3CC7Z

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2487u
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cc7Z00
1VQ51 1VQ41 3CCMZ 2OTL1 3CCJZ 3CD61 1Q821 1Q812 1VQNZ 1QVGZ 1Q822 3CCUZ 3CC71 3CXCY 3I561 3OW2Z 1VQLZ 3CCV1 1JJ2Y 1K9M1 1Q7Y1 1M901 1VQ61 1VQP1 2OTJ1 3CCQ1 1K9M2 1VQKZ 1Q861 1YJN1 3CCR1 3G4S1 1YJ91 1S72Z 1YI2Z 3CPWY 3CCLZ 1K731 3CCS1 1YJWZ 3CCM1 1W2BY 3CCJ1 1KQSZ 1VQN1 1Q811 3CCU1 1M1K1 1M1K2 1VQL1 1YIT1 3CMAZ 1NJI1 1VQMZ 2QEX1 1NJI2 1JJ2Z 1YI21 3CCL1 1YHQZ 1YJW1 3CMEZ 3G6EZ 3CCEZ 1YIJZ 1K8A2 3CPWZ 1VQ8Z 1QVFY 1VQ5Z 2OTLZ 3CMA1 1VQM1 2QA4Z 1KD11 3G71Z 1N8R1 1KD12 3CXCZ 3I55Z 1VQ9Z 1YHQ1 1N8R2 1VQOZ 1VQK1 3CME1 1VQ6Z 3G6E1 2OTJZ 3CCQZ 1S721 3CCE1 3CC2Z 1K8A1 1VQ7Z 3CC4Z 1QVGY 1W2BZ 1QVFZ 1VQ4Z 3CD6Z 2QA41 3G711 3OW2Y 1KC81 3CC7Z 3I551 1YITZ 1VQ91 1VQO1 3I56Z 1KC82 1Q7Y2 2QEXZ 3CCVZ 1M902 3CC21 1VQPZ 1Q862 1VQ71 1YIJ1 1YJNZ 1VQ81 3CCRZ 3G4SZ 1YJ9Z 1K732 1KQSY 3CC41 3CCSZ
chains in the Genus database with same CATH superfamily
3PO2I 2GU2A 1VQ41 1Q821 1Q822 4E2ZA 3GCFA 4NBFA 1VQLZ 4A3CI 2IV2X 1JJ2Y 2E7ZA 1YUKA 1M901 4A3MI 3S1MI 3NDIA 3CCR1 2DE6A 3IR7A 1S72Z 3CPWY 5A2Qb 3CCLZ 1K731 2R93I 2AKLA 1VQN1 3MONA 3HOVI 3HOXI 3CMAZ 1JJ2Z 3H0GI 1YHQZ 1YJW1 4X6AI 1YIJZ 2VUMI 3CPWZ 4RVGA 4BBRI 1QYPA 4DK1A 3RZOI 4Y52I 3RZDI 5IT9f 5T64A 1ZB9A 1VQM1 1RQFA 1KD11 3G71Z 3IX0A 3ESWA 2IZ3A 1LQLA 1KD12 1N2FA 3GTPI 1X3WA 1Z03A 2V45A 1KRLA 2VPWA 3CCE1 2JIPA 1S721 4RV9A 2AYDA 3CC4Z 4NBHA 3J81b 1I50I 2RBLA 3IF8A 5C4XI 1VQ4Z 2V8IA 3HOUI 5FLMI 3BG1B 1KC81 3I551 2YU9I 1VQ91 1Z02A 1KC82 2IZ4A 1Q7Y2 2JIRA 2WAQA 2Q4ZA 4E31A 1YIJ1 3VMGA 3CCRZ 1K83I 4NFRA 4MONA 4NH1C 3JAMb 3I4MI 3S2DI 4A3BI 2ZAEB 3D9XA 3CD61 1VQNZ 3GTLI 2JIQA 4E33A 3D2LA 3VTNA 3M3YI 3Q87A 2P28A 3CXCY 2OOYB 4RVFA 1I6HI 2JA6I 1VQKZ 1Q861 1YJN1 1R9TI 4NB8A 4E2YA 1YJ91 1Y1WI 2R6MA 2JA8I 1YJWZ 4MD8A 3I07A 1W2BY 3CCJ1 2G2KA 2JUBA 3S14I 3CCU1 1X0TA 4BY7I 4A3GI 3GTGI 2O53A 1VQMZ 3GTMS 4A3LI 3EERA 1WCMI 1TWFI 1YI21 3VMHA 4E2XA 2QRDB 1PFTA 1VLAA 3K7AI 3GKQA 3CCEZ 2VPXA 2KI7B 3NH4A 3M4OI 1VQ5Z 2JNYA 2V3VA 2QR1B 5T6BA 2QLVB 3QWUA 5IT9b 4AYBA 3I55Z 2JIMA 1VQ9Z 1VQK1 1VQ6Z 2M48A 4NBDA 3S15I 5FLXf 3GTJI 3NFZA 2R7ZI 4MH4A 3S2HI 2PMZA 1QVGY 3J80f 2NVTI 3GTOI 3P5JB 3CD6Z 2VUGA 2QA41 4A3KI 3HOWI 4BY1I 2QKDA 1YITZ 1VQO1 2HU9A 3VB9A 1Q16A 2QEXZ 3PO3I 1Z01A 3T4NB 1YJNZ 1YJ9Z 3GTQI 1AA6A 2JMOA 2V8KA 4A3DI 1VQ51 2B63I 5C4JI 3CCJZ 3MZKB 1Q812 1QVGZ 1I3QI 3CCUZ 3CC71 2YADA 3I561 1S7MA 4MD7A 1NUIA 3TE5B 1K9M1 1Q7Y1 1VQ61 1VQP1 2R92I 2HF1A 1K9M2 2RHBA 4RS4A 1YI2Z 1QXFA 3NH8A 3CCS1 4EWCA 2J6AA 1P9NA 3CCM1 1SFOI 1M1K1 4A3FI 4MXUA 2I3CA 1M1K2 3GTKI 1YIT1 5C44I 1TFIA 3FKII 1Y8CA 2QEX1 2NVXI 2DE5A 2V8JA 2E2II 2W04A 2JA5I 2OOXB 1K8A2 3S17I 1VQ8Z 1TWAI 3S1RI 5AN9F 2VF1A 2OTLZ 4BBSI 3KIFA 4NBCA 2GTIA 3J7A4 4S1TA 2PK7A 4RVHA 2E9HA 2QA4Z 2F4MA 1WZNA 3FQQA 1N8R1 2GTHA 4CL1A 3CXCZ 2RPRA 2JR6A 1N8R2 1VQOZ 2LFUA 3CME1 3CQZI 3G6E1 2OTJZ 4DGLA 3CCQZ 1ZH1A 4E32A 4NBBA 3TDHB 1YUAA 4A3EI 4A93I 2H85A 2RT9A 5FLXb 1W2BZ 2PM9A 1DL6A 3OW2Y 2NAPA 3J80b 3CC7Z 2W03A 2WB1A 1ML8A 3I56Z 2LIYA 2F4OA 4RVDA 4TNUA 1M902 5CM2M 2K5RA 3CC21 4NBAA 4HGZA 2NVYI 1VQPZ 4A3II 1VQ71 4QTUA 1VQ81 1USPA 1K732 1KQSY 1X3ZA 1QF8A 3CCSZ 2LEXA 3MZLB 4BXXI 4QTTA 3CCMZ 2OTL1 2K3RA 1USPB 1Y1VS 1TWGI 4NB9A 1WJ2A 3OW2Z 4E30A 3CCV1 5A2Qf 3HOZI 1RNIA 2OTJ1 3CCQ1 3G4S1 3S16I 3NDJA 2JA7I 3IFUA 2JIOA 5D1OA 1KQSZ 3BG0B 2QREB 5LL6f 2DE7A 1NP6A 1Q811 2QRCB 2RIQA 3NH5A 2E2HI 5D1OB 2M6NA 4NBEA 1RO0A 1TWHI 1VQL1 3S1NI 3F3PC 3GTMI 1NJI1 4E2WA 1WIIA 2E2JI 5T67A 1NJI2 4Y7NI 1RO4A 3CCL1 3CMEZ 1FDIA 3G6EZ 2KPIA 1FDOA 1QVFY 5IP9I 3HKZA 3EEDA 3FQMA 3CMA1 5C3EI 4HGYA 1WW9A 2Q51A 4DQYB 3KIHA 4NBGA 1RLYA 3S1QI 1YHQ1 3HOYI 1RO2A 2O4HA 4MRIA 2OZKA 3CC2Z 1K8A1 3F3FC 3J81f 1VQ7Z 3VMIA 3I4NI 3D6WA 4A3JI 1Y1VI 2P3YA 1QVFZ 4NOZA 5D1PA 2BJOA 2Y0SA 3G711 2JS4A 4XX2A 3LUSA 1TWCI 2NVQI 1JWHC 1SIWA 4HH4A 1ZB8A 1L1OC 5IP7I 3H3VJ 3CCVZ 2EGTA 3PO3S 3U50C 3JAMf 1Q862 4MD9A 2VPYA 2VPZA 3G4SZ 3CC41
chains in the Genus database with same CATH topology
3PO2I 2GU2A 1VQ41 1Q821 1Q822 4E2ZA 3GCFA 4NBFA 1VQLZ 4A3CI 1JJ2Y 1YUKA 1M901 4A3MI 3S1MI 3NDIA 3CCR1 2DE6A 1S72Z 3CPWY 5A2Qb 3CCLZ 1K731 2R93I 2AKLA 1VQN1 3MONA 3HOVI 3HOXI 3CMAZ 1JJ2Z 3H0GI 1YHQZ 1YJW1 4X6AI 1YIJZ 2VUMI 3CPWZ 4RVGA 4BBRI 1QYPA 4DK1A 3RZOI 4Y52I 3RZDI 5IT9f 5T64A 1ZB9A 1VQM1 1RQFA 1KD11 3G71Z 3IX0A 3ESWA 2IZ3A 1LQLA 1KD12 1N2FA 3GTPI 1X3WA 1Z03A 1KRLA 3CCE1 1S721 4RV9A 3CC4Z 4NBHA 3J81b 1I50I 2RBLA 3IF8A 5C4XI 1VQ4Z 2V8IA 3HOUI 5FLMI 3BG1B 1KC81 3I551 2YU9I 1VQ91 1Z02A 1KC82 2IZ4A 1Q7Y2 2WAQA 2Q4ZA 4E31A 1YIJ1 3VMGA 3CCRZ 1K83I 4NFRA 4MONA 4NH1C 3JAMb 3I4MI 3S2DI 4A3BI 2ZAEB 3D9XA 3CD61 1VQNZ 3GTLI 4E33A 3VTNA 3M3YI 3Q87A 2P28A 3CXCY 2OOYB 4RVFA 1I6HI 2JA6I 1VQKZ 1Q861 1YJN1 1R9TI 4NB8A 4E2YA 1YJ91 1Y1WI 2R6MA 2JA8I 1YJWZ 4MD8A 3I07A 1W2BY 3CCJ1 2G2KA 2JUBA 3S14I 3CCU1 1X0TA 4BY7I 4A3GI 3GTGI 2O53A 1VQMZ 3GTMS 4A3LI 3EERA 1WCMI 1TWFI 1YI21 3VMHA 4E2XA 2QRDB 1PFTA 1VLAA 3K7AI 3GKQA 3CCEZ 2KI7B 3NH4A 3M4OI 1VQ5Z 2JNYA 2QR1B 5T6BA 2QLVB 3QWUA 5IT9b 4AYBA 3I55Z 1VQ9Z 1VQK1 1VQ6Z 2M48A 4NBDA 3S15I 5FLXf 3GTJI 3NFZA 2R7ZI 4MH4A 3S2HI 2PMZA 1QVGY 3J80f 2NVTI 3GTOI 3P5JB 3CD6Z 2VUGA 2QA41 4A3KI 3HOWI 4BY1I 2QKDA 1YITZ 1VQO1 2HU9A 3VB9A 2QEXZ 3PO3I 1Z01A 3T4NB 1YJNZ 1YJ9Z 3GTQI 2JMOA 2V8KA 4A3DI 1VQ51 2B63I 5C4JI 3CCJZ 3MZKB 1Q812 1QVGZ 1I3QI 3CCUZ 3CC71 2YADA 3I561 1S7MA 4MD7A 1NUIA 3TE5B 1K9M1 1Q7Y1 1VQ61 1VQP1 2R92I 2HF1A 1K9M2 2RHBA 4RS4A 1YI2Z 3NH8A 3CCS1 4EWCA 2J6AA 1P9NA 3CCM1 1SFOI 1M1K1 4A3FI 4MXUA 2I3CA 1M1K2 3GTKI 1YIT1 5C44I 1TFIA 3FKII 2QEX1 2NVXI 2DE5A 2V8JA 2E2II 2W04A 2JA5I 2OOXB 1K8A2 3S17I 1VQ8Z 1TWAI 3S1RI 5AN9F 2VF1A 2OTLZ 4BBSI 3KIFA 4NBCA 2GTIA 3J7A4 4S1TA 2PK7A 4RVHA 2E9HA 2QA4Z 2F4MA 3FQQA 1N8R1 2GTHA 4CL1A 3CXCZ 2RPRA 2JR6A 1N8R2 1VQOZ 2LFUA 3CME1 3CQZI 3G6E1 2OTJZ 4DGLA 3CCQZ 1ZH1A 4E32A 4NBBA 3TDHB 1YUAA 4A3EI 4A93I 2H85A 2RT9A 5FLXb 1W2BZ 2PM9A 1DL6A 3OW2Y 3J80b 3CC7Z 2W03A 2WB1A 1ML8A 3I56Z 2LIYA 2F4OA 4RVDA 4TNUA 1M902 5CM2M 2K5RA 3CC21 4NBAA 4HGZA 2NVYI 1VQPZ 4A3II 1VQ71 4QTUA 1VQ81 1USPA 1K732 1KQSY 1X3ZA 1QF8A 3CCSZ 3MZLB 4BXXI 4QTTA 3CCMZ 2OTL1 2K3RA 1USPB 1Y1VS 1TWGI 4NB9A 3OW2Z 4E30A 3CCV1 5A2Qf 3HOZI 1RNIA 2OTJ1 3CCQ1 3G4S1 3S16I 3NDJA 2JA7I 3IFUA 5D1OA 1KQSZ 3BG0B 2QREB 5LL6f 2DE7A 1NP6A 1Q811 2QRCB 2RIQA 3NH5A 2E2HI 5D1OB 2M6NA 4NBEA 1RO0A 1TWHI 1VQL1 3S1NI 3F3PC 3GTMI 1NJI1 4E2WA 1WIIA 2E2JI 5T67A 1NJI2 4Y7NI 1RO4A 3CCL1 3CMEZ 3G6EZ 2KPIA 1QVFY 5IP9I 3HKZA 3EEDA 3FQMA 3CMA1 5C3EI 4HGYA 1WW9A 2Q51A 4DQYB 3KIHA 4NBGA 1RLYA 3S1QI 1YHQ1 3HOYI 1RO2A 2O4HA 4MRIA 2OZKA 3CC2Z 1K8A1 3F3FC 3J81f 1VQ7Z 3VMIA 3I4NI 3D6WA 4A3JI 1Y1VI 2P3YA 1QVFZ 4NOZA 5D1PA 2BJOA 2Y0SA 3G711 2JS4A 4XX2A 3LUSA 1TWCI 2NVQI 1JWHC 4HH4A 1ZB8A 1L1OC 5IP7I 3H3VJ 3CCVZ 2EGTA 3PO3S 3U50C 3JAMf 1Q862 4MD9A 3G4SZ 3CC41
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ5 1;  1VQ4 1;  3CCM Z;  2OTL 1;  3CCJ Z;  3CD6 1;  1Q82 1;  1Q81 2;  1VQN Z;  1QVG Z;  1Q82 2;  3CCU Z;  3CC7 1;  3CXC Y;  3I56 1;  3OW2 Z;  1VQL Z;  3CCV 1;  1JJ2 Y;  1K9M 1;  1Q7Y 1;  1M90 1;  1VQ6 1;  1VQP 1;  2OTJ 1;  3CCQ 1;  1K9M 2;  1VQK Z;  1Q86 1;  1YJN 1;  3CCR 1;  3G4S 1;  1YJ9 1;  1S72 Z;  1YI2 Z;  3CPW Y;  3CCL Z;  1K73 1;  3CCS 1;  1YJW Z;  3CCM 1;  1W2B Y;  3CCJ 1;  1KQS Z;  1VQN 1;  1Q81 1;  3CCU 1;  1M1K 1;  1M1K 2;  1VQL 1;  1YIT 1;  3CMA Z;  1NJI 1;  1VQM Z;  2QEX 1;  1NJI 2;  1JJ2 Z;  1YI2 1;  3CCL 1;  1YHQ Z;  1YJW 1;  3CME Z;  3G6E Z;  3CCE Z;  1YIJ Z;  1K8A 2;  3CPW Z;  1VQ8 Z;  1QVF Y;  1VQ5 Z;  2OTL Z;  3CMA 1;  1VQM 1;  2QA4 Z;  1KD1 1;  3G71 Z;  1N8R 1;  1KD1 2;  3CXC Z;  3I55 Z;  1VQ9 Z;  1YHQ 1;  1N8R 2;  1VQO Z;  1VQK 1;  3CME 1;  1VQ6 Z;  3G6E 1;  2OTJ Z;  3CCQ Z;  1S72 1;  3CCE 1;  3CC2 Z;  1K8A 1;  1VQ7 Z;  3CC4 Z;  1QVG Y;  1W2B Z;  1QVF Z;  1VQ4 Z;  3CD6 Z;  2QA4 1;  3G71 1;  3OW2 Y;  1KC8 1;  3CC7 Z;  3I55 1;  1YIT Z;  1VQ9 1;  1VQO 1;  3I56 Z;  1KC8 2;  1Q7Y 2;  2QEX Z;  3CCV Z;  1M90 2;  3CC2 1;  1VQP Z;  1Q86 2;  1VQ7 1;  1YIJ 1;  1YJN Z;  1VQ8 1;  3CCR Z;  3G4S Z;  1YJ9 Z;  1K73 2;  1KQS Y;  3CC4 1;  3CCS Z; 
#chains in the Genus database with same CATH topology
 3PO2 I;  2GU2 A;  1VQ4 1;  1Q82 1;  1Q82 2;  4E2Z A;  3GCF A;  4NBF A;  1VQL Z;  4A3C I;  2IV2 X;  1JJ2 Y;  2E7Z A;  1YUK A;  1M90 1;  4A3M I;  3S1M I;  3NDI A;  3CCR 1;  2DE6 A;  3IR7 A;  1S72 Z;  3CPW Y;  5A2Q b;  3CCL Z;  1K73 1;  2R93 I;  2AKL A;  1VQN 1;  3MON A;  3HOV I;  3HOX I;  3CMA Z;  1JJ2 Z;  3H0G I;  1YHQ Z;  1YJW 1;  4X6A I;  1YIJ Z;  2VUM I;  3CPW Z;  4RVG A;  4BBR I;  1QYP A;  4DK1 A;  3RZO I;  4Y52 I;  3RZD I;  5IT9 f;  5T64 A;  1ZB9 A;  1VQM 1;  1RQF A;  1KD1 1;  3G71 Z;  3IX0 A;  3ESW A;  2IZ3 A;  1LQL A;  1KD1 2;  1N2F A;  3GTP I;  1X3W A;  1Z03 A;  2V45 A;  1KRL A;  2VPW A;  3CCE 1;  2JIP A;  1S72 1;  4RV9 A;  2AYD A;  3CC4 Z;  4NBH A;  3J81 b;  1I50 I;  2RBL A;  3IF8 A;  5C4X I;  1VQ4 Z;  2V8I A;  3HOU I;  5FLM I;  3BG1 B;  1KC8 1;  3I55 1;  2YU9 I;  1VQ9 1;  1Z02 A;  1KC8 2;  2IZ4 A;  1Q7Y 2;  2JIR A;  2WAQ A;  2Q4Z A;  4E31 A;  1YIJ 1;  3VMG A;  3CCR Z;  1K83 I;  4NFR A;  4MON A;  4NH1 C;  3JAM b;  3I4M I;  3S2D I;  4A3B I;  2ZAE B;  3D9X A;  3CD6 1;  1VQN Z;  3GTL I;  2JIQ A;  4E33 A;  3D2L A;  3VTN A;  3M3Y I;  3Q87 A;  2P28 A;  3CXC Y;  2OOY B;  4RVF A;  1I6H I;  2JA6 I;  1VQK Z;  1Q86 1;  1YJN 1;  1R9T I;  4NB8 A;  4E2Y A;  1YJ9 1;  1Y1W I;  2R6M A;  2JA8 I;  1YJW Z;  4MD8 A;  3I07 A;  1W2B Y;  3CCJ 1;  2G2K A;  2JUB A;  3S14 I;  3CCU 1;  1X0T A;  4BY7 I;  4A3G I;  3GTG I;  2O53 A;  1VQM Z;  3GTM S;  4A3L I;  3EER A;  1WCM I;  1TWF I;  1YI2 1;  3VMH A;  4E2X A;  2QRD B;  1PFT A;  1VLA A;  3K7A I;  3GKQ A;  3CCE Z;  2VPX A;  2KI7 B;  3NH4 A;  3M4O I;  1VQ5 Z;  2JNY A;  2V3V A;  2QR1 B;  5T6B A;  2QLV B;  3QWU A;  5IT9 b;  4AYB A;  3I55 Z;  2JIM A;  1VQ9 Z;  1VQK 1;  1VQ6 Z;  2M48 A;  4NBD A;  3S15 I;  5FLX f;  3GTJ I;  3NFZ A;  2R7Z I;  4MH4 A;  3S2H I;  2PMZ A;  1QVG Y;  3J80 f;  2NVT I;  3GTO I;  3P5J B;  3CD6 Z;  2VUG A;  2QA4 1;  4A3K I;  3HOW I;  4BY1 I;  2QKD A;  1YIT Z;  1VQO 1;  2HU9 A;  3VB9 A;  1Q16 A;  2QEX Z;  3PO3 I;  1Z01 A;  3T4N B;  1YJN Z;  1YJ9 Z;  3GTQ I;  1AA6 A;  2JMO A;  2V8K A;  4A3D I;  1VQ5 1;  2B63 I;  5C4J I;  3CCJ Z;  3MZK B;  1Q81 2;  1QVG Z;  1I3Q I;  3CCU Z;  3CC7 1;  2YAD A;  3I56 1;  1S7M A;  4MD7 A;  1NUI A;  3TE5 B;  1K9M 1;  1Q7Y 1;  1VQ6 1;  1VQP 1;  2R92 I;  2HF1 A;  1K9M 2;  2RHB A;  4RS4 A;  1YI2 Z;  1QXF A;  3NH8 A;  3CCS 1;  4EWC A;  2J6A A;  1P9N A;  3CCM 1;  1SFO I;  1M1K 1;  4A3F I;  4MXU A;  2I3C A;  1M1K 2;  3GTK I;  1YIT 1;  5C44 I;  1TFI A;  3FKI I;  1Y8C A;  2QEX 1;  2NVX I;  2DE5 A;  2V8J A;  2E2I I;  2W04 A;  2JA5 I;  2OOX B;  1K8A 2;  3S17 I;  1VQ8 Z;  1TWA I;  3S1R I;  5AN9 F;  2VF1 A;  2OTL Z;  4BBS I;  3KIF A;  4NBC A;  2GTI A;  3J7A 4;  4S1T A;  2PK7 A;  4RVH A;  2E9H A;  2QA4 Z;  2F4M A;  1WZN A;  3FQQ A;  1N8R 1;  2GTH A;  4CL1 A;  3CXC Z;  2RPR A;  2JR6 A;  1N8R 2;  1VQO Z;  2LFU A;  3CME 1;  3CQZ I;  3G6E 1;  2OTJ Z;  4DGL A;  3CCQ Z;  1ZH1 A;  4E32 A;  4NBB A;  3TDH B;  1YUA A;  4A3E I;  4A93 I;  2H85 A;  2RT9 A;  5FLX b;  1W2B Z;  2PM9 A;  1DL6 A;  3OW2 Y;  2NAP A;  3J80 b;  3CC7 Z;  2W03 A;  2WB1 A;  1ML8 A;  3I56 Z;  2LIY A;  2F4O A;  4RVD A;  4TNU A;  1M90 2;  5CM2 M;  2K5R A;  3CC2 1;  4NBA A;  4HGZ A;  2NVY I;  1VQP Z;  4A3I I;  1VQ7 1;  4QTU A;  1VQ8 1;  1USP A;  1K73 2;  1KQS Y;  1X3Z A;  1QF8 A;  3CCS Z;  2LEX A;  3MZL B;  4BXX I;  4QTT A;  3CCM Z;  2OTL 1;  2K3R A;  1USP B;  1Y1V S;  1TWG I;  4NB9 A;  1WJ2 A;  3OW2 Z;  4E30 A;  3CCV 1;  5A2Q f;  3HOZ I;  1RNI A;  2OTJ 1;  3CCQ 1;  3G4S 1;  3S16 I;  3NDJ A;  2JA7 I;  3IFU A;  2JIO A;  5D1O A;  1KQS Z;  3BG0 B;  2QRE B;  5LL6 f;  2DE7 A;  1NP6 A;  1Q81 1;  2QRC B;  2RIQ A;  3NH5 A;  2E2H I;  5D1O B;  2M6N A;  4NBE A;  1RO0 A;  1TWH I;  1VQL 1;  3S1N I;  3F3P C;  3GTM I;  1NJI 1;  4E2W A;  1WII A;  2E2J I;  5T67 A;  1NJI 2;  4Y7N I;  1RO4 A;  3CCL 1;  3CME Z;  1FDI A;  3G6E Z;  2KPI A;  1FDO A;  1QVF Y;  5IP9 I;  3HKZ A;  3EED A;  3FQM A;  3CMA 1;  5C3E I;  4HGY A;  1WW9 A;  2Q51 A;  4DQY B;  3KIH A;  4NBG A;  1RLY A;  3S1Q I;  1YHQ 1;  3HOY I;  1RO2 A;  2O4H A;  4MRI A;  2OZK A;  3CC2 Z;  1K8A 1;  3F3F C;  3J81 f;  1VQ7 Z;  3VMI A;  3I4N I;  3D6W A;  4A3J I;  1Y1V I;  2P3Y A;  1QVF Z;  4NOZ A;  5D1P A;  2BJO A;  2Y0S A;  3G71 1;  2JS4 A;  4XX2 A;  3LUS A;  1TWC I;  2NVQ I;  1JWH C;  1SIW A;  4HH4 A;  1ZB8 A;  1L1O C;  5IP7 I;  3H3V J;  3CCV Z;  2EGT A;  3PO3 S;  3U50 C;  3JAM f;  1Q86 2;  4MD9 A;  2VPY A;  2VPZ A;  3G4S Z;  3CC4 1; 
#chains in the Genus database with same CATH homology
 3PO2 I;  2GU2 A;  1VQ4 1;  1Q82 1;  1Q82 2;  4E2Z A;  3GCF A;  4NBF A;  1VQL Z;  4A3C I;  1JJ2 Y;  1YUK A;  1M90 1;  4A3M I;  3S1M I;  3NDI A;  3CCR 1;  2DE6 A;  1S72 Z;  3CPW Y;  5A2Q b;  3CCL Z;  1K73 1;  2R93 I;  2AKL A;  1VQN 1;  3MON A;  3HOV I;  3HOX I;  3CMA Z;  1JJ2 Z;  3H0G I;  1YHQ Z;  1YJW 1;  4X6A I;  1YIJ Z;  2VUM I;  3CPW Z;  4RVG A;  4BBR I;  1QYP A;  4DK1 A;  3RZO I;  4Y52 I;  3RZD I;  5IT9 f;  5T64 A;  1ZB9 A;  1VQM 1;  1RQF A;  1KD1 1;  3G71 Z;  3IX0 A;  3ESW A;  2IZ3 A;  1LQL A;  1KD1 2;  1N2F A;  3GTP I;  1X3W A;  1Z03 A;  1KRL A;  3CCE 1;  1S72 1;  4RV9 A;  3CC4 Z;  4NBH A;  3J81 b;  1I50 I;  2RBL A;  3IF8 A;  5C4X I;  1VQ4 Z;  2V8I A;  3HOU I;  5FLM I;  3BG1 B;  1KC8 1;  3I55 1;  2YU9 I;  1VQ9 1;  1Z02 A;  1KC8 2;  2IZ4 A;  1Q7Y 2;  2WAQ A;  2Q4Z A;  4E31 A;  1YIJ 1;  3VMG A;  3CCR Z;  1K83 I;  4NFR A;  4MON A;  4NH1 C;  3JAM b;  3I4M I;  3S2D I;  4A3B I;  2ZAE B;  3D9X A;  3CD6 1;  1VQN Z;  3GTL I;  4E33 A;  3VTN A;  3M3Y I;  3Q87 A;  2P28 A;  3CXC Y;  2OOY B;  4RVF A;  1I6H I;  2JA6 I;  1VQK Z;  1Q86 1;  1YJN 1;  1R9T I;  4NB8 A;  4E2Y A;  1YJ9 1;  1Y1W I;  2R6M A;  2JA8 I;  1YJW Z;  4MD8 A;  3I07 A;  1W2B Y;  3CCJ 1;  2G2K A;  2JUB A;  3S14 I;  3CCU 1;  1X0T A;  4BY7 I;  4A3G I;  3GTG I;  2O53 A;  1VQM Z;  3GTM S;  4A3L I;  3EER A;  1WCM I;  1TWF I;  1YI2 1;  3VMH A;  4E2X A;  2QRD B;  1PFT A;  1VLA A;  3K7A I;  3GKQ A;  3CCE Z;  2KI7 B;  3NH4 A;  3M4O I;  1VQ5 Z;  2JNY A;  2QR1 B;  5T6B A;  2QLV B;  3QWU A;  5IT9 b;  4AYB A;  3I55 Z;  1VQ9 Z;  1VQK 1;  1VQ6 Z;  2M48 A;  4NBD A;  3S15 I;  5FLX f;  3GTJ I;  3NFZ A;  2R7Z I;  4MH4 A;  3S2H I;  2PMZ A;  1QVG Y;  3J80 f;  2NVT I;  3GTO I;  3P5J B;  3CD6 Z;  2VUG A;  2QA4 1;  4A3K I;  3HOW I;  4BY1 I;  2QKD A;  1YIT Z;  1VQO 1;  2HU9 A;  3VB9 A;  2QEX Z;  3PO3 I;  1Z01 A;  3T4N B;  1YJN Z;  1YJ9 Z;  3GTQ I;  2JMO A;  2V8K A;  4A3D I;  1VQ5 1;  2B63 I;  5C4J I;  3CCJ Z;  3MZK B;  1Q81 2;  1QVG Z;  1I3Q I;  3CCU Z;  3CC7 1;  2YAD A;  3I56 1;  1S7M A;  4MD7 A;  1NUI A;  3TE5 B;  1K9M 1;  1Q7Y 1;  1VQ6 1;  1VQP 1;  2R92 I;  2HF1 A;  1K9M 2;  2RHB A;  4RS4 A;  1YI2 Z;  3NH8 A;  3CCS 1;  4EWC A;  2J6A A;  1P9N A;  3CCM 1;  1SFO I;  1M1K 1;  4A3F I;  4MXU A;  2I3C A;  1M1K 2;  3GTK I;  1YIT 1;  5C44 I;  1TFI A;  3FKI I;  2QEX 1;  2NVX I;  2DE5 A;  2V8J A;  2E2I I;  2W04 A;  2JA5 I;  2OOX B;  1K8A 2;  3S17 I;  1VQ8 Z;  1TWA I;  3S1R I;  5AN9 F;  2VF1 A;  2OTL Z;  4BBS I;  3KIF A;  4NBC A;  2GTI A;  3J7A 4;  4S1T A;  2PK7 A;  4RVH A;  2E9H A;  2QA4 Z;  2F4M A;  3FQQ A;  1N8R 1;  2GTH A;  4CL1 A;  3CXC Z;  2RPR A;  2JR6 A;  1N8R 2;  1VQO Z;  2LFU A;  3CME 1;  3CQZ I;  3G6E 1;  2OTJ Z;  4DGL A;  3CCQ Z;  1ZH1 A;  4E32 A;  4NBB A;  3TDH B;  1YUA A;  4A3E I;  4A93 I;  2H85 A;  2RT9 A;  5FLX b;  1W2B Z;  2PM9 A;  1DL6 A;  3OW2 Y;  3J80 b;  3CC7 Z;  2W03 A;  2WB1 A;  1ML8 A;  3I56 Z;  2LIY A;  2F4O A;  4RVD A;  4TNU A;  1M90 2;  5CM2 M;  2K5R A;  3CC2 1;  4NBA A;  4HGZ A;  2NVY I;  1VQP Z;  4A3I I;  1VQ7 1;  4QTU A;  1VQ8 1;  1USP A;  1K73 2;  1KQS Y;  1X3Z A;  1QF8 A;  3CCS Z;  3MZL B;  4BXX I;  4QTT A;  3CCM Z;  2OTL 1;  2K3R A;  1USP B;  1Y1V S;  1TWG I;  4NB9 A;  3OW2 Z;  4E30 A;  3CCV 1;  5A2Q f;  3HOZ I;  1RNI A;  2OTJ 1;  3CCQ 1;  3G4S 1;  3S16 I;  3NDJ A;  2JA7 I;  3IFU A;  5D1O A;  1KQS Z;  3BG0 B;  2QRE B;  5LL6 f;  2DE7 A;  1NP6 A;  1Q81 1;  2QRC B;  2RIQ A;  3NH5 A;  2E2H I;  5D1O B;  2M6N A;  4NBE A;  1RO0 A;  1TWH I;  1VQL 1;  3S1N I;  3F3P C;  3GTM I;  1NJI 1;  4E2W A;  1WII A;  2E2J I;  5T67 A;  1NJI 2;  4Y7N I;  1RO4 A;  3CCL 1;  3CME Z;  3G6E Z;  2KPI A;  1QVF Y;  5IP9 I;  3HKZ A;  3EED A;  3FQM A;  3CMA 1;  5C3E I;  4HGY A;  1WW9 A;  2Q51 A;  4DQY B;  3KIH A;  4NBG A;  1RLY A;  3S1Q I;  1YHQ 1;  3HOY I;  1RO2 A;  2O4H A;  4MRI A;  2OZK A;  3CC2 Z;  1K8A 1;  3F3F C;  3J81 f;  1VQ7 Z;  3VMI A;  3I4N I;  3D6W A;  4A3J I;  1Y1V I;  2P3Y A;  1QVF Z;  4NOZ A;  5D1P A;  2BJO A;  2Y0S A;  3G71 1;  2JS4 A;  4XX2 A;  3LUS A;  1TWC I;  2NVQ I;  1JWH C;  4HH4 A;  1ZB8 A;  1L1O C;  5IP7 I;  3H3V J;  3CCV Z;  2EGT A;  3PO3 S;  3U50 C;  3JAM f;  1Q86 2;  4MD9 A;  3G4S Z;  3CC4 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...