA 1RO2A 3I55Z 3GTKI 4A3GI 2J6AA 3CCL1 3VMHA 4BBRI 4A3CI 3OW2Z 2PK7A 3CCJZ 4DQYB 3S15I 1RQFA 1W2BZ 3EERA 1K731 1TWCI 2GTIA 3CMAZ 4HH4A 1YUAA 4MD7A 3NFZA 3I07A 5IT9b 1VQ8Z 3D6WA 3CD6Z 4A93I 1ZH1A 2IZ4A 3CD61 3TDHB 4DK1A 1Q862 3JAMf 1R9TI 3BG1B 5AN9F 2JNYA 1TWAI 2RT9A 3PO3S 4NBDA 3GTJI 3EEDA 2IZ3A 4X6AI 2ZAEB 4BY1I 5D1OA 1M901 2BJOA 1VQP1 1YJN1 2W03A 2JA6I 1Z02A 4RVHA 2E2JI 1QVFY 3RZOI 2OZKA 4BY7I 3KIFA 2JUBA 2OTJ1 2E2II 3GKQA 2M6NA 3J80f 2E9HA 2DE6A 2EGTA 4NBBA 3HOWI 2VUMI 4NB8A 1VQ9Z 1VQ5Z 3H0GI 3J81f 3G6EZ 1VQ91 3IX0A 1KQSY 1VQ51 3G6E1 3RZDI 3OW2Y 1S7MA 2Q4ZA 2QREB 1W2BY 2I3CA 2Q51A 3CCMZ 3G71Z 4QTUA 3CCM1 3G711 3S16I 3HOXI 2YADA 1QF8A 1VQLZ 2NVQI 1VQL1 1YIJZ 1YIJ1 1NUIA 3CCEZ 4QTTA 3CCE1 1KD12 2GU2A 1VQ7Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCL 1;  1VQ7 1;  1Q81 2;  1VQN Z;  1VQN 1;  3OW2 Z;  3CCJ Z;  1S72 1;  1W2B Z;  2OTL Z;  1K73 1;  1VQ4 Z;  2OTL 1;  1VQ4 1;  3CMA Z;  2QA4 Z;  1NJI 2;  1VQK Z;  1M1K 1;  2QA4 1;  1VQK 1;  3CCQ Z;  1YHQ Z;  3CCQ 1;  1YHQ 1;  1VQ8 Z;  1Q7Y 1;  3CD6 Z;  3CD6 1;  1K9M 1;  3CCL Z;  1JJ2 Z;  1N8R 2;  1KC8 1;  1Q86 2;  1S72 Z;  1K8A 2;  1YI2 1;  3CCS Z;  1M90 1;  1Q82 2;  1KD1 1;  1QVG Y;  3CCS 1;  1VQP 1;  1YJN 1;  1Q81 1;  3CC4 Z;  1YIT Z;  3CC4 1;  1YIT 1;  1QVF Y;  3I56 Z;  3CCV Z;  3CCU Z;  3I56 1;  3CCV 1;  3CCU 1;  1NJI 1;  2OTJ 1;  1K73 2;  3CCR 1;  1M1K 2;  1YI2 Z;  1VQM Z;  3CPW Y;  3CXC Y;  1VQM 1;  1YJN Z;  1VQP Z;  1VQ9 Z;  1VQ5 Z;  3G6E Z;  1VQ9 1;  1QVG Z;  1KQS Y;  1VQ5 1;  3G6E 1;  1YJW Z;  3I55 1;  1N8R 1;  1Q7Y 2;  1Q86 1;  1KQS Z;  1YJW 1;  2QEX Z;  3OW2 Y;  3CME Z;  2QEX 1;  1K8A 1;  1K9M 2;  1VQ6 Z;  3CME 1;  1W2B Y;  1YJ9 Z;  3CCM Z;  3G71 Z;  1VQO Z;  1VQ6 1;  3CCJ 1;  1YJ9 1;  1QVF Z;  1KC8 2;  3CCM 1;  3G71 1;  1VQO 1;  2OTJ Z;  3G4S Z;  1VQL Z;  3G4S 1;  3CMA 1;  1VQL 1;  1YIJ Z;  3CCR Z;  1YIJ 1;  1Q82 1;  3CC2 Z;  3CC7 Z;  3CC2 1;  3CC7 1;  3CCE Z;  1VQ8 1;  1M90 2;  3CPW Z;  3CCE 1;  1KD1 2;  3CXC Z;  3I55 Z;  1JJ2 Y;  1VQ7 Z; 
#chains in the Genus database with same CATH topology
 4S1T A;  1ML8 A;  2JIO A;  3I4M I;  1VQ7 1;  3VMI A;  1L1O C;  2JIM A;  4NH1 C;  2OOX B;  2OTL Z;  2OTL 1;  4NOZ A;  1VQK Z;  4RV9 A;  5A2Q b;  1VQK 1;  1TWG I;  5C4X I;  3GTL I;  2QRC B;  2QR1 B;  3HKZ A;  4A3M I;  3BG0 B;  3S2D I;  2JMO A;  3GTO I;  2Y0S A;  2HF1 A;  1X0T A;  1JWH C;  4NB9 A;  1K9M 1;  3CCL Z;  2V8J A;  2NVT I;  1JJ2 Z;  1N8R 2;  2PM9 A;  5FLM I;  4NBH A;  1K8A 2;  4CL1 A;  2V3V A;  4A3F I;  1PFT A;  4HGY A;  3KIH A;  1TFI A;  5FLX f;  1WCM I;  4MRI A;  4MXU A;  1YI2 1;  3CCS Z;  1Q82 2;  3M4O I;  3CCS 1;  1YUK A;  3P5J B;  2JIR A;  1Q81 1;  2RIQ A;  4E2W A;  4A3D I;  3F3F C;  4Y52 I;  2JA5 I;  1YIT Z;  2GTH A;  4RVF A;  1YIT 1;  2QRD B;  3LUS A;  3GTM S;  2OOY B;  3CCV Z;  2RHB A;  3CCV 1;  1NJI 1;  4HGZ A;  2VUG A;  1K73 2;  1TWH I;  3GTM I;  1VQP Z;  1YJN Z;  3D9X A;  5IT9 f;  4E30 A;  2HU9 A;  3CME Z;  3CME 1;  3IR7 A;  1YJ9 Z;  2JR6 A;  1X3W A;  4A3K I;  1YJ9 1;  4E31 A;  4XX2 A;  2NVX I;  2OTJ Z;  1SIW A;  4E32 A;  5IP9 I;  2YU9 I;  3HOV I;  5IP7 I;  1M90 2;  5D1P A;  3I4N I;  3S17 I;  2JIQ A;  1JJ2 Y;  4MH4 A;  3H3V J;  1DL6 A;  3ESW A;  1S72 1;  3HOU I;  2F4M A;  1P9N A;  1NP6 A;  2VPY A;  3VTN A;  1M1K 1;  1FDI A;  1RNI A;  3CCQ Z;  1I6H I;  3NDJ A;  4TNU A;  3CCQ 1;  1X3Z A;  4RVG A;  1Q7Y 1;  2RPR A;  5D1O B;  3HOZ I;  2O4H A;  1I3Q I;  2WB1 A;  1KC8 1;  4A3B I;  5C44 I;  3S2H I;  1QXF A;  3GCF A;  1VLA A;  1Z01 A;  2F4O A;  2B63 I;  3M3Y I;  3FKI I;  5C3E I;  2V8I A;  2R7Z I;  2M48 A;  1Z03 A;  1I50 I;  3U50 C;  5C4J I;  3S14 I;  4MD9 A;  5T64 A;  5CM2 M;  3Q87 A;  3QWU A;  3IF8 A;  3GTQ I;  4E2Z A;  2JIP A;  3FQQ A;  3GTP I;  2W04 A;  2KI7 B;  3CCR 1;  5A2Q f;  3NH5 A;  1USP A;  1YI2 Z;  2G2K A;  2O53 A;  1Y1W I;  1QVG Z;  3I55 1;  1YJW Z;  4EWC A;  1Q86 1;  1KQS Z;  1YJW 1;  2H85 A;  3JAM b;  1SFO I;  3D2L A;  3J7A 4;  1K9M 2;  1VQ6 Z;  4NBC A;  3VMG A;  1VQ6 1;  4MD8 A;  3CCJ 1;  3G4S Z;  3G4S 1;  3CQZ I;  1K83 I;  1Y8C A;  2PMZ A;  4RS4 A;  3CMA 1;  2RBL A;  2IV2 X;  3S1N I;  3NH4 A;  3IFU A;  3MON A;  2P3Y A;  4NBA A;  2V8K A;  3S1Q I;  2JA7 I;  1Y1V S;  1WW9 A;  3NDI A;  1VQ8 1;  1KRL A;  4DGL A;  3CPW Z;  3S1M I;  3CXC Z;  1RLY A;  1Q81 2;  1VQN Z;  1VQN 1;  4E2X A;  3T4N B;  2R92 I;  1VQ4 Z;  3J80 b;  1TWF I;  2NVY I;  1Y1V I;  4A3J I;  3F3P C;  1VQ4 1;  4NBF A;  1LQL A;  2QA4 Z;  1NJI 2;  2DE5 A;  4NFR A;  2QA4 1;  2VF1 A;  1RO0 A;  3GTG I;  1YHQ Z;  4A3I I;  1YHQ 1;  3J81 b;  1USP B;  4RVD A;  4E2Y A;  3FQM A;  3PO3 I;  4A3E I;  1S72 Z;  4NBE A;  1WII A;  3MZK B;  5T67 A;  2E2H I;  5T6B A;  1KD1 1;  1QVG Y;  2P28 A;  2VPZ A;  3S1R I;  3CC4 Z;  3PO2 I;  3CC4 1;  3I56 Z;  4AYB A;  4BXX I;  3CCU Z;  3I56 1;  3CCU 1;  2LFU A;  4NBG A;  4BBS I;  2R93 I;  2QLV B;  3VB9 A;  2AKL A;  2LIY A;  1M1K 2;  1RO4 A;  1QYP A;  1VQM Z;  3CPW Y;  3CXC Y;  1VQM 1;  4Y7N I;  1N8R 1;  1Q7Y 2;  2QEX Z;  2VPW A;  2JS4 A;  1FDO A;  2QEX 1;  1K8A 1;  2R6M A;  2JA8 I;  1VQO Z;  3NH8 A;  4E33 A;  1ZB9 A;  1QVF Z;  1KC8 2;  1ZB8 A;  1VQO 1;  1WJ2 A;  5LL6 f;  3TE5 B;  2QKD A;  3K7A I;  1N2F A;  5FLX b;  2DE7 A;  3CCR Z;  2K3R A;  1Q82 1;  3CC2 Z;  3CC7 Z;  3MZL B;  2K5R A;  2V45 A;  3CC2 1;  3HOY I;  3CC7 1;  4A3L I;  4MON A;  1AA6 A;  2KPI A;  2AYD A;  2WAQ A;  1RO2 A;  2NAP A;  3I55 Z;  3GTK I;  4A3G I;  2J6A A;  3CCL 1;  3VMH A;  4BBR I;  4A3C I;  3OW2 Z;  2PK7 A;  3CCJ Z;  4DQY B;  3S15 I;  1RQF A;  1W2B Z;  3EER A;  1K73 1;  1TWC I;  2VPX A;  2GTI A;  3CMA Z;  4HH4 A;  1YUA A;  4MD7 A;  3NFZ A;  3I07 A;  5IT9 b;  1VQ8 Z;  3D6W A;  3CD6 Z;  4A93 I;  1ZH1 A;  2IZ4 A;  3CD6 1;  3TDH B;  4DK1 A;  2LEX A;  1Q86 2;  3JAM f;  1R9T I;  3BG1 B;  5AN9 F;  2JNY A;  1TWA I;  2RT9 A;  3PO3 S;  4NBD A;  3GTJ I;  3EED A;  2IZ3 A;  4X6A I;  2ZAE B;  4BY1 I;  5D1O A;  1M90 1;  2BJO A;  1VQP 1;  1YJN 1;  2W03 A;  1Q16 A;  2JA6 I;  1Z02 A;  4RVH A;  2E2J I;  1QVF Y;  3RZO I;  2OZK A;  4BY7 I;  3KIF A;  2JUB A;  2OTJ 1;  2E2I I;  3GKQ A;  2M6N A;  2E7Z A;  3J80 f;  2E9H A;  2DE6 A;  2EGT A;  4NBB A;  3HOW I;  2VUM I;  4NB8 A;  1VQ9 Z;  1VQ5 Z;  3H0G I;  3J81 f;  3G6E Z;  1VQ9 1;  3IX0 A;  1KQS Y;  1VQ5 1;  3G6E 1;  3RZD I;  3OW2 Y;  1S7M A;  2Q4Z A;  2QRE B;  1W2B Y;  2I3C A;  2Q51 A;  3CCM Z;  3G71 Z;  4QTU A;  3CCM 1;  3G71 1;  3S16 I;  3HOX I;  2YAD A;  1QF8 A;  1VQL Z;  2NVQ I;  1VQL 1;  1YIJ Z;  1YIJ 1;  1NUI A;  1WZN A;  3CCE Z;  4QTT A;  3CCE 1;  1KD1 2;  2GU2 A;  1VQ7 Z; 
#chains in the Genus database with same CATH homology
 4S1T A;  1ML8 A;  3I4M I;  1VQ7 1;  3VMI A;  1L1O C;  4NH1 C;  2OOX B;  2OTL Z;  2OTL 1;  4NOZ A;  1VQK Z;  4RV9 A;  5A2Q b;  1VQK 1;  1TWG I;  5C4X I;  3GTL I;  2QRC B;  2QR1 B;  3HKZ A;  4A3M I;  3BG0 B;  3S2D I;  2JMO A;  3GTO I;  2Y0S A;  2HF1 A;  1X0T A;  1JWH C;  4NB9 A;  1K9M 1;  3CCL Z;  2V8J A;  2NVT I;  1JJ2 Z;  1N8R 2;  2PM9 A;  5FLM I;  4NBH A;  1K8A 2;  4CL1 A;  4A3F I;  1PFT A;  4HGY A;  3KIH A;  1TFI A;  5FLX f;  1WCM I;  4MRI A;  4MXU A;  1YI2 1;  3CCS Z;  1Q82 2;  3M4O I;  3CCS 1;  1YUK A;  3P5J B;  1Q81 1;  2RIQ A;  4E2W A;  4A3D I;  3F3F C;  4Y52 I;  2JA5 I;  1YIT Z;  2GTH A;  4RVF A;  1YIT 1;  2QRD B;  3LUS A;  3GTM S;  2OOY B;  3CCV Z;  2RHB A;  3CCV 1;  1NJI 1;  4HGZ A;  2VUG A;  1K73 2;  1TWH I;  3GTM I;  1VQP Z;  1YJN Z;  3D9X A;  5IT9 f;  4E30 A;  2HU9 A;  3CME Z;  3CME 1;  1YJ9 Z;  2JR6 A;  4A3K I;  1X3W A;  1YJ9 1;  4E31 A;  4XX2 A;  2NVX I;  2OTJ Z;  4E32 A;  5IP9 I;  2YU9 I;  3HOV I;  5IP7 I;  1M90 2;  5D1P A;  3I4N I;  3S17 I;  1JJ2 Y;  4MH4 A;  3H3V J;  1DL6 A;  3ESW A;  1S72 1;  3HOU I;  2F4M A;  1P9N A;  1NP6 A;  3VTN A;  1M1K 1;  1RNI A;  3CCQ Z;  1I6H I;  3NDJ A;  4TNU A;  3CCQ 1;  1X3Z A;  4RVG A;  1Q7Y 1;  2RPR A;  5D1O B;  3HOZ I;  2O4H A;  1I3Q I;  2WB1 A;  1KC8 1;  4A3B I;  5C44 I;  3S2H I;  3GCF A;  1VLA A;  1Z01 A;  2F4O A;  2B63 I;  3M3Y I;  3FKI I;  5C3E I;  2V8I A;  2R7Z I;  2M48 A;  1Z03 A;  1I50 I;  3U50 C;  5C4J I;  3S14 I;  4MD9 A;  5T64 A;  5CM2 M;  3Q87 A;  3QWU A;  3IF8 A;  3GTQ I;  4E2Z A;  3GTP I;  3FQQ A;  2W04 A;  2KI7 B;  3CCR 1;  5A2Q f;  3NH5 A;  1USP A;  1YI2 Z;  2G2K A;  2O53 A;  1Y1W I;  1QVG Z;  3I55 1;  1YJW Z;  4EWC A;  1Q86 1;  1KQS Z;  1YJW 1;  2H85 A;  3JAM b;  1SFO I;  3J7A 4;  1K9M 2;  1VQ6 Z;  4NBC A;  3VMG A;  1VQ6 1;  4MD8 A;  3CCJ 1;  3G4S Z;  3G4S 1;  3CQZ I;  1K83 I;  2PMZ A;  4RS4 A;  3CMA 1;  3S1N I;  2RBL A;  3NH4 A;  3IFU A;  3MON A;  2P3Y A;  4NBA A;  2V8K A;  3S1Q I;  2JA7 I;  1Y1V S;  1WW9 A;  3NDI A;  1VQ8 1;  1KRL A;  4DGL A;  3CPW Z;  3S1M I;  3CXC Z;  1RLY A;  1Q81 2;  1VQN Z;  1VQN 1;  4E2X A;  3T4N B;  2R92 I;  1VQ4 Z;  3J80 b;  1TWF I;  2NVY I;  1Y1V I;  4A3J I;  3F3P C;  1VQ4 1;  4NBF A;  1LQL A;  2QA4 Z;  1NJI 2;  2DE5 A;  4NFR A;  2QA4 1;  2VF1 A;  1RO0 A;  3GTG I;  1YHQ Z;  4A3I I;  1YHQ 1;  3J81 b;  1USP B;  4RVD A;  4E2Y A;  3FQM A;  3PO3 I;  4A3E I;  1S72 Z;  4NBE A;  1WII A;  3MZK B;  5T67 A;  2E2H I;  5T6B A;  1KD1 1;  1QVG Y;  2P28 A;  3S1R I;  3CC4 Z;  3PO2 I;  3CC4 1;  3I56 Z;  4AYB A;  4BXX I;  3CCU Z;  3I56 1;  3CCU 1;  2LFU A;  4NBG A;  4BBS I;  2R93 I;  2QLV B;  3VB9 A;  2AKL A;  2LIY A;  1M1K 2;  1RO4 A;  1QYP A;  1VQM Z;  3CPW Y;  3CXC Y;  1VQM 1;  4Y7N I;  1N8R 1;  1Q7Y 2;  2QEX Z;  2JS4 A;  2QEX 1;  1K8A 1;  2R6M A;  2JA8 I;  1VQO Z;  3NH8 A;  4E33 A;  1ZB9 A;  1QVF Z;  1KC8 2;  1VQO 1;  1ZB8 A;  5LL6 f;  3TE5 B;  2QKD A;  3K7A I;  1N2F A;  5FLX b;  2DE7 A;  3CCR Z;  2K3R A;  1Q82 1;  3CC2 Z;  3CC7 Z;  3MZL B;  2K5R A;  3CC2 1;  3HOY I;  3CC7 1;  4A3L I;  4MON A;  2KPI A;  2WAQ A;  1RO2 A;  3I55 Z;  3GTK I;  4A3G I;  2J6A A;  3CCL 1;  3VMH A;  4BBR I;  4A3C I;  3OW2 Z;  2PK7 A;  3CCJ Z;  4DQY B;  3S15 I;  1RQF A;  1W2B Z;  3EER A;  1K73 1;  1TWC I;  2GTI A;  3CMA Z;  4HH4 A;  1YUA A;  4MD7 A;  3NFZ A;  3I07 A;  5IT9 b;  1VQ8 Z;  3D6W A;  3CD6 Z;  4A93 I;  1ZH1 A;  2IZ4 A;  3CD6 1;  3TDH B;  4DK1 A;  1Q86 2;  3JAM f;  1R9T I;  3BG1 B;  5AN9 F;  2JNY A;  1TWA I;  2RT9 A;  3PO3 S;  4NBD A;  3GTJ I;  3EED A;  2IZ3 A;  4X6A I;  2ZAE B;  4BY1 I;  5D1O A;  1M90 1;  2BJO A;  1VQP 1;  1YJN 1;  2W03 A;  2JA6 I;  1Z02 A;  4RVH A;  2E2J I;  1QVF Y;  3RZO I;  2OZK A;  4BY7 I;  3KIF A;  2JUB A;  2OTJ 1;  2E2I I;  3GKQ A;  2M6N A;  3J80 f;  2E9H A;  2DE6 A;  2EGT A;  4NBB A;  3HOW I;  2VUM I;  4NB8 A;  1VQ9 Z;  1VQ5 Z;  3H0G I;  3J81 f;  3G6E Z;  1VQ9 1;  3IX0 A;  1KQS Y;  1VQ5 1;  3G6E 1;  3RZD I;  3OW2 Y;  1S7M A;  2Q4Z A;  2QRE B;  1W2B Y;  2I3C A;  2Q51 A;  3CCM Z;  3G71 Z;  4QTU A;  3CCM 1;  3G71 1;  3S16 I;  3HOX I;  2YAD A;  1QF8 A;  1VQL Z;  2NVQ I;  1VQL 1;  1YIJ Z;  1YIJ 1;  1NUI A;  3CCE Z;  4QTT A;  3CCE 1;  1KD1 2;  2GU2 A;  1VQ7 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...