The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
21
|
sequence length |
252
|
structure length |
155
|
Chain Sequence |
SLMVPVEIRWQQGGSKVYVTGSFTKWRKMIGLIPDSDNNGSFHVKLRLLPGTHRFRFIVDNELRVSDFLPTATDQMGNFVNYIEVRQTTDIPAVFTDPSVMERYYYTLDRPPQLPPQHVVLNHLVTSSIKHNTLCVASIVRYKQKYVTQILYTPI
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Transferase/protein binding
|
source organism |
Saccharomyces cerevisiae
|
publication title |
Crystal structure of the heterotrimer core of Saccharomyces cerevisiae AMPK homologue SNF1.
pubmed doi rcsb |
molecule keywords |
Carbon catabolite derepressing protein kinase
|
total genus |
21
|
structure length |
155
|
sequence length |
252
|
chains with identical sequence |
E
|
ec nomenclature | |
pdb deposition date | 2007-07-13 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
B | PF04739 | AMPKBI | 5'-AMP-activated protein kinase beta subunit, interaction domain |
B | PF16561 | AMPK1_CBM | Glycogen recognition site of AMP-activated protein kinase |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Single Sheet | N-terminal domain of TfIIb | N-terminal domain of TfIIb | ||
Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulins |