2QLVB

Crystal structure of the heterotrimer core of the s. cerevisiae ampk homolog snf1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
252
structure length
155
Chain Sequence
SLMVPVEIRWQQGGSKVYVTGSFTKWRKMIGLIPDSDNNGSFHVKLRLLPGTHRFRFIVDNELRVSDFLPTATDQMGNFVNYIEVRQTTDIPAVFTDPSVMERYYYTLDRPPQLPPQHVVLNHLVTSSIKHNTLCVASIVRYKQKYVTQILYTPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the heterotrimer core of Saccharomyces cerevisiae AMPK homologue SNF1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/protein binding
molecule keywords Carbon catabolite derepressing protein kinase
total genus 21
structure length 155
sequence length 252
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04739 AMPKBI 5'-AMP-activated protein kinase beta subunit, interaction domain
B PF16561 AMPK1_CBM Glycogen recognition site of AMP-activated protein kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.290 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2qlvB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2qlvB01
2VTFA 3V95A 3MRKB 3U7WH 3U0TB 1CFQB 5JW4M 4FZ8L 1SVZA 5CLTA 4M4PA 3CFDB 5F88A 1BJ1H 5IT2H 4XCNA 2H32H 4JPWH 4YHPA 3D39D 5I74C 3JSSA 1ZWIB 3OB8A 5T1KA 3DRTA 4FQHB 1BZ9A 4XNXH 1HOCB 2J8UE 4K3JH 3WIHL 3TV3H 4Y16C 1RQ5A 4WUKH 3GEWB 1QRKA 1AP2A 1J0YA 1UVQA 5TF1H 5F9JB 1UFUA 2WIMA 3EYQC 4FXLA 4JPWL 2P5EA 3MLPA 2GFBA 3VFNA 1WWWX 1UZ8A 3P9WB 2Y25A 3DTXB 5ID1B 1T0PB 1OW0C 1N64H 4HXBL 4XAKD 4LAQL 4Y1AA 1U92A 1RK1A 1QO3A 2KH2B 4GRMB 5T33H 4LIQH 2V2WA 4KJQC 3TP4A 1UENA 5ISZB 1PFCA 3FJTA 4JZOA 5IEKB 5J1SC 3K7UA 4EN3D 1QR1B 5CCKL 3HZMB 1DBAL 1EHLH 3ARZA 3ARGB 2EDQA 1MFAH 3BP5A 5F1OB 2AK4A 3EGSB 5C0IB 2ZKHL 1GIGH 4JDTH 3O9WB 3SDAA 4YHPB 4JDZA 4GKSB 4P23C 3VXOA 1CLCA 1LEKA 3ULUC 1NCCL 1KCSH 4MD5B 4XNZB 3WE6A 5BVPH 1DEEB 3MYJB 5BS0B 5B3JE 1YMMD 4K23H 5IHZB 3PQYB 1IGCH 2ENSA 2PO6D 3O6KH 4N8CL 1MHEB 4JQXA 2X10A 4EIZC 4PGCA 4OZFH 3LS5H 2PW1B 2I24N 1FO0L 4JVWA 3T1WA 1IGJA 3MA9L 1C7TA 4CVXA 1MJUH 2GSIB 4GKZB 5AG9A 4JR9L 1JYWA 4G3YH 2CK2A 4D0CB 3HG1A 3OB0H 4JO2L 3IVKA 3AAZB 4O5LH 1DUZA 2FLBT 1T1ZA 4C59B 4LDEB 2L7JA 1KTRL 2MQ0A 2FO4A 2BERA 2VQ1A 5IOPA 1MHPL 4PRBA 2ZUXA 3E2HB 2CJUL 1V3JA 4ZUUB 5FYJE 4K7PL 5E2WH 3OGCA 1J1XH 4OGXL 5EZIL 3SY0A 3WNPA 3KLHD 3BFOA 4I3RH 5GIRB 3BZDA 2X4SB 3KPMA 3DURB 1JNHA 5TDNB 4XGZA 3MUJA 3CVHA 5MENB 2XTJE 3EZ8A 5BZDA 2EDXA 3RL1A 4NRYB 5KAQG 5FHAH 2OTWB 3FONA 4MXVE 2KKQA 3ZT5A 2PR4H 2FJFA 5F6IB 4OZIF 5AZEL 2WWKO 4NHUA 5IW6B 3TO4B 1AGEB 2OQJA 1R24A 2ITCA 4O4YH 4JFZL 3TO4A 3PP3H 1NLDL 1KXQE 2BVPB 3JTSB 3SPVB 3SKMB 1BQHG 2VJXA 5JDJA 3T65B 4X6BA 1L6XA 4XB7A 1R5IA 5DS8B 4N1EA 4WFHD 5ANME 4KKBD 1F4AA 4MQSB 4NZUL 3MXWH 1FL3B 5IVOA 1LP9E 3HAEB 1D5MB 4RZCA 5EUOE 3H0TB 3MRCA 4U7SA 3TT1L 4HK0A 3HNVL 5LBSH 3VE0B 2X1OA 5E5MA 2X44D 4ELKA 2BNUA 5C0IA 1KTLA 2NTSP 1LQSR 4PGJA 2AEIT 1RD6A 2W59A 1J87A 1FG9C 1EFQA 4PY8J 3T2PA 4BQ9A 5H2BB 1IRAY 3QH3B 5GGUB 4P3CH 1L6ZA 3CVHH 4MDJA 5IFHL 4R6UA 3CDFA 2R0WL 3GSQB 4S2SB 2F5BL 3ULVL 4DN4H 5KTEL 1GGYA 4A2MA 4ODVL 1BGXH 3SDAD 1EA9C 4UNTA 3Q6FB 5HDQH 3SDDD 1ZA3A 1W0WA 3Q5TA 5CJBA 1YEJL 4MQTB 3BEVB 1NC2D 1HSBA 5DFTA 4WJ5B 4QRRE 3HZYB 1KB9J 2GJ6B 4OLEA 5D7IB 5HHNA 5FDWB 5BMFH 4POUB 3MRPA 3C5ZA 2DRUA 4WTZG 1ZLSH 2YRZA 5JOEA 5GISH 5ESAA 1MFDH 3V6OC 1W8NA 4DKEL 4P2YA 4POZD 3RWCB 3BYTA 4JLRA 3LKQA 1KJ2A 1WGOA 1INDL 2C3VA 1MNUL 1OT2A 1TZGH 4IBLT 2IADA 4OGAD 4MJ6B 2O61B 1GPOH 1RY7B 1HEZB 1NGZA 2KQMA 5CEZD 2JELH 2OJZH 3MRJB 4O4YL 1RIUL 4LPCA 3KYNB 1KTDB 3NFPB 2L7UA 4WRLA 3W5NA 4KMLB 4M03A 3ZT6A 4XC3H 3WFDH 1MCKA 2WUBH 3QDGA 5FYLE 4XHJD 3IFPA 4YK4B 4R26L 2OSLA 2XWTB 3MV7E 4NKIH 3R1GL 4LRIA 4LHJB 4Y4HA 5DC0A 3HLAB 3O6FA 5L0QB 3FQNB 1BOYA 4QNPE 2XA3A 5HYJB 4GLRI 4M48H 5J0BA 1BWMA 3B3IB 1BJ1J 3SKMA 3MGAA 3QUXC 3BQUB 5KVMC 5C71A 4S0TD 1E4XI 4D0DA 4JFPB 5FDYA 4H8WH 4EDXA 1BOGB 4MZ3A 1X5FA 3EFDH 4PJXB 5IMMB 4QRTA 1TVDA 3LQZA 4H88L 2XQYG 2R69H 1GXEA 5T5NG 5SX5H 4Y8DC 3TJHD 2J4WH 3BMWA 4KI5D 4LCCA 4P9HH 3RWIA 4XWGL 3EJJX 2M26A 3AU1B 1PEZA 2NY0C 5SWZB 3RDTA 1E4KA 5DT1L 2W9LA 3TT1H 4HIEB 5D9SB 1KPVA 2EYRA 1FLRL 3FN3A 1B88A 3DMMA 3UTOA 2R2EA 3MLVH 4HV8A 3LEYL 3DUHA 3V6OA 3O3BB 4MD4B 2FEDC 5CMAB 2CK0L 3ROOB 4IOIA 1KNOB 4RWYH 2Y72A 1MJ8L 4P2OA 2VXSH 3ARFD 1TITA 2ORBH 1T5WA 3LIZL 1NLDH 1U8IB 4NZRL 4X4YA 3VI4F 4UIKH 3QXAA 2QSTA 5D96C 1YPZF 4OGYH 5E00B 5DD0H 3VXRA 3QUKA 2D9QB 3HMWH 3MV7A 1AIFB 4HKZA 2Q87A 2YSSA 4XCCH 3BRDA 1N5YH 2NYYD 3T0EE 1SVCP 3BWAA 2JJUA 2XV6B 3CDGA 1OAQH 1YC7A 4TVSa 2R0ZH 1S9YA 2HA1A 4WEBL 3D0LA 2BHZA 4IRSB 5IIEB 2HJKA 4UQ3A 1F4XH 3VXNB 1M05B 1P1ZA 2ED9A 3AFLA 3ARFA 2BVTA 2H2PC 1AJ7L 3V0WH 2QRDB 4I18C 2QL1A 3C09B 1KTDA 3NFPA 4QO1A 3T8XB 1N2RB 3VWJA 2DWEA 1OPGL 5DD6A 4O02H 3QT2A 4P2QA 4K7PH 2Q8AH 1AKJD 1JNLH 4MCYB 4HKBB 3DX8B 3AROA 1EEQA 1SQ2N 2P8LA 3DX9A 3BDYL 5EB9A 32C2A 2J6EH 4KRPC 4QRQA 4AH2A 3V79C 5DJCA 5FECA 1I1FB 5FUCC 2IWGA 3FO0L 3MBED 2QSVA 4HSQA 2FJHB 4LGRB 3SKNB 4F37F 1N59B 4GRMA 4YFLF 2A74B 5HGDB 2IH3B 5BQ7B 1JCKA 1R3IL 4Q58C 3O9WD 3QIBA 5FO8B 3E1F1 4JE4B 3HE7C 3BPOC 3QIBB 1VENA 5IBLC 4AL8L 4Y0GA 4NDMA 1ZT7B 1RIHL 2N7AA 1I9IL 4P2CG 2GFBB 3QWRA 5MENE 3WS6C 1DDHA 4BSVB 5FKPA 3KXFB 3DROA 4U1NA 2K9UA 1KCSL 3RPIA 5KW9H 1FSKB 5M95B 4XXCA 4G7YL 4LU5L 4YC2C 3L3HA 1BFVH 4RAUB 1AGFA 4P4KD 1KGCD 4PJBB 1ZLUK 2VSCA 4G9DB 4RAUA 2B0SH 2JIXA 4TUOB 5GRJH 3MTRA 3OPZL 3NGBB 1MFAL 4XVUC 4FN0A 1EJ6A 1SMAA 1C1EL 1EHLL 2NW2B 1A7OL 4F8TA 5DD6B 1SHMA 1DP0A 4W4OC 4UV4L 5FA4B 1VPOH 1FC1A 1U8KA 5HY9A 1NC4B 2OX5A 3LPGA 1KFAH 2BJML 4D9LH 4ZYKB 1W72L 1MCNA 5E6ID 3S4SB 3VRIA 4EUPB 4MMXC 1EFXB 2LU3A 3O3EB 4L3EB 3RWFA 5F3BA 5E94B 1JHKL 5CZVL 1JTPA 3RA7L 1J18A 1NCDL 4W68A 4N0FA 4F7CA 3FFCA 3VH8G 5CLWA 2DWDA 4JGJA 2VERN 5GS1A 1R3KB 2YPLE 4WUKL 2DKSA 2NY1B 2QQKL 4G5ZH 3QNXA 5CZXC 1XF4B 3BX7C 4FFYH 5I8OL 2ZJSH 4PJHE 4G6FD 4EBQL 1FV1A 2MMXA 4I2XA 4IOSD 2NXZB 4X9FA 4KRMB 2FH6A 2VDKH 4DFHA 3O3BA 4MD4A 2AJYL 1GGIH 4X7SH 1KG0B 1A9BA 1J05B 1NCWH 2D7PA 2DYPB 5JQ6L 2RQ8A 4XNQB 5I15H 3L3OB 4QOKB 4EN3C 1KCVL 2VZSA 4FS0A 1M7XA 2VLRE 1YEFL 3KPQB 4AMKH 3G04B 4OI8A 2B1AL 2GY5A 2HT2D 3PGCB 4YIQA 3B2VL 3LRSB 3GSNA 2FD6L 3OBAA 3BESR 2BP3A 3DXAB 3QDJE 4HFUL 2Q6WB 4P57A 3KDMB 3DIFB 1MREL 3DVGB 3AXLA 1FDLL 4YGVB 5KVGL 3RU8H 3DVGA 5ALCL 1EO5A 1LGVA 4CVXB 3L9RB 4HKXA 4XVTH 3V52L 3BISA 3D3VA 4YPGB 2C4XA 2XG4A 5KSVB 4FHBD 1XGTB 2PO6A 4HH8A 3S37H 1CXHA 5INDB 2FIKA 5EBWB 3REWB 4NC1C 1BHGA 4FQQB 4OZFB 1CFSA 4F33A 3L7FB 1UH3A 4BSJA 1NMAH 3K1KC 1HQRB 3SDCA 1IT9H 4Z7UB 3LKOA 4IMLA 3E6FA 5IMKB 3WLWC 2OYPA 2YUWA 2B20A 4XHJC 3ARUA 4O2CB 3IDGA 3X17A 3FRUA 3AS1A 5A1AA 4ZNEA 2AEPH 2QHRL 1KIPB 3C6LB 1KSRA 5MEQA 4OGZA 5DUMH 3W9EB 2DLGA 1AD9A 1NGQH 2KPNA 1LE9B 3IDMA 5A40E 5HYIA 3NFSH 4HFUH 2F8VA 3MV9E 1A3QA 4C56B 6FABL 4OFDA 1B0GA 2AW2A 1U2CA 3OXSA 5HGAA 5HHME 3VXTB 5LCVL 1BPVA 3MLWL 1JWUA 1S7WB 4GRWB 1YEGL 4O2FB 1CG9B 5DHXB 1O7VA 4PJXA 5IMMA 1X3DA 4WV1B 3RWFB 5F3BB 1JGUH 2QHRH 2VQUA 2NY2C 2JLLA 3KPPB 2GY7B 4D0DB 4CL7A 3MV8B 3OKLA 4OSUL 3IDIB 5MEPB 3QZWA 3MRQB 5EOCL 1MUJB 4N1HB 1B4RA 5BO1H 2J88L 4OZGB 4E5XA 1RVFL 3S4SG 1ZA3B 1S5HA 3QRGH 4YPJA 5I1DA 1IBGH 4GRLA 5KSBB 4R97C 3QJFB 5T1LB 3U2SA 3SGJC 3WL9A 5IFAH 1A5FL 3OTTA 1CF8H 4R7NB 3RY6C 1PBYA 1VACB 4PTUB 3GSUB 1AHWC 4F57L 1KC5H 2AK4B 1MCSA 4MVBC 3G9AB 3JV0A 4ODUA 2C1PB 1U8LA 2LVEA 5ADPL 5ITBH 2AP2A 4KI1A 4ZS7L 1A7PH 1OTUC 4YDVB 3L3IA 4MJ6A 2W60B 4L5FH 3O8XA 3GM8A 1CVSC 3WDJA 1LNUB 4OZFG 4ZD3L 5EORL 3QIWA 5IR1B 4UILL 3EJZD 3PE9A 3SGKC 2BFVL 5BVPL 1XR9B 2OS7A 4NO2A 1CE6A 2WLYA 1XR9A 2YK1H 2VLMD 2EDYA 3F7VA 3C60B 2QRCB 1Q9OA 4HAGA 1FFQA 5AD0A 4ISVA 3O3DB 3NIDE 2N56A 3VW3H 1JRHI 3MOQA 3HPJB 3TBVA 3HFML 3PP4L 2IGFL 4CMMA 2XTJD 2ZSWB 4NP4H 2ZG3A 5JHLH 2JB5L 3F7YA 5AUMB 2B1AH 2XWJB 3E6FB 4MAYA 4OZIE 4IJ3B 3RIFF 4OLUL 1U8QA 2EYRB 3ZKMD 3CFDA 4M43H 1G6RA 4WEMB 4Z7OF 5K9KB 5FYJD 4LSRL 2R1WA 1EPFA 3LKNA 4I77L 3U36A 5D2LE 3PGDB 1U58A 1D5ZA 5ERWB 4J7RA 1KJVB 2QSCH 4FG6D 1D9KB 3GK8L 3WIHA 2Z35A 4X5WA 5SWSA 3O9WA 4PUBH 1PY9A 3SHSA 4TTDC 5KN5A 4FMKA 3UZEA 2HJLB 1XGQA 2BSED 5FK9A 4FNLH 4Z95H 3OKYA 4X4YB 3L5XL 3IF1A 4MB4A 2VKWA 3UYRH 3EOYG 4GG6B 4JFFA 3CLFL 2RAMA 4PRHD 4NQSB 2YXFA 2MFNA 2FHFA 4XPTL 4B7IA 5CZVH 1FNGB 3GIZL 3F7QA 5JW5A 5D4QA 2YR3A 4AG4L 3K3QA 2YD8A 4XX1E 5JIKA 4WHTA 1BFVL 2NQCA 3HC3H 4FZ8H 3ARPA 4PJIF 5IESH 5L6YL 1UWGH 1G7JB 3BP4A 4NJ9L 1FNEB 2Q7YB 1S9KC 2WZPD 5ENWA 5DJXB 3SGDH 3FO9A 2OL3H 4UINL 4X8JA 5EOQL 1OVZA 1G7MA 1VPOL 4QNPF 3P0VH 3QPQC 5EU3A 1TMCB 5J3HD 1GAFH 4EOWL 5DZOA 1JGEB 2IAMC 5DD5H 1PW3A 2P7TA 4LKXB 3B9VA 1E6OH 4JY4A 3BEWA 5T5NF 4HC1L 3VXRD 1T2XA 1KLGB 4PGBB 5DURB 4TOYL 4JPKH 1CR9L 3BN9D 3FKUS 4HLZG 3AGVA 2ID5A 2DM2A 1CIDA 2YD6A 2CK0H 3UAJD 3WIIH 1BOGA 5E2UL 2Y9RT 4UQ2A 2GAZB 1YYMH 5CBAA 2EDTA 5AD0B 3JV5A 3G5YB 3BEVA 4N0CC 3ARGC 4ZXBD 1XF3B 3QCTL 1DEDA 3RX7A 2VAAB 3HUJF 4GXVL 2VDPL 2PYED 3SDYH 5J6HB 4KC3B 4U1MA 3WFZA 2VSDA 4ZPVA 5IJVA 1D3CA 2A74A 1EHAA 2AJXH 4BQBA 4YLQT 3TIEA 3BO8A 3U1SH 3UJIL 4CGTA 2DQHL 4HKJA 3PDDA 3HZMA 5ILTH 5A16B 2O61A 1P4BL 3UJJL 3GIZH 1ZGLB 5C9KA 1HOCA 4FQ1L 1QSFA 2OLDA 3MUZ1 4R8WL 3P0GB 1NPUA 1T0MB 2FWOA 4JZJA 1XEDA 1B9ZA 3C08L 2OOYB 4EQ3A 4L9DA 3MNWB 2DMCA 1JWMA 2JIXB 5C0AE 2DQDH 1A6TA 1CLZL 3MCG1 4LPXA 5D93C 1E27B 4WEBH 1CZ8H 4R26H 2YPKB 4U1GB 4CADA 1JYVA 3LEYH 2VXVH 2D03L 1V7NH 1CLYH 1J1PH 2R4SL 1YECL 3D3VB 4YPGA 5K93A 4U31A 3IDIA 3HI5H 5C3TA 5HXMA 4HZAA 4OCSL 2ATKA 3GK8H 5CUSH 2VLJE 4YHML 2A9ML 1J10A 4NN5B 4K7PY 4I0PD 2E8YA 3HRPA 5BXFA 4E0RB 3LMJL 1W0WB 5BZWA 3WDIA 3SGDI 3EO9H 1DN0B 4XMPH 3LN4B 1JF1B 1E28A 4PRID 5FF6B 5BVJA 5K59F 4UIMB 4ESKA 5EOTA 1YUHA 2CUMA 3HUJB 3BIBX 1UACL 1R0AH 1UM6H 5IQ7L 3U46A 4ONFL 4PJDA 2NX5D 4WI6A 5I19L 1T2JA 5I76B 3PWPB 1AD9B 1LE9A 1GOGA 3QUZC 4J3OC 4PG9B 4NO0A 3OJ2C 3EW3B 4LKCA 1OT1A 1JPTH 4ELKB 5GIRA 3SDXF 5GRVL 3KPMB 4L4TD 3MOBL 4FQLL 2M8XA 2DM4A 1WLHA 2XRAH 4PV8B 2EXYD 2FX8H 1I8KA 2X9YA 3PABB 5E00A 5MEOB 3SJVE 3N1MC 1X4ZA 4U1SB 5KVFL 3QZWB 3P77A 1N5AA 1TZIB 2Q76A 3BIAX 3GSVA 4K71C 3LB6D 4DVBA 4MA8H 4MYWB 1NUNB 3P30H 4KJYA 4TYUA 4NO0D 3V6ZB 5EO1B 2EECA 4LEOA 4TPRL 3IVKB 4M8QB 1QBAA 2WLZA 5EDXA 5C6PB 3JWDC 5F96L 1IGFH 3LRGA 2CO7B 4LSQH 4HZLB 5C0EA 5IVZB 2X1QA 3U7YH 1QEWA 4P2RE 4P5KA 4J12A 1S7UA 4XI5C 4C56D 5EU4A 5FXCH 2ZSVA 3AY4A 3X3GL 3QDAA 4I18B 5DJ8A 4EUPH 2HVJB 4N9OB 3ZDZF 2X1PA 3CMGA 2VDQL 4GKSA 4XHQA 4YDLB 5ETUA 2CD0A 2J88H 3PXJA 5DR5H 1DQJB 3NA4A 1T1WB 3VFSB 2P43B 3QEQE 5E5UB 4LKCB 3TWCH 1CFSB 3ZE2E 3MRLA 5IB4B 5SWZA 2CLVA 4D8PA 4WO4B 5T5FL 5J3HC 1F6AB 3K2UH 2HH0L 4V1DB 3SE3C 3EO1A 1J5OL 2XACC 1MNUH 2HKHL 3SJVD 7FABH 2VZOA 4BSVA 4JY5H 1YEHL 4K9EL 1FZKA 1U8OB 1UWEL 1FL6B 5GISL 4OLXL 4IOIB 1AKJB 3HE7D 2VAJA 3V4PL 4GKZA 1MF2L 3DYPA 5M94B 2HFGH 3HNSL 1YN6A 4D0BA 4IHOB 5AAWA 2H8PB 3VXUA 1R5IB 4LIQE 3VXRE 3GJEA 1AE6L 2EO1A 1UGNA 4HF5H 3DV4A 4BELD 2A9NL 3TYFB 1JPTL 2YD2A 1BGXL 3OKKB 4WVRA 3D0VB 4PJAA 2PXYB 5C0CE 4ZD3H 3H6JA 3INUL 4F7PB 4MJIB 2DF3A 5JDSA 4NQEB 2GI7A 5HYQB 5L8LB 4NBZB 4AIOA 4JM2B 5KSAA 1ORQA 4W4OA 1KJ2H 5I75B 1JZ5A 5GHWH 2FGWH 1NSNH 3KPRB 5T1KB 4PRIA 3WSQH 2VDNL 4LF3B 2YD1A 2RHEA 3QPQD 3S35L 1WAAA 4MB5A 1MJUL 1MLBA 1ZVSB 1U93B 2ZCHL 3S9DB 1KN4H 1T04A 3SE4A 1H3TA 3BE1H 4LCWB 4NC2B 3CZFA 2PR4L 4WFFD 4X9GA 3TBYA 5IBTL 1OAZL 5F7DB 1ED3A 3MXWL 3NA9L 3QEQA 3OF6A 3QEUA 43C9B 1UA6L 3O9WC 2LV4A 5JA9A 4PJHF 2J6EA 2KL6A 1H8OA 5E2VL 4FQXC 2AJUH 2COQA 3FT2B 5HHNB 3EDFA 3F6LA 3ALWA 4ERSL 2YZ1A 4MXVF 2J12B 3VXME 5DQ9B 1DJSA 1KB5H 1T66C 4QRSB 2C5DC 4WO4D 1YEIL 4OZGF 1BZ7B 2CJUH 3AREB 3OXRB 4JG1H 4ONHA 3QNYB 1PQZB 1N0XL 2FRGP 5JO5B 3U4BH 2Y7QB 5TE7H 1FNFA 3GUTA 4P59L 4HS3A 5DRZB 1GCFA 5HGBB 5H2BA 1CDHA 3ROLB 3T8XA 4YJZL 1TPXB 4HS8L 3MRIA 5T3ZL 3SOBL 2BCKA 5C6TH 1HDMB 1HILA 4KUZH 1XCTA 2Y36H 3IS0X 3VXQA 2B7DT 1QBLH 3ULVD 4NO3B 3WKNA 3A6BL 3U48A 3CH1B 1L7IL 4G8GE 3O45B 3H9YA 3CX5K 4NT6B 5C0BB 1W8OA 3LD8B 1RK0B 3SE8H 1I7RB 1YNTA 1XR8B 3LHPH 1N4XH 2CXKA 1M71A 5EZOL 2MQCA 4Z78A 4AT6A 2Q1EA 1IGYB 1RZJL 5JW5B 4ONGL 3BZ4A 4YNYA 4AEHH 4JZOB 4GQ9H 1GL4B 4EI5B 5ISZA 2P4AB 2UWEE 3MUGB 5JXEC 1EAPA 4RFEB 4DGVL 4MSWA 2GJJA 5E6IC 2FO4B 4FQIL 4EI5A 3HC0B 2VH5L 3B2UD 3DNKA 3IF1B 3MFFA 4PBVC 1KIPA 2DD8H 2A6DB 3JWNC 3QUML 1KT2A 4G8IA 5ECJE 2X70A 4HDIA 2VZTA 2CLRB 1IAOB 2BY3A 4Z7QE 1E6JL 2ADIB 2DQEH 3RKDD 5BV7L 1AXTH 2OOXB 3SDCB 5GS0D 4PGEB 1HHGB 1AXTL 2ICWI 1MFEL 5CD3A 4HIEA 3EZJB 2HFEB 4WWKD 4G9FE 2YKLH 3STZA 4TULL 5BS0A 1JI2A 3MRJA 4UTBL 1RUQL 2NCMA 4X9HA 4TSAH 5EIIB 4YFLI 3TBTB 5L7XL 4GS7C 2X4UB 4CMHB 1U36A 3FB5B 4PB9H 2K7PA 3QQ3B 5JZ7C 3ARDB 5DJ6B 1DBAH 3CFBA 2ZJSL 5CP7B 5CCKH 2UYLA 2WUCH 3SEPA 4ZQKB 2QQKH 4G5ZL 3UTSD 3TBVB 1NMBL 4UOW0 5GSRA 3WL9B 4YIQB 3VD7A 2XA8H 2ZUQB 4FQPA 3RZCA 2BRRL 4TUKL 3RDTD 2ZUWA 4JHWH 2HVKB 2VL5B 3WS3B 1OF2B 4ZPTB 5IB5A 3MRQA 1WAAF 1IMHC 4QHNA 5L9DH 1OP3H 2ARJA 4MNHA 3O6FC 4UZGA 3ILPA 1H3PL 4PJ7A 4M5ZH 1LK3H 3OGOE 4JRXB 1IARB 3SN6N 1HCFX 2NW3A 3HPLB 5DRNA 3T0VA 4FG6C 1EMTH 2BNQD 4NN7B 5C8JB 5JMOC 5B4MC 3QQ9D 2VZUA 1CL7I 3KYNA 4K3JL 4L4VB 2YUZA 5C08B 4OZHF 4X4XB 3NTCH 1ZS8B 3DPBA 4QYOA 1F6AA 1IGMH 2VUYA 1HK6A 3OJDA 1JK8A 2KQNA 2W65B 4QWWC 1CD8A 4LCIL 1LEIA 4ZMAT 1IM3A 3FN0H 4ELMF 2BMKA 1A1OA 1QD0A 8FABB 3AUVA 3GJFK 4P9ML 1FFPA 4U6XA 4JY4B 1ZLVH 1X5IA 3T4NB 4DUVA 5JW4Q 5DZNA 1I3GL 1S9XB 4F3FA 3QYCA 4WHYG 5C07D 1P4LA 3U0TA 4X6BB 5IEKA 4P5TC 3DVNB 2IPKA 2SEBA 4YGAB 3DVNA 1KYOJ 3ZO0A 1PDKA 5E8OA 1E27A 4X99B 4HULB 1BQHA 4JKPH 4I5BA 3QZWG 3NMEA 4LOUC 1TNNA 4X7EC 1E4WH 3QEHB 5F21B 1CT8B 3GFUA 1NBZB 1RZKC 5ESVA 4ELME 4P9HL 4OLVL 4F57H 1WBYA 3L3GB 3IKCB 1A6WH 2YMXL 3EOBB 5C09D 4M3KB 4XCNB 1KLGA 3FRPA 4LCWD 3EJYC 5IFAL 3ARBC 5EZOH 1NGZB 3H9ZA 2X4TB 3NCJL 4U0RC 5GJSH 4G8GB 5GS2D 3STZB 2NY6B 1DQDL 5C8JA 4ZXBA 4LHUA 5FYKH 1OPGH 2XXMB 1MLCB 3VMOA 1A6AB 3SE9L 3VWKA 4FMFA 1MLCA 3FB5A 4KUZL 1MCOL 2Y5TB 4KAQL 2ICEA 3SQOH 1KB9K 1U8PB 1IVLA 3MLTB 2NTFA 3TBWA 5TGBA 1F2XK 2NY0B 5C08E 5BS0D 5LGJA 1XIWD 4XP9H 5B21A 3RWDA 4MSWB 2DQUL 2FGZA 5KBNC 5C08D 4XCCL 4AEEA 4WUUB 4ZTPL 5AWNL 5DD0L 2HKHH 5C0AB 1D5BB 2WWKT 3D69A 1TJHH 5EA0L 1R3KA 1EZVY 1J0HA 2BSRB 5C0AA 1UM4L 4X7DC 2IPTL 3QDGE 5J89A 5D7SL 1IC4L 4K8RD 2OXGA 3QSKB 4E42A 3MV8E 3UTSA 2P24A 3EUUA 1TZHA 3C8KA 2DDQL 2LABA 4KJPD 3O3DA 4Y4FC 1KJ2L 1QSFE 3EYQD 4NRYA 4ZFFA 3ARSA 4L4VA 4KVCL 3MLYH 4OFYD 2VISB 2BCKB 3PHQA 3MROA 3MUHL 3S5LB 5TQ2L 5ESQB 2V9TA 3X3GH 1EUTA 4ORZC 4PBWD 4KK9C 4IOFC 2HMID 3CK0H 5I8CA 1I8MA 4OD3H 3QFDB 2P45B 5F7KC 1G9EA 3VU2A 2V5SA 2JCCB 3MJ8A 3HC4L 2DJ4A 4POZC 1OGTA 3RU8L 1S7RB 4Y4FB 2H2PD 4S10A 2WWMD 1Q1JL 4KPHL 4APQB 1E28B 1ZT1A 3FFCB 4F2MB 3BMVA 1FNAA 1A6VH 3LKQB 3TBSB 5E8EB 1MFCH 3ZYZA 3JWDH 2PYEA 1JRHH 1X44A 4WUUA 3QEHA 2VL4A 3DETD 3RKPA 3O2VH 4BUHA 2VR4A 1YMHB 4HF5L 5SWZD 1OARL 2EYSA 5CSZA 5HI4D 1SM3L 3S36X 5D7JD 1FPTH 4HPYL 4L4VE 1FFNB 4CDHA 4EBQH 1I8KB 1QFUL 3PABA 3S36L 3WHXA 1VKXA 5DRZA 3P73B 5HPMB 4WHYH 3GSQA 4U3XA 1V5JA 4YHYC 2IFFL 3KPOB 2NW2A 3VDBA 7FABL 1IM3B 2FECL 4WV1C 4Z7VF 2C4FT 5C0BE 4NOBA 1QSFB 3STLA 2Y6SD 4LSQL 3QPXH 3T2NL 4RAHA 4Y2OA 4A6YB 1T89A 3FTGB 2RR3A 4Z7VA 1GPOL 2VC2L 4XNMA 3CFCL 4F7EA 1V7MH 1LE5A 1IEHA 1EGJA 4DCQA 3PXHA 4DN3H 2J7LA 5D71L 1MRFH 3AC0A 3W82A 2H32B 2CIKB 3P30L 5DMIH 1J8HB 5F70A 4WY7L 3PP3K 5GS1C 4L9LC 2E7LC 1Q9KB 5CILL 4AIZA 3UTSE 1HI6B 2X2YA 5BMFL 5C0JB 5FO8A 4R2GD 3B5HA 4ZFGL 1AO7D 4GKNB 5K9OB 4P0DA 3LS4L 4UQ2B 2ATPB 3UZVB 4P5TB 4PS4H 1WTGT 2QLVB 1IGTA 3DV6B 4WENB 5CS7A 2GIYA 3A0OA 1UM4H 1KELH 1NDGB 3ZLQC 5C08A 3VCLB 4WW2F 4BK5A 1VA9A 4M7ZB 2LVCA 4J4PC 3RVWC 1WBXA 2P49B 5ILTL 5J56B 1A6UL 2NY7L 3PWVB 1MAKA 3MLUL 3QQ3A 4HKBA 5JZ7D 1R0AL 4KPHH 4MCYA 3PWVA 3S98A 2W65A 1UM5H 5KSUA 5FUCE 4JO2H 4NO3A 3TNNA 5J9PB 3TDHB 4KROC 3TBTA 3E8UL 4AL8H 5MI0C 3BEWB 4BZYA 2V9RA 4P4KC 1YY9C 3MRDA 4ODXA 1EEZA 5TDNA 3WEXA 1A64A 2Z92A 4NRXB 5EBLB 5FB8A 4HUVA 3CK0L 1LK2B 1Z9OA 1EUUA 4TSCL 5AYQA 1S7UB 2FL5A 4LSPH 4Y5YC 4JHAH 5HI5C 1YEDB 2NY4B 2VDLH 3KPRE 4Y5VA 3HR6A 3HHRB 1HZHH 1NCAL 4MNHB 1S3KL 5DMGD 3MLYL 3FT3A 1BD2D 3MRRB 1FAIL 4QTHA 4L4TE 5CEXA 5HSFA 3GSNL 1MY5A 4IJ3C 1RURL 3UTTD 1VESA 2XZQH 1JNLL 1T80A 3VGEA 1ZKAA 3DO7A 3IDNB 5C9JB 1T0NA 1QLEL 3BOVA 4Z78B 1BECA 5DUPL 1U8NB 5EA0H 3CU1A 5DD5L 1P84K 1D5XA 2XN9A 3NIGE 4LF3A 5DK3A 4GAFB 4IIQA 2ADJA 3PWUA 4HEPG 1SBBA 2AK4D 3R06B 2R2EB 1EIBA 1F4XL 1WK0A 4IRZL 4O2CA 4OFVA 5EH1A 3D1MC 4MNGE 1BFOB 4NO5B 1K9TA 5I30H 1V7NL 4YXKL 3D25B 1FGNL 3QDMA 5E5RB 1WICA 2QBWA 1LK3L 1I3GH 3SDYL 2E6PA 1KB5B 2Z35B 4X5WB 5J12C 5IESL 5HY9B 1E4JA 3QUZD 3FN0L 3C8HA 3ZKMC 5EU6B 4NZRH 2O5XH 3JUZA 4PRPD 5E1AB 5C0DB 4PD4K 1DBJL 3KGRA 1I7ZA 1DQDH 2FJGA 4HBCL 1NFDF 1HHJB 4Y89A 5FHBL 2F58H 4M1CC 1VSCA 3L5XH 4JGMA 1NFDA 3OR7B 2A0LD 3H2WA 4C56E 4OQTA 2X7LB 3EDEA 1ZHKB 2ATPA 2X5PA 1EXUA 1MEXL 3UDWC 4LVHC 5DI8B 1ZA6B 5MENA 3L3DA 4MB3A 3FT4B 3QCTH 5DJDA 2Q3AA 1UADC 2QTEA 4M43L 2DI8A 3B6SA 3OSKA 3BUYB 4HUUA 3H8NA 1EO7A 2FR4A 4OLUH 4G9FB 2NMSA 4MQXC 4YHIA 4JVUA 5IMLB 5F7DA 5BV7H 4Y16B 1U3HA 3CC5A 3EO0B 1CGSL 2XPGA 4NO0B 2HVJA 1P2CB 3VFTA 2WUCL 2Z8VC 4HMDA 5I1EL 1ETZA 4JDTL 1JFQL 3I02B 3NCBB 3R0MA 3LKRA 4AQ1B 4KRLB 5EN2B 3ZE0E 4NN5C 5ID0A 5MERA 2BNRD 4LPYA 1IAKB 3ZHDA 5DQJB 3QG7L 4G6AD 3HN3A 4L3CB 5IVXE 2YN5A 5A2IH 3B83A 1OD7A 3WFHA 5IHUH 2W0FA 4MXWH 4MAYD 5IFJB 2UWEB 3WXWH 4I48A 1QHOA 1XMWA 1NGYB 4OF7A 1S7TA 4ORGB 4HWZB 1N8ZB 5D1QA 1K8DA 1NAKL 3PWLA 5SWSE 1U8MA 3LN5B 4X99A 5E99L 5B39G 3H7BA 4RA0C 3QI9D 3H3BC 1UCTA 3QUXD 4J3XA 3WFDL 1MCCA 3R8QA 1A7BA 5JHDA 1B4JH 4XP5L 2XG5A 5IJVB 2R23A 3D85B 4KU1A 1JGLH 4KHXL 2HLAB 2E8ZA 3QFJD 2EIDA 2HFFB 3HS0A 4PJ8B 3V7AE 1MCWW 1URLA 3QISA 3C5SB 1XIWB 5IGXH 5C0RH 3PWJB 3IFLH 4M00A 2R1YA 1XT5A 2YN3A 2AI0L 4ZUSA 3CLEH 4YDJB 3VD3A 1MFDL 2QREB 2D4DA 1U8LB 3GSXA 1Q9LB 5CP3H 5C86A 5FYLL 4XCFL 4AYFA 4Y2DA 5EO9A 1G0YR 1QACA 3BT2H 1B0RA 1FC2D 4NDMB 3RWGA 5C6TL 4PJ8C 1IKFL 3JV6B 3OKEA 3AMLA 3VFNB 4HWNA 3O4OB 3ARGD 1HWHB 4M9OA 5EWIH 2Z4QB 4XTRC 2DM7A 3PHSA 2E27H 5FUOL 5HHVH 2HN7B 4HLZH 4OKVA 3N06B 2GAZA 4EUPG 3BZ4B 3EYSH 1N0XH 4NFDA 1FVEB 1CE1L 4HWBA 1T1XB 1FP5A 5EUKB 1X5YA 5B39A 1VFBA 2ZUYA 1U91B 4OLZH 5ADPH 5ITBL 3GSWB 3LKSA 1NGWB 1UKTA 4G42B 4WTZA 3PHOA 4PJ9D 1QA9A 5DA4A 4RGNB 1CK0H 4BH8B 4GAYB 4PJ5D 2PW2B 4PREB 1BAFH 1VKXB 1H3GA 4GJTB 3THMH 1CDJA 3BSZL 4FFZH 2P5WD 1MCBA 4Z76B 1S9WA 3CFEB 5JA8B 5GRVK 1DQMH 4NQEE 5C07B 3FFDA 3RL2B 1JWMB 1BIHA 1T1WA 3VFSA 4XB8A 4J6RH 1MVFA 4F37K 4YFEA 1YEKH 4MQXD 1KN4L 3O4LA 1DQTA 4JFYA 4XVSL 1SY6H 1FJ1B 3Q48A 4RNRB 3UEZA 4E9LA 1UJ3B 3WJJA 3TVMB 2IF7A 3CCHB 5IROA 3ARED 2O5ZH 1UM5L 4J2XA 3EOAB 4CU6A 5KSBE 2FO1A 1S7RA 5IK3A 5FHAL 5DTFA 1MQ8A 3T0AA 5J13B 5I75C 1KELL 1FFRA 2ESVE 3ARDD 1RVFH 1UH2A 4MXQC 2XKUA 1A21A 5IJKC 1AGCB 4X6EB 4HWBH 3QA3A 4U6VL 5FAAA 1S7VA 3G6AB 4NGHH 3MLZH 3LS4H 5C70A 4NQCB 2MQ3A 2R0LH 3TVMC 3G04A 4FZEH 2E9IA 4UB0H 2GCYA 3U36B 5E56A 4GG6E 5EU3B 1D7FA 4XCFH 3VD9A 2Y5TA 4ZUWB 4UU9B 3MREA 4YHKH 3QAZC 1T03H 3K1DA 4TVPH 4PV8A 2ZG1A 4BK4A 4CW1B 2ZUVA 3KPRA 2BVYA 3F5WA 5CIPH 5F8RC 3IAQA 3BE1L 5IWLC 1OQOA 4W70A 2ESVD 3P4LA 5K9JL 1I4FA 3EDDA 5D71H 1CDIA 2V5MA 1HQ4A 3VXSD 4OBSA 3LQMA 4M62H 2ZUUA 4JN2B 2Z31A 1NCDH 4JFDB 3WSQL 4OLWH 1WEJL 4DQOH 4NQSA 1C08B 3HB3C 4JAMB 2GEEA 2R1XB 1ACZA 2EYTA 2HJKB 4DZBA 4OUOA 4FQXD 2V2WB 4N8CH 5FUZH 2IQ9L 3GMMA 4HT1L 3W11C 2VDQH 5DA0B 3IRPX 3EYUL 3OX8B 2Z0BA 5D2NC 5DURD 1JPSH 4GLRH 5C0BD 1HE7A 3X14A 1NAKH 4L3EA 4FFVD 3FB6A 4F15C 4XVTL 1JHLL 1ND0B 2OZ4H 4NUGH 1HXYB 2G5BA 2XOTA 1ITBB 4S1RH 3RRQA 5IROC 5EU7E 3UAJC 1Q9LA 3QDJB 1R3LB 2B0SL 4OM0L 4YBQC 4YAQA 2PF6A 1L4IA 5MEQB 3DOSA 2FD6H 3L3KB 1XGQB 3CDCA 3NZ8B 1CLOH 4IDJL 4XCEB 4GSDL 2E27L 3ES6A 1YYLH 3OKOB 5KSBF 4CW1A 1DUYB 3HUJE 4MWFA 1P7KA 2WM0A 3QDJD 4U33A 4NC0B 4CJ1A 4X4XA 1TJGL 5IMOB 1AH1A 1VEMA 1T5XB 4RAVA 3LMJH 2JF1A 3OAUL 5D7JA 2GTZB 1XCQA 4OD3L 4X4ME 2H1PH 5J1TC 1OLZA 3KXFA 3BT2L 4WUUE 2H8PA 1YMHA 4Z0BL 3VXUB 1WC7B 1KCUH 3GJEB 5C0FB 4UT7H 1U8OA 5KVDH 3GRWA 4FQ2H 5BRZD 1CLZH 1FGVL 2Y1VA 5IWLA 1IQDB 2DL9A 2CIIB 4A6YH 1CGVA 1UQSB 3DX6A 4JQXC 2F53D 4PJDF 3VMNA 4JFPA 3QI9C 1I9RL 4S1SL 2PO6C 5EC2A 3VXMB 2YWYA 1ZGLM 3PJSB 5GQBA 3S88H 3TPKA 3NVQA 1QQDA 4NNYA 2F19H 5GS0L 1X6LA 4HQQH 4EI6A 3LD8C 3T77B 1WT5C 1DBML 3DGCR 5TE6L 4KZDH 3O4LB 2AJXL 4BM7A 4BKLB 2BJMH 2X1WL 5HHMD 4D9LL 2IAMD 4KTEH 3IJHA 4QXTA 4IMLB 1KXVC 4Q9RL 4L8DB 4JQIL 4I8DA 2X41A 1BQSA 1RJLA 4XH2B 4HCRH 1H0DB 5B3NA 4Z5RA 3PWPD 4QRRA 3FB8B 5DJZB 5HHOD 3R4DA 5LAXA 1DLHB 1YPZB 4HIIA 5I1IL 4LOUD 3T0EC 4E0RA 5I19H 1FRGL 1FIEA 2NY3C 5C0CB 1T4KA 4GRLB 3FQRA 5CGTA 1EJOH 4DZ8B 3QUYB 1FSKC 5FKAA 1I7UA 1PG7W 2NXYC 1ND0A 1K5NA 3CH8A 4N0YL 4PR5A 5DEZA 2DQTL 3PWNA 1UC6A 2PKDA 4JDVA 4KXZH 4NQVA 3E6HA 3X11A 3MV8A 1Q9WB 3JWOC 4JG0L 5F9WC 4POYA 1RSFA 3UXFA 4PJEB 1RZ7H 1P7QA 3KLDA 3BUTA 3ARWA 4YHMH 3AS2A 5F7HA 3B9KA 4K3HA 3RY6A 4Q9RH 1PD6A 5CJXC 1DANU 2DQIL 2EKSB 2ZUSA 3K46A 2OI9B 1D9KA 1QBML 3MRMB 5D6CB 5C7XH 3MCLL 4ZFFB 1LD9A 4Q6YA 5DQJA 3WIIL 5F7EH 2APWA 4XVUD 5JLZA 1F3JA 2VABB 3BDBA 3MLUH 1KPUA 4OZGE 4PRHE 2F58L 2OTPA 1ZV5A 1KPUB 1T5XA 2QADC 3C5ZD 1Q9OB 2YA2A 2IADB 4KK8C 4PJXF 4HC1H 2O5XL 4JM2C 2X42A 1GSMA 4NQDB 4YEFA 3B8SA 1PSKL 3MLSL 3LN4A 2UZIL 3FOMB 3JTTB 4LBEA 4PV9A 1RK1B 4ZFGH 3VGDA 1JPFA 2PNDA 4PP1D 2ICWJ 3C5ZB 2HKFL 1K2DB 2A6KA 4LCYB 1M6OA 1CXIA 2IH3A 3MLVL 2DQCH 3W2DH 2SEBB 4BZ2L 3C87A 2E6QA 5JXED 1TCRA 4JN1H 5FKAB 1VADA 3V0VB 1R3HA 4ELMA 4NKDA 3HI1B 2ICWA 5KZCB 1JV5A 4YK4C 3L7EB 2IH1B 5D2LB 3S37X 1IJ9A 3RVVC 4OZHB 4BFIB 1NCNA 2Q6WA 3BZFA 1P7HL 4R4FH 2HMIC 5DFWH 1AR1D 3QH3A 4MJ4A 2VITB 1CXKA 1V8HA 1TENA 1FG2B 1T83C 2XN9E 3C5ZC 1I85A 3FB7A 3MR9A 2IEPA 4V1DA 1YY8A 4LMQI 2EIZB 5FYKU 4JFDA 4FQ2L 4UBDC 5I1IH 1U3HB 3CC5B 4V2BA 3EO0A 4HG4K 1UB5A 5ALBL 5L2KB 1KCRH 4GW4B 2NNAB 2GITA 2Z93A 4YE4H 1DCLA 4NKMB 4M48L 4U1MB 4N5UA 5DT1H 3WFEL 4R7DA 3OX8A 3KLAA 4P48A 2YK1L 5BV7B 3R1GH 4RFNB 5EOQH 1BMGA 1N59A 1TPXC 3HTLX 3PWUB 3H3KA 3G5VB 1MFEH 5EUOF 4PJBE 3TA3B 3TYFA 3DV4B 1G9ML 2D2OA 3PQYE 2MNUA 4JFDD 2WUBL 3RZCB 1AC6A 4NZTH 2ZCKH 4G8EA 1K5NB 4PR5B 4JJ5B 1A6PA 4PBXA 4F7CB 1UYWH 2X4RB 4Y19D 3OKNA 3ILQC 4OLWL 2FWOB 4JZJB 1OY3B 4M1CD 1PYWA 1TTFA 2W9EL 2X1XR 1DE4B 5IB3B 1CICB 3OKDA 1ZGLA 3QIUD 1IM9A 2ZPKL 5JPMB 4I4WB 4KROD 3L5IA 4I9WE 1RJLB 5JLZB 3WUWA 1Z9SA 2EDOA 4KFZC 3SE8L 1J0IA 1ZHBA 2AV1A 4ZOBA 2YC1A 2EKJA 2CRMA 3GMNB 3RI5K 2MKLC 5HPOA 1MCIA 2H1PL 4OQ1A 4Y5XC 5JHDE 2C26A 2GHWB 1JPGA 1X4YA 1KIRB 2F15A 4WFEE 1HXYA 3RHWF 4J8RA 3MUGA 4XPGL 3SDDC 1B2WL 4M6NH 1KBGH 3EOBA 5FGBA 3RNQA 4Q9QL 3BXNA 4GKNA 5HD8C 3T0EB 3K80A 5IEHA 3DWTA 3KNBB 1FNHA 1PZUB 1CU4L 1S7XB 2FECI 3SQOL 2VWEE 1T1XA 4IRJA 4TTGA 1QG3A 3MLZL 4YQXL 1FYTE 2MPAH 3PQYA 4B7LA 2NY6D 3D48R 2MTPA 3WNKA 3GGWB 2EXWD 5FGBC 1J88A 5FM4A 3UTTE 5F9JA 2R56L 2HRLA 3MRIB 4ODVH 1YY9D 2GQHA 5F6HI 5F9WB 1KG0A 4XCEA 4PREA 32C2B 2E7MA 4PP2B 1OTSC 1F90H 1TQCC 2CKBA 5LCVH 3FQUB 2ITDB 4LLQA 3MRGA 3V52H 2EEBA 3SGKA 1S7SB 1YDPB 3B9DA 1YA5A 3BI9X 4CVZA 2IAND 2G9HA 2WBJB 2MJWA 2R23B 3VXRB 2QJDA 1Q38A 1S8DA 3BP6A 3HR5B 4RMTA 5I8EA 3S96B 3FMGH 4KQ3L 2QADB 4LVNC 5EC2B 5ELIA 2LTQB 4MA3B 4RFOL 2GJ6A 5D7IA 4MQ7B 4Z7WF 1KIRA 3NGBC 4YXHL 3T0XA 4K8RC 3SCMA 1WQVT 3OJMB 3SKJH 1ZHNB 3D85D 4D9RE 4XP4H 3QRGL 2APBA 3L7EA 4LHQB 5E7BA 1KCVH 1ZHNA 3L5WB 4OUUB 1S7QB 1T21B 2NY4D 3O6LH 1A0QL 2FB4L 5JQ6H 3R0NA 3CZJA 1F6FB 3THML 4QOKE 3UMTA 3L6FA 1ZHKA 4YQXH 1XIWC 4U6VH 4EXPX 3LB6C 1SEQL 2DM3A 3CX5J 4P4KB 5IHZA 1MAML 1QSEE 1NGPL 4XWOC 1WWCA 5KVGH 2X4TA 1GGCL 1HSAB 1HHHB 3IFNH 4DTGH 4OLZL 3L1OH 1TJHL 1DUYA 3SCMD 4YUEL 4PJGE 2E7BA 1IAII 3E3QE 1J9CT 4WW1A 1WFTA 3BVNA 3U9PL 4KK9D 2KZWA 3CNKA 4WW1B 5KSUB 1EMTL 5HGGS 2WAHA 4ZS6C 1GVIA 3A67H 3VI4E 3MREB 4D9QE 1X6NA 4N8VB 2IMMA 1TDQA 3RNKB 4WU5B 3VFRA 2I9LA 3ZKXC 2J8OA 5AAMA 5I1JH 5D7IF 4M5ZL 1FE8H 1QR1A 1OL0A 3HZYA 4LVOC 4WJ5A 3BZEB 3AB0B 4LCYA 4U0RB 3M1BA 3BQUA 5DGQA 1MPAL 1TXKA 3GO1L 3V0AC 3NAAH 4HGWB 4BSWA 4GAYA 3KPTA 3KPPA 1J1XL 4JO1H 4OGXH 3LEVL 5D2NA 4KQ4H 5CIPB 4I48B 3CVIL 2HFTA 2XA8L 1YQ2A 3ZTNH 3BH8A 7CGTA 1OLLA 2PYEB 3V4VL 4HHAA 5EOCJ 5B39B 4UV4H 4NQVB 3GMMB 3SJVB 1FO0A 3QHTC 5AYUH 2Z31D 4P5TD 2GJ6E 5D7IE 4ENEC 2VLRA 2P5WB 3L5JA 5DHVA 2EDFA 1F3JB 1NEZA 1N2RA 5SWZE 3KS0J 4LPVA 4H0GA 4KHXH 1OP5K 5BOPA 4QYOB 1ZS8A 5DSCB 5GRJL 4CN4A 1WFUA 3SBWC 4XMKL 4PRPA 4D8PB 1BF8A 3MOAL 4OM1L 3QIWD 4B50A 5T3XD 5I1GL 1R24B 2K7QA 1IC5L 4Q0XH 4PP2A 2F9BT 4NO5A 4NWUH 2AXHA 2CKBB 3P0YH 4H20H 3QP3A 4ZUTA 3CSBA 1YC8A 4P9HC 1EK3A 3ORJA 5INDA 4GG8B 3WEXB 3V4UH 2EXWC 4QHMB 4LLAA 2R2HA 2C1OB 4LLDA 4R4BB 4X98A 1E4KC 3IGAB 5E8DH 5CP3A 1YN6B 4QRPB 1JNJA 3HE6D 43CAB 5D1XD 4X8XA 2VDKL 3FQRB 5GRUH 3QUYA 1JPFB 2VLJB 4YWGL 4QRTB 3RNQB 4KK5C 4F7MB 3MV7B 2EC9U 1G0DA 4ODBD 3ZL4L 5ESVB 2ENYA 4ONFH 1NKRA 3X13A 3P4MB 1UACH 4N0CD 5CKAA 3OZ9H 4L1HA 5FHBH 4X4MA 4XCYB 3FONB 4RMUA 5SX4I 4HBCH 2WWMC 2ED7A 3LRHA 2CDFB 2JK5B 2QQLL 3WE6B 1BVKA 1QZ1A 2AV7A 2AXGA 1FVDA 3QDGD 5D6CA 1I1CA 5CEZE 4EDWH 2WV3A 1UB5B 1Z9MA 1A6AA 1OM3H 4W81A 25C8L 2NY2B 4XAKE 4ODWA 1G7LA 1KFAL 1QQDB 3MZGB 2XZCH 3PGDA 5ERWA 4Y5VC 3IFOA 1LK2A 4P59H 3U9UA 1NMBH 1S9WB 2XY1A 4PJDE 1DR9A 3GMPB 4P4RA 1SEBA 4NQCD 5DS8A 3WHE0 5K59E 2UZIH 1MJJB 4U4BA 5C0EB 1QRNE 1F58H 3RVTD 2CIIA 1VACA 1CD1A 1DBJH 5I18L 5T3XH 2YEZB 5GRUL 3NCYS 4HK0B 2ORBL 2XICA 2XYCA 3TLRA 5KSAD 2DIAA 2WBWB 2VXSL 4Q97A 3ZYIA 1DSFH 5L8KB 3GIVA 5DJZA 1BZQK 3KHQA 2IBGA 4LGPB 2X4NA 1A1MA 1OTTC 3D5OF 4EQ2A 1N26A 3F12B 1L0QA 4I9WD 3NA9H 3C5JB 4EN3A 1DEEA 3MYJA 2DKMA 4TSCH 1I9EA 5J8OA 3C5JA 4NCC1 4R0LC 4HMCA 1P7KB 5IKCB 1CFNA 4KI5E 4QF1B 3LOWA 4GRLD 4YO0B 2XKNA 1CL7L 1NGXB 3AREC 3KPLB 1WBZB 4JG0H 3VFVB 3GB7B 2I9TB 3U30C 2Z8SA 1PGRB 1OGAB 1U8JA 5GGUA 5EUOB 4YDVA 2XZQL 3RUGF 2QADD 3L3KA 4UDUA 3T4YB 3T04D 3LKRB 1NANI 1JTOA 3H3PL 5ANMB 5EFIB 1MCEA 3RTQD 1RZGA 4AENA 1FAIH 3H7LA 3MGTA 3GSRA 5F7MC 1LD9B 5CAYB 4XI5D 5F7YC 4LSPL 3KJ4C 3QDME 1KJ2B 1L7IH 4L8SA 4ZO7A 3QXWA 2HT4C 2PTTA 3WIFA 2V2TB 2Q3ZA 4JHBA 1ZT7A 3T3PF 4UT9L 5FYLD 5CEXB 1HI6A 4S1DD 1WC7A 4JM2F 1K6QH 4XWGH 5I9QB 5I71C 4H26A 2BNQE 2AK1H 2B2XL 3OQ3B 5D2LF 5E6IB 5ISZE 1IEAB 4K9EC 4GAJL 3EFDL 1NFDE 3MJ6A 4ZDHA 3QO0B 4JREC 4WI2A 5CINH 3O2WH 4UIKL 4GMSH 4OIIL 4QRQB 4XPTH 2ITCB 4MHHG 5I73B 3B9EA 4IM8A 2AJVL 4MMZC 3TN0C 1G6VK 3K8KA 1QFWI 3VG0L 3S3SA 4A2LA 2V7HB 4ERSH 4JKKA 1MJ8H 4KH2A 3QXUA 5I71B 2EH8L 4WGWB 4KKCD 3IJHB 4MAUL 1IFHL 3FZUC 4QXTB 4X80H 5L2KE 1UA6H 3TN0D 4DVRH 5CD3B 5I16B 1EVUA 3QIUC 4PUBL 3AVEA 1I8IA 1QLRA 1ZTXL 3V5DA 4M7LL 2YSSB 4YHZL 4RISL 4XBEH 5DJ2B 3RKDC 3BDXA 4N1CA 2ZCHH 3RHWK 3ZDYE 4OIAA 1RIUH 5J1AA 4QHNB 2W9EH 5F96H 1MI5A 35C8L 3KR3L 5DC9B 5A2JH 3UTTA 1MFCL 3U6RB 4KDWA 1JZ2A 5J4MA 1A6VL 2R0WH 4X6DB 5GHWL 5C0GA 1AI1L 4XAWL 4DZ8A 3TJEL 1KJ3L 4JRXD 4AM0B 4G42A 3UYPA 4MGXA 4YDLC 5INCA 1QFHA 5KANI 5GRZA 5D1QC 5CEZH 5T1KD 2XTLA 3QFJE 2GYSA 4WDIA 3DX8A 4NHCL 1IL1A 1EEYB 3VFOA 4UOW1 1CDBA 1WIPA 5D9SA 1A4JB 1PEWA 3MBXH 4KVNH 4PS4L 2AK4E 3DMMB 1QNZH 3KPSD 1RUPH 1NMCB 2I60L 4LHUB 4PTTB 3V8OA 3WXVH 4IS6B 4PTTA 4AEIL 5LGJB 2R1WB 3T3PE 1G1CA 3BZEA 5HHXH 1EEZB 4YDJA 2BFVH 3KWWA 1LP9B 4K8RL 5DGRA 3OKOA 3S6CA 3NIDF 2P48B 4EDXB 5TH2B 4HJ0C 1A7PL 3RVWD 4F15B 4X9IA 3VFMA 4LNRB 3OKNB 5DXWA 5DD1L 4QLRA 5LWYL 1OTTD 1F8TH 1CQYA 4ZODA 5LBSL 5E9DA 1CDCA 4P46D 3GMRB 4HIXH 3MNZA 3TIDA 2YPVH 1NCUA 1Y18B 3RX8A 3X14B 3MGOA 1DANT 2BSSA 4JFXB 3VWKD 2DYPA 3ZYOA 1TJIH 1IFHH 4X80L 1FPTL 2CH8A 5IG7A 2DQDL 3UCRA 2EH8H 4U1HA 1U3JA 3V7MA 5EOCH 3QWRD 4NGHL 3I6GA 1QNZL 3U7YL 3ARGA 4WWKA 1O0VA 3GBLA 4I3RL 5HYEA 4E41E 4KV5E 1VFOA 4R8WH 2A2QT 2Z92B 4NRXA 5E2JA 4F7EB 5FB8B 5ICZA 1IEBB 3ARTA 4RMQA 3HE6A 5FECB 4N8VA 3ULVH 5GJSL 3WO3B 4OGAC 2WMPA 3O6ML 4QXUH 1V3LA 1JF5A 2OR7A 3IDJB 1VB9A 4N0FB 1LO3H 4PJ9A 1HHHA 4X6CA 1NGQL 5DC4B 2D3VA 4LLMA 4C83A 1MY7A 1BVLB 1H3WM 2AJZB 2XY2A 3I84A 3TPUA 5ID1A 5DEGA 2FX8L 4X6CF 2LU7A 5IQ9A 2VDPH 4CDGC 1LEGA 1OP9A 5CJOL 1RZ7L 3GHBH 2C7UA 3D0LB 5GGVL 4XBEL 4OFYA 5E6IA 1NDMA 1T22A 4AZ8A 2OJEB 3ALPA 4J6RL 4JFEB 4Z8FH 4DKAA 3VA6A 4BQ8A 1OSZA 2ICCA 3T09A 3HA0A 2GJZA 3RJDA 5IVXF 4WNQA 4U3HA 3WV0A 2FBOJ 4N68A 3I75A 4C56A 1P2CA 2DI9A 4UDTB 1XGPB 2BNQB 1ETZB 1WFNA 3BQUD 5HYJE 4ZNEE 2JCCA 2H45A 1MJJA 1E4WL 4BH7A 1ZHLB 3GBML 4HFWA 1A4KA 2A73B 3IT8D 4LCUA 3ZKSD 4PRIE 5DUBA 4PRAB 1DLFH 3U9UB 3MRMA 2WW8A 3GNMH 3S5LG 1JZ8A 1CVRA 4YR6A 2D0GA 2IG2H 4LASL 4NNXB 3AS0A 4KGJA 3HKFA 2VXVL 5F93C 5EU5B 3UTZB 1WWAX 2YPLB 5TFSH 5TE6H 4DKDC 1AGDB 2CDGA 2JKXA 3X12A 4UQ3B 1XGTA 2PO6B 4KZEL 2AQ2A 3RWIB 3C6SB 2H2SC 5T1MA 3SE9H 5IV2B 3IU4L 1FN4B 1T1ZB 4HZLA 3SDDB 5FM5M 2YD7A 5IVZA 1UXSA 3MACH 1CFBA 3BPOB 4TRPH 5DTFB 1OQXA 1T83A 2ZOKA 3KLSA 5C0CA 1P4BH 3UJJH 2VQTA 3RUGA 3QO0A 4A6YL 1Q94A 3W39A 3TBSA 1XF5A 4TVPD 2FYYA 4KK5D 4LEXH 5C7XL 3MPCA 4P99A 3BH9A 4JY6B 1KB5A 5HYJA 2DLFL 4HUVB 1H3VA 4IRSD 4JRYA 1N64L 3MBEC 1OAXL 4QOKA 2BNUB 4TSAL 4EDWL 4I1NB 3RGHA 4DW2L 5BZDB 5IB4A 4LSRH 4OCYH 4CAGA 3RBGA 5L88H 1ZGLP 3PNWA 1IGCL 4HFWB 4PLJC 1TLKA 2BRRH 5DUBB 3KXFE 1FNSH 5KSVA 4O9HL 4OD1L 4NP4L 1J8HD 5I1GH 3SDXB 3GMLA 4MXWL 5F7NC 4LDLB 2PXYC 4DEPC 5L2JB 4XNXL 1D6EA 2Q20A 4IEFB 1A3RH 5GXBB 5IHBA 3D85A 3DX6B 1UQSA 4PJFE 4OZ4A 4X7FC 5HVHC 3IXTA 5H37H 1DN0A 3TO4D 4ODTL 1X5JA 5KJRL 2RFXA 4TULH 4K2UH 1ZE3C 5EIQA 4PD4J 3BWUC 1XF2A 2WQRA 3LHPL 3WS3A 3CVIH 4XPAH 5FUZL 4JO1L 2F8OA 4KY1H 4ZUTB 3RWEB 2YS4A 3NPZB 1GGTA 4OCYL 1J86A 1LEKB 2BK8A 5GRXG 3JWOL 4Z7NF 3MOAH 1HHKB 4JFOB 2V7HA 3O3AA 5D7KE 4YHLL 2HTKD 1G1YA 4WI5A 2HJFB 4ZTOL 1EVTC 4GKOA 4NBYB 3ESVF 1C5BH 4TUKH 3WLWD 2AKRB 2CQVA 5FEBA 1ZVYA 4KHTH 4ZUUA 4ONGH 3UYRL 4M8VA 2J6EL 3BQUC 5FO9B 2GSGB 2P1YA 4XNYH 3ABZA 3AB0C 4HUXB 1IBGL 2W91A 2V5RA 3VGAC 4LLVA 1NC4D 4RRPA 5FGRA 5C07E 3TC9A 4Z0BH 3FT2A 1ES0B 2NY5H 4JZJC 4BYHA 1KCLA 1MPAH 2Y36L 4PJCA 5GSVA 1OSZB 3MGOB 4JFXA 3MRPB 5DI8A 5MHSE 3MZTA 1GJIA 1RJYB 1TCRB 3QHZL 5JW3L 1S78D 5EU4B 4ZXBC 2A83B 4HXAL 4ODSL 3O45A 4QHKJ 2A0LC 2MWCA 5E6YA 1S9VB 4GSDH 2W60A 2H26A 5T1DL 2FJHA 4A6YA 5H35A 1JBJA 5EBMA 4Z7VB 4AT6B 1FNLA 2PYEE 3UROR 4ZO9A 2DQFA 3IFNL 4DTGL 3ZSSA 3G6JE 1PX3A 1I4FB 1NGPH 5FK9B 2NXZD 4S1RL 1RUKH 2WQ8A 5I6XB 1LILA 1OW0A 2EDLA 4RMSA 1LP9A 5AZ2L 4BZ1L 2I26N 4G6ML 4CN6A 2CKBL 5E2TH 3I6LD 5J12B 5BS0E 3P40A 5E9DD 1LP9F 1U95A 2Q8BH 2IAMB 5E5MB 3O41B 2V7NA 1JIBA 4UILH 4UUJA 3I50L 4M7KH 2YHGA 3O2DH 3NIFE 2ZNXA 3H9HA 4YXHH 4OV5A 4NOFA 1CGYA 2XQBH 4F9PC 1TVHB 3IDUA 3GHBL 3MJGX 3G6JF 1YJDH 1CU4H 1K4DA 1FDLH 4G8IB 4OTXL 2AXFB 2VQ1B 1I7UB 2K3TA 3SCMB 4J8RB 3BH9B 1F11B 2AXFA 3CXHK 3NCYP 3A67L 4ONOA 3UO1H 4P23A 4K9EH 4YH6A 4PY7A 1FBIH 4XNMB 4LVHB 4XCYA 1FH5L 1A6UH 5FV1L 4ZQKA 2HT4D 4JG1L 4U7KA 2DLTA 3C60D 4H8WL 2CRYA 5T5FH 1VDGA 2F54E 4JFED 2NY5C 2X4PB 4NM8H 4KRPB 2F54D 4JFEE 5SWSB 2B8OT 1GC1L 2YD4A 4QT5A 3E0GA 2J1KA 4OFIA 1OTSD 4HWBL 2E6JA 3DLQR 4G43A 2HFGL 2Q76B 3HNSH 4L8DA 1LWRA 5JOFA 4LK4A 4WWKC 4G43B 2ADGA 5FYLH 1XGYL 2N1KA 5CILH 1MH5B 1UEMA 4U1KA 2J8UB 4Y19A 3D39A 4XC3L 1DBBL 3QCVH 3C2AH 2AGJH 1YZZA 3IETB 4XPGH 3RJQB 4PJ7E 4U1JB 5SWQA 1G7HA 1BJ8A 2VDOH 1R5WB 4CMMB 4S11A 1GOFA 5D7LE 1D5XB 2XN9B 3WO4B 3K2UL 1CGUA 4N0UE 2A6DA 5ABDE 3HZVA 4WHTB 1MWAB 2YWZA 1WBZA 4HC1A 3ZZ1A 5IOPB 5EUKA 4CN1A 3QCUL 1AY1H 1JGLL 4KDTC 6CGTA 2X4RA 4OZHE 3LV3B 1KPRB 1INEL 3I75B 2A83A 2NXYD 5B8CB 1K4DB 2CR6A 3MV8D 1SYVB 1OD9A 2E9WA 4NRZA 4MA8L 3PGFL 3VMPA 3U6RA 1BX2B 4M93B 1RFDH 2DJUA 2YA0A 1INQA 4Z77B 3FRPG 1TQCB 1IAIL 3T0ED 4L4TA 1XF1A 1OHQA 4EEEA 2GUOB 3OR6B 1NFIA 4GMTH 1BQUA 3DJ9A 1AQKH 3WO4C 3NIFF 1T1YB 2AJSH 3S5LA 3MOBH 5FM8A 1UVQB 3TFKC 1HDMA 4WW2C 1IM9B 4JZNA 4YDKL 1IGFL 3NOIA 3V4PH 1YY8B 5LGKA 1BQLH 3T4YA 3VWJD 1JL8A 1QSED 3SKUD 1MHHB 1I1FA 4C83B 3LKPA 4Y5YB 4Z18A 3QNZB 3G5ZB 4M6NL 3KJ4B 4U1IA 4XPBH 5FYJH 4ALAH 2MHAB 4O51A 1OP3K 3W9DA 1BWWA 4I3SH 3RUGB 5HHPA 4HUNB 4MJ5B 2DWEB 5E8PB 2NY1C 3I3EA 5L88L 3TA3A 2WBKA 4OCMC 5FYJU 2VUOA 3D0VA 3SE4C 3OKKA 3HNVH 2A6IA 5HTSA 3VGAB 4LSSL 1A4JA 4GBXC 1CBVL 3DETC 4NN6C 4OCSH 3UTPE 4H26B 4M7LH 1XFPA 2DMKA 2VLKE 1DQLH 5JW4R 3EDJA 3TO4C 3OV6A 3NBNA 5IM7B 3U83A 3UTPD 3TNMB 3BXNB 2DI7A 3RGVA 3MNZB 3TIDB 1AQDA 2AI0H 1K8IA 5F1NB 2XTJB 4WFGE 1OB1B 3VFGH 1JK8B 3OJDB 4ZXBB 1PSKH 1A4KB 1CDGA 3DXAA 1MLBB 1G0XA 1FG2A 1ZVSA 2Q8AL 3GSVB 4JFHE 4LVOB 5DHVH 2B4CH 1KLFA 4X9BA 5JMRA 2GJ6D 3GMLB 3N50A 4OIIH 4EVNA 1ONQB 5C3LD 2E7HA 4GUPB 2H6PA 5C09B 1OAUH 2JCCF 4BJLA 5EUOA 1I3VA 3D39B 3U1SL 3UJIH 2J8UA 4NZTL 3DO3A 5FF6A 2BHUA 3TM6A 1AFVH 4RA3A 4UNUA 1UB6A 3U79A 3KYOA 5DJ0B 3ULUL 3O6FD 4G8GD 4NKOA 4KV5F 5E99H 4FQQA 5HI4C 4R0LA 3PHQB 4L8CB 1CFQA 1T7VA 2A6KB 1L9NA 5H37G 3WXWL 1EGJH 2HVKA 4Y4HC 3TZVC 4O58L 1SBSH 5CEYB 5JPNA 1C1EH 3WFBH 3W0WA 5E2WL 1A6ZB 4XXDA 2X70B 4HDIB 5E8NB 5J13C 4LPUA 4CU7A 3VFGL 1MHPH 2R2BA 3K4ZA 1IAKA 5T1MB 5GJTL 4RWYL 2DQHH 1UM6L 4G7YH 5GJTH 1FRGH 3RVXC 1X5LA 3G08B 1HWGB 1FIGL 2VABA 2E3VA 4MLSA 1RZ8A 1YN7B 1MFNA 1XCTB 3ULUD 2HYMA 3M17B 4ZS6D 5MEOA 3RBSA 3L3OA 1FO0H 1R3IH 3DHJA 1OSPL 3N9GH 4GW5B 2AEWA 4WFGD 2XWTA 2VE6A 3S34L 2VKXA 2HLFD 2D03H 2A6JA 4UAOB 1G9NC 4ODHL 5IF0B 4AENB 4WFFE 4QTIH 3O8XC 1IAMA 4OJFH 3LEXB 2VLRD 2ZSVB 1EAPB 4RFEA 1KLUA 4JFQB 4YXLH 4PRHB 3GHEL 4KKBC 4HKJB 3GMOB 1N3NB 5ITFB 4KMTL 3HUJA 4L3AA 1ZANH 2B4CC 2AJ3A 3CUPA 2A1WH 2R1YB 2GJZB 3TH4T 4R7NA 3QR2A 4HHAB 5GGRA 3C6LD 3L9RA 3WFBL 4PP1C 4PLNC 3D69B 3CIQA 5D2NB 5JPNB 2FX9H 4MDIA 3U0PA 4U6YB 1VGEH 1AGBB 3SDDA 5CGYC 4B5EA 1E4XH 5JOPD 1GZQA 3O3EA 1RUAH 3O8XB 1Q72L 5DZLA 4CADB 1T04B 2YBRB 1K4CB 5DMIL 2AJZA 4L4JA 4M61B 4TNVF 4XRCB 3U0WH 3GM0A 2YPLA 3SDCD 4KWUA 3OAUH 1JI1A 1RZIA 2VC2H 4PYGA 2P8LB 3DX9B 1YPZE 3M8OL 1LDPH 3QFJB 4R90H 1J11A 1X7QB 1NH6A 4FTVA 3NABL 5E2UH 3ZE1F 5I1KH 5JHLL 3DSFL 4XP6H 4RMVA 4XXCC 4LSDA 3F65A 4PRDA 1IQDA 3UBXI 2ZWLT 4PJDB 2B1HH 2VMFA 2ZP0T 5F3HA 3DROB 5HHQB 4JHAL 3UBXG 2NYYC 1ORQB 3ILPB 5I66B 3O4LE 1CXLA 4PRNA 4PJ7B 1H3XA 3ZE2F 4I0CC 3BH8B 2I60H 2PETA 5I73C 5IEHB 3DARA 1EFXD 4ZO6A 3J8F7 4NPYA 2E5EA 3ZE1E 3L3DB 1EBAA 2BNRB 3VXMD 4JFHD 3QG6B 3WNLA 4KTDH 1AP2B 3QQNA 2JJTA 3MLXL 3UTZA 2EIZA 1T3FB 4H88H 3WS6A 1BLNA 3MRBB 5C09E 5GS0H 4JN2A 1A7RL 3TEUA 4OM1H 3BRFA 5DQDH 3UO1L 1LEIB 5HPMA 2UYLB 1RUML 4LLQB 3FQUA 3W0WE 3G5ZA 3MRGB 2XT1B 4KKLD 1WCBB 4NUGL 3FB8A 1WSST 1I9RH 3DBXB 1JZ4A 1HQRA 2CR3A 4QRPE 5I2IB 2IALA 2R2HB 1PKQE 3BP7A 4FNLL 1I85C 1CFTB 3QCVL 3CGTA 5EZJA 1QFOA 4K71B 4AK1A 3MV11 4Q74A 4M1DH 4NWTH 4Y4FD 2AS5M 3BD3A 3CFKA 4WY7H 3JVGC 2RIKA 3A6BH 2P8PA 3KNBA 4YBHA 1U6AL 4WCYH 2G2RB 4OI7A 3L5WA 4JRYB 4MDIB 5B8CA 2Y06H 2B39A 4NFBA 1SJVA 4WIQA 1FL5A 2P5WE 3L95B 3W39B 1RJZA 1B3JA 5EO0A 4UTAL 1P9MA 6FABH 5T1DH 3C6LA 4DKEH 4Y2DD 2XI9A 4L8BB 5M7QA 3QHFH 3GBNH 3BN9C 3KPOA 3O6FB 3ROOA 3CFBB 4HXAH 1S7SA 4DAGL 5EO1A 4LRNH 4YHOL 5I8CB 2DB8A 1I8MB 1I1AB 3SBWA 4D2NA 2YD9A 4LARH 3UP1A 2BC4A 1IEBA 5GGTH 2FL5B 3UPRB 5E4EB 1BVZA 3F58H 4M7LT 5C07A 4WFED 5T1LA 3U2SB 1GC1H 4OT1H 1U3ZA 2AABL 4W6WB 1MSPA 4KI5F 3U7AA 3ARBD 3I50H 2FBJL 1NJ9B 1BREA 4R96A 4QT5B 3TFKD 5GGVY 1MCJA 3NCJH 1OAZH 1H3UA 5CBEA 5DMKA 5IBLD 4BZ1H 1BAFL 1NBQA 1PYWB 3ZKNC 5D1ZA 4DQOL 3MFFB 4F9LC 3FMGL 2IQAB 1M7IB 4GBXD 2UVEA 3FQTA 2BXYA 2F53A 2E7LA 3L3HB 2DLIA 2HG5A 5J6GA 2FSEB 3H9SD 3MA9H 4NUJB 4XVSH 5KOMC 2P5WA 5DQDL 1QLFA 1AO7B 1YEKL 1A5FH 4X5XB 4XMLH 4BQCA 5F7LB 1J1OH 1M6OB 2D0FA 2IANB 2VIRB 2OK0L 3MNVB 4YFDB 1FHGA 2Q86B 3QEUB 3KVQA 3CFEA 4G6MH 3O41A 5I0ZA 4XBGB 4B41A 1U3HD 5E70A 1YNKL 2MOVA 4LCIH 4V1DD 5EFIA 12E8H 2ZOLA 1HCVA 4M1GH 5B4MD 3WD5H 5FGSA 3V5HA 2IMNA 5EULV 3TF7C 4Z7QF 5SWSD 1U8QB 1HQ4B 2DL2A 4ZTPH 2HTKC 1XZ0B 4NM4H 4XBPA 3DSFH 4IIQC 4F80A 3DRTB 3EYVA 1ADQL 4YDIH 5E1HB 1A7NH 1O5DT 1C5DA 1VFAB 2APXA 3HNTL 1H3PH 4LAQH 3B4NA 1A9EA 2FIKB 2YA1A 2OXHA 3UTTB 1RJYA 1IZKA 1S7XA 3GKWH 1F4WH 4Q6IB 4FXGB 3IXTB 4HH9B 4OB5L 5CWSB 5H8DA 5KG9A 5DJCB 3OKEB 3VWKB 1QVOA 3PL6B 1ROWA 1A9BB 1ED3B 3LSOA 5HBBA 1LNUA 3GSXB 2DN7A 3IFPB 3IFLL 1I75A 5HGHB 3ISWA 1Z3GL 4KJWC 1J0JA 1A7OH 4TTDD 4PJCF 3OG6B 4P4RB 3MV01 1B0GB 4LSVL 4XPFL 5HGAB 1OWRM 1PY4A 4JFQA 4N90D 3I02A 4HBQA 3FZUD 4LP4A 1K8IB 2VB5A 4KMTH 2CLZA 3LAFA 2A6JB 2HJFA 3GHEH 4KZEH 1II4E 1NBZA 3RVVD 4KY1L 4KTDL 5JDSB 4GRLC 1JP5A 4YBQD 4AIXA 5DMYA 4DOHE 4NJAL 1U41A 4OLYL 2IH1A 1NDMB 4OZGA 2P42B 3H7BB 4Q0XL 1L7TH 1C7SA 4M5YH 4MD0A 5IB1B 1DLFL 3F12A 4HCRA 1SMOA 4EZMA 4CJ0A 3KPSB 4JFFE 2HG5B 1VFAA 1HYSD 5JNYB 2YBRA 4YE4L 1DFBL 3MBEB 4U6YA 4ZSOA 3G08A 4R2GC 3V5KA 5CGMA 2QKIB 1RZKH 3HE7B 3JXAA 4OQTL 4YEEA 1R5VB 1C8PA 2QKIA 3HE7A 1WISA 1PKQB 5I8OH 1SJXA 4H1LB 5D5ME 3V6FA 1UWXK 4UMGA 1UH4A 1UJTA 4HG4J 4PGBA 5IGXL 3PV6A 1BFTA 1ZWIA 3TCLB 2PW1A 2YD5A 4LPWA 1V05A 5ANMA 2OZ4A 2CXGA 4TRPL 4R4FL 2UUDK 1U58B 4P23D 1HXMB 4K3GA 5EN2A 2BY0A 3IGAA 2JJSC 3TN0A 4LNVA 3TBWB 5GGVH 5L9DL 3MRHB 4RNRA 1OAKH 2A9MH 3RY5A 1S7VB 4PG2C 3DRQB 3WNMA 4UOJA 3TYGH 2BNRE 1W72A 4NRZB 2CLRA 3ME0A 1MCHA 3ZDXE 1JMZA 4PJBA 5DHVB 4OCWL 1KEGL 5EBWA 3DO7B 2VITA 5L8JB 1U0QA 3VDAA 1T0NB 4V2CB 4MJIE 4LVNB 3PUCA 4K7FB 3D2UD 1BEYL 4LMQE 4WWID 5AG8A 5CGYD 1OB1A 5TJWK 3K0WA 3MJ7A 1KB5L 2A1WL 5IB2B 2WIIA 4X7TB 1Q0XH 2YXMA 5CWSA 1RUQH 5DRWB 1YNTB 2YC1B 2FB4H 3OKMA 3D2UB 4J3UA 4WW2A 5HDBF 3LRSA 5FYKD 3MJ9H 1G7IA 1MELA 4OCNC 4DZBB 1H15A 4LLDB 1GOHA 3ZDYF 2Y23A 1YEEL 2YPVL 3VFRB 4KK6C 2HLFC 4ZFOL 2X4PA 2PTTB 4N9GB 5DEFB 4K3EH 3MRNA 2ADFH 3C9NA 4PRPE 3NACH 3WUWG 1PKOA 3BVNB 1P84J 4J23A 1QRND 4RRPG 3DUUB 1YMME 3MLRH 3RZCC 5GRYA 5F1NA 3QXTA 3X13B 4UIMA 1FO0B 1W2KT 3FB6B 1RHHB 1P7QD 4D3CH 3NPSB 2AABH 3KPLA 5KG9B 4ZPVB 5F89B 4XVJH 1M4KA 1AJ7H 3V0WL 1I1YB 2H41A 2BVOB 2DIJA 1Q8MA 1FZMB 1EDQA 4OLXH 3P9LA 1OAQL 1HNGA 4QXGH 3CPLA 4PRIB 1I9JL 1MHCB 2X4QA 1KEML 3ES6B 1Y0LA 4Z0XA 3HR5A 4MWFB 1ODAA 4P3WA 3KYAA 2DQJL 1N6QH 4JFYB 2D7QA 2X89A 1Z5LA 1A3LH 4H25B 5TH2A 4N9GA 5FFLA 4JZNB 1KXTB 1BM3H 3DXAD 3MCKA 1G84A 2X9WA 3ZDZE 4NKIL 3VCLA 3AU1A 4XPHH 1KCUL 2DBJA 4H0HB 5J6HA 1MI5E 5IMKA 1D5IH 3I6KA 5BRZB 1JNNL 2BSSB 3PF2A 2ZPKH 3I6KB 5BRZA 1KTKE 5CFHA 1XGUB 5DMGC 5IB2A 1XGRA 4M3JA 4FTVD 2EIBA 5DD1H 3CFCH 1FL3A 5LWYH 1AO7A 5I66A 5JR1H 4MDJB 4TNWF 1I1RA 3QDGB 1TZGL 3C09C 1JN6B 3W9EA 3P4MA 1DVFB 4WU5A 1MCPH 2P5ED 5MP6H 2AKRA 3MLXH 4R2GB 1LE5B 4UDUB 1T4KB 2CLVB 2IGFH 2BY2A 3EYFA 3K74B 1GGBH 2PTVA 3RWGB 3P4NA 4P5MA 5DEFA 2AV7B 2AXGB 4R96B 5SV4A 2PXYA 2VN7A 2VE6B 3VFPA 1AE6H 2X05A 5I1AB 4RAVB 4X0KA 1D5IL 3DX7A 1WTLA 4GMTL 2OR9H 3QQ9C 5I1AA 1M7DB 4LLUB 4M6MH 1MUJA 2VLKB 3VXOB 4JQVA 5F1KC 4DVRL 1F13A 1FNEA 2F53B 4DJMA 1W0VB 4LCCB 2CKBH 3QIBC 3B9KD 3PHOB 1NGWA 1MRFL 4X7TA 5LKNA 1V7ML 3NABH 1G9MC 5GZND 3MRBA 3CSYB 2ZG2A 2ADJB 4YBLB 4P23B 2IPTH 1G7QA 4J1UA 5GGSB 1KV3A 3H9SB 4PJIB 3TZVD 5JOPE 4KRNA 2IFFH 3QXVA 1JNNH 5EZLA 1OGAD 5DR5L 5F1SA 3FAXA 1ZTXH 1VEOA 1P69B 4JKLA 2DQCL 3W2DL 5HVHB 3QIWB 1A22B 4JPVL 4YHYB 3MRNB 1RUAL 5D1ZD 2NR6D 4KRPD 3OAZH 5J11B 2M1KA 3VWJC 4UT9H 1BM3L 3O3UN 1QKZH 4XC1L 2AV1B 1D5MA 2I5YL 5BW7C 1ORSB 1IILE 1ZSDA 4FQJL 3MCKB 3T0BA 1B6DA 3MYZA 4JFDE 2UZXB 2D0HA 1F58L 1GHFH 2F5BH 5DDHA 4G80B 4OF8A 4M6OL 3LKSB 3QUYD 2BOCB 5DVMA 4OCWH 1P4IL 3V5KB 1I9JH 3FN9A 1K85A 1RJCA 1R5VA 1IEAA 4YZFF 4ZAKC 2ZUTA 1NUFA 5ESAB 1KENH 4TN9A 4MJIA 4OTXH 1VADB 3V0VA 3TYGL 3RWCA 5DJDB 4N0UB 3V6BR 3AM8C 2OP4L 1K6QL 4Y4KD 1T7YA 2A6IB 2VR9A 4WW2B 1MCOH 3K8MA 1CL7H 5K9QI 3GI9L 4NQCE 3F7PC 5CJQH 4ODXB 1F6LL 4GO6B 1IT9L 3KLAB 1T0MA 1YYML 3ALXA 2NTFB 3UPCA 1S7WA 1DQML 5IFJA 5TDPA 4MAYC 2D31A 5MERB 2KDGA 5ID0B 4JB9L 1Q9KA 5CJ8A 4G6AC 1UZ6E 4GRWF 4PJBF 2CLZB 3TN0B 1BJMA 2N4IA 3BKMH 3FQXA 1CR9H 1TQBB 4IDLA 4QRUB 1EERB 5MI0B 4JFZH 1E6OL 1EEUA 4O2EB 1DFBH 3KYMA 4CVWA 2AEQH 2DKUA 5AWNH 1JGDA 5FKPB 5BZWB 1DQQA 1NBYB 3OF6D 5CUSL 4UI2A 1CD9B 1BVKB 1SJEB 4JRWA 3Q5YA 4HIJB 1R3HB 4MQ7A 2XTJC 3HI1A 1DBMH 1BQHB 2G75A 2FNBA 2CMRH 4WO4C 4KAQH 4J3WA 4HQQL 1H15B 3S3PA 1GGIL 4N0UA 1Q0XL 3IKKA 2XWBB 3V6FB 4JHZA 1YQVH 1C5DB 2J8UF 5FO7B 2VO5A 2BXZA 1A9EB 5FYKL 4YHNB 1OWWA 5FA4A 1G7PA 5TDOB 4LSVH 4O2FA 1S9XA 3VXPB 5T3ZE 3T4AB 1FORL 4LEXL 1NL0L 2P46B 3KDMA 3NTCL 4XNYL 5JNYA 3CAFA 1EO8H 2ZCLH 4Y19E 3V5HB 1J0KA 3K81A 3WIHH 4S2SA 2PYFB 4QWWD 2VYRE 3G6DL 3QNZA 3MR9B 1OGAE 3AM8A 1HH9A 4OLVH 2HP4A 2J3SA 4Y7MA 4Z7WB 1H0DA 1WAAE 2FX7L 2BC4B 3G9VA 2R9HC 2RCSL 2ICEB 3GKWL 4JKPL 2NLJB 5KANG 4IS6A 4K3DL 4NYLB 1MVUA 3ULUF 2CMRL 5EBGA 1TJGH 4Z7UA 4I0KA 5TF1L 4NJAH 4IRJD 3BUYA 4HUUB 4FXGA 3BJLA 2MCPL 2JJTC 4XNZC 4PRBB 5HHOE 2X6MA 1CLOL 1E6JH 3K4AA 2FYYB 4PGZA 5GGSA 4IMKA 1KPRA 3LY6A 5KJRH 3RFZC 3HFMH 3PP4H 1CN4A 3LSOB 3IXAA 3QJHA 4OV6F 4QKXB 1F11A 4JPKL 1KNOA 1QP1A 3BKYL 2Y5EA 3QG7H 2EH7L 2VXQL 4GFTB 4LCCC 4QHLA 4C54A 4F8QA 2D7OA 3ZKND 2OZ4L 4AEHL 2DIBA 3DIFA 1YEDA 5C0DA 2DQGH 2YKLL 3QULB 2HJLA 2FJGB 5I1CL 4P2QB 4FQXB 1A0QH 5ICXA 4WHCA 1YNLH 4XZUB 1J8HA 3MXVH 5T33L 4XH2A 1O7SA 1RIHH 4OB5H 3HLAA 4MA7L 3C6SA 4X0KB 2NX5B 5JOFB 5D7LD 4RFOH 4LCWE 1LVEA 3FHQA 4LHUD 2GITB 2IPUK 3FTGA 1WCBA 5DK0B 3QIWC 3C8KB 4PGDB 3KPRD 5IW1B 2ESVB 4FFWD 3UYOD 3QCUH 4IIQB 5J11C 3WCYA 2F8XC 3I9GL 3KPNB 4Y8AA 3RY4A 3C60C 3P9MA 4I2XE 4I3GA 3UBXA 1A1NA 2G5BB 1P4IH 4QXUL 3NZHL 2OM5A 4Q9CA 4QRSA 4FABH 3MRKA 4M6OH 5DD3H 4YHKL 1SY6A 5KVEH 3RPIB 3BO8B 1KIUA 4P2OB 5HVFB 2EYSB 1DBKL 4XP1H 3U4EB 2ICWB 1A6ZA 3CFJB 1ZLWH 4ZAKD 3TNMA 2OJEA 2MPAL 1CS6A 3PIQA 2I25N 4LL9A 4MX7B 5BQ7A 4LRNL 2R0KH 3MRHA 3KAAA 2VZVA 1QRNA 4F2MA 1IKNA 4GAGL 3WUWB 2NZ9C 4F58L 3CZFB 1A6TB 1U95B 2GSGA 2UZYB 1UKQA 5A3ID 4OF5A 1U8MB 5TE7L 1B2WH 1V3KA 2DICA 2QR0A 4LNRA 3HMWL 3BD4A 1I1AA 4PLKD 3S96A 1R3JB 3QJFA 5GGSY 2RGSA 1A02N 4LQFL 4KK6D 4Z0XB 2AQ3A 3SDCC 4JPIB 3ARYA 3O4OC 3HZKA 4JB9H 2G5RA 3RI5F 1BZ7A 2B5IC 3O6LL 2D7MA 2UV3A 1MIEL 1NKOA 5A2FA 5I17B 1NUDA 1MIEH 3S37L 4D9QD 5IBTH 2OR9L 4PJHB 4MNGB 5CZKA