2QLVB

Crystal structure of the heterotrimer core of the s. cerevisiae ampk homolog snf1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
252
structure length
155
Chain Sequence
SLMVPVEIRWQQGGSKVYVTGSFTKWRKMIGLIPDSDNNGSFHVKLRLLPGTHRFRFIVDNELRVSDFLPTATDQMGNFVNYIEVRQTTDIPAVFTDPSVMERYYYTLDRPPQLPPQHVVLNHLVTSSIKHNTLCVASIVRYKQKYVTQILYTPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Carbon catabolite derepressing protein kinase
publication title Crystal structure of the heterotrimer core of Saccharomyces cerevisiae AMPK homologue SNF1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/protein binding
total genus 21
structure length 155
sequence length 252
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04739 AMPKBI 5'-AMP-activated protein kinase beta subunit, interaction domain
B PF16561 AMPK1_CBM Glycogen recognition site of AMP-activated protein kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.290 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2qlvB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2qlvB01
4WV1A 3GMLA 4JO4L 3MMEA 2R0LH 3BUYB 5BRZB 1BVLB 3NCFB 3NPZB 1PKQB 3QQ9D 1DBJH 1A0QH 4AIOA 1FFRA 1VKXA 1R3JB 4NKMA 2I60L 4I18A 3WDIA 5IB2A 4XB8A 3IDMA 1C12B 3QNXB 4I0PC 3PWNA 5E2UH 3LEYH 4P59H 4HWBA 1A7BA 3B9EA 3L3OB 1MJJA 4J6RL 1W8NA 2Z35B 3FOMB 3GKZA 2XKSA 4YXKH 1FNEB 1RZGA 3FO0H 2N1KA 3P9LB 4YFLF 1YUHB 2NX5D 4U3HA 2ZKHL 2RAMA 3EYQC 3CC5B 1YEKH 2W9EL 4JM2B 1S7UB 4X5LA 4F9LA 2JF1A 2XTJE 2B1AL 2H8PA 3MCG1 4GW1A 1JZ4A 4LSUL 3LS5L 1R3HA 4IMLB 1KLGB 5I15L 4MB5A 4PJDA 3QUXA 5I1JL 1H15A 1QRNB 5BQ7A 3HC3L 4YHIB 1B88A 1JMXA 5CLTA 4PTUB 2AJYL 4TUJB 2VLKA 5F9WC 1TVHB 3RWGB 3CZFA 4HWEL 2F53A 1XR9B 5HJ3A 1NC2B 2ZOKA 4BFIA 4EDWL 2L0DA 3GSVB 5I6XB 1S7QB 3V4VL 1KCUL 1OM3H 1R3KB 3SE3C 8CGTA 3ARGC 2EICA 4HUWB 3PL6A 1KNOB 4LASL 2XWTB 3FCTB 4NNYB 5FO9B 3B8YA 4R3SA 5IB2B 4C57C 4N5EC 2ICWA 3IDMB 4DCQA 4PLJC 1XEDA 2HT3D 3C2AH 5JQ6L 4J7RA 1J18A 1LNUA 2QSCL 3RL2A 1YYMH 3QEGH 4HXAH 3G5VA 3JV6B 4HWZB 3VXQA 4QLRA 3KGRA 1MJJB 2DQGL 4LPWA 4ONFH 3LRSA 1D6EB 2HJFA 2OBGA 3IKKA 2D7NA 3LPGA 5JZ7D 5BV7H 3HE6D 4PJ9B 3O6FC 3OJDA 2BNRA 3AS2A 4PY8J 1EMTH 4LNVA 3TA3C 2AQ1A 4MAYA 1UM5H 2ZUVA 5CEZE 5I17B 1UB5A 3OXSA 5IGXH 2YXMA 5BV7C 1R3IH 4ZD3H 5IW3A 3QUZB 5FF6A 2CIKB 5EU3A 2C7UA 3CCHB 5KVDH 3GIZH 2JELL 5DRXA 4JN2A 1G7LA 3RFZC 5LQBL 1ROWA 1ZVHA 2KQNA 1A02N 3S96A 1WAAA 1GCFA 5E9DD 2DQTH 4HW6A 1KTLA 3CZFB 3MRJB 4NWTL 5DD0L 1RIHH 2IGFL 2YD2A 1TCRB 3QEUA 3RKPA 3QFJA 4X9BA 3UO1H 4NKIH 1FE8L 1HI6B 4M9PA 5D1ZA 4ODBD 5FM4A 4OCSL 1XF3B 4JKPH 4XMPL 4CVZA 1H3GA 4R3SB 5JXEC 2Q86A 3VXUE 2DL9A 4Z78B 1EFXD 1G1CA 1KFAL 3AB0C 3T3MF 2IPUG 5IFJB 3G5VB 3RTQD 4PJDF 3N85H 1RZIA 3O6KL 1GGIH 3BXNB 5IQ9B 4WI3A 5EPMA 2Q6WB 1IGJB 4YR6A 2YK1L 3LRSB 3A67H 3SJVA 4IJ3C 2X4QA 1S7SA 3OR7A 3PHSA 5E6ID 2R2EA 4F7MB 1XR8A 2BNRB 1WFNA 4ELKA 1ZT7B 5I8CA 3BGAA 1JGDA 3CXDH 4TTGA 2BVUA 5E24E 1UB5B 2H2PC 1FQ9C 1QTYT 2LTQB 5IHUH 1Q9LA 2W0FA 3EDEA 5I1DA 5C0BB 4W6XB 1N6VA 4NC2B 1T5XB 3TF7C 5I30L 1J0KA 4LEXL 1FORL 1MIEL 4LCCC 3F7PC 4RISH 1AI1L 1LK3L 3ARVA 4PJBF 4XPFL 1WBYA 4Y8DC 3T04D 4XP9L 3GM0A 4MMXC 1QD0A 2CGRL 35C8L 4FFYL 3OKDA 5E2JA 1KTLB 3PIQB 3CD4A 1GVIA 4QRRB 3QEUB 1LGVA 4CMHC 4JE4B 4JQIH 4NCC1 1CCZA 3OPZL 4PS4H 5I1LA 5L9DH 4ODVL 1E6OL 3QFJB 2GAZA 2XTJD 3OR6A 3QSKB 5D5MA 4ZFOB 4JM4L 1MRCL 4PD4J 5TQ0H 1UVQA 3C6LB 5E2TH 1MF2H 4M8QA 5CJQL 3U4AA 1INQA 4MQ7B 1BM3L 1WIUA 1F97A 2KL6A 2IAMA 1YJDH 4H26A 5AZ2H 4LCYB 2NY2D 2QQNH 3MLVL 3QJFA 1MJUH 4FZ8L 4L9LC 4L8CB 4HUVA 1RUML 1I8LC 4XC3H 4J12A 1G6RA 1DQQB 4NPYB 5IR1B 1KCRH 2Q7NA 4JREB 4YR6B 1WAAF 3SJVB 3LSOA 1S7SB 4R4BA 1ZGLA 1M1SA 3IFNL 1JTOA 1ZE3C 1AQDB 3WUWA 4CL7A 2ZCHL 1QBBA 4D0DB 1IKFL 5H94B 4KQ3L 5I8CB 4LDOB 4ZS7L 3GMPA 4HV8A 1T20A 5JLZA 4Y4HA 3AMLA 4GKNA 1Q9LB 1IC4H 1OGAB 3NCBB 1CXIA 4I5BB 1GGCL 2YD3A 4Y4FD 5D6DC 5I1DB 4HQQL 4F57H 2MSPA 4ZOCA 4MXWH 4V1DA 3MZTA 3QDGA 5D7LA 1PBYA 3RY4A 2LFGA 4R2GB 3HZYA 1A4JA 1TFHA 5DQJA 1WWCA 4DK6A 1X5GA 4LGPB 3O6ML 5AAMA 1B0GA 2IFGA 2D7OA 1OAUH 3C5ZB 3VFWB 4D9LL 1I7RB 4J3WA 2GSGA 3W82A 3D18A 5CEZD 3EBAA 1VERA 3HS0A 1X6NA 4BH8A 2NY4B 4JRWA 5EBLA 3WSQH 1AC6A 1UVQB 5E2WL 5E00B 4KJYB 2UY6A 4F58L 3V5HA 2P45B 5GXBB 1J9CT 5C0GA 1WBXB 3BPNC 3EOTH 2HFFA 1INQB 2WP3T 1X5IA 3QZWB 5EN2A 1K5NA 2PTVA 4UBDC 2IAMB 1P7QA 4G7VL 1Q9KA 3QJFB 5IK3A 5TJWK 4MVBD 4QOKB 2RJMA 3ARBA 5T1LB 1J05A 1U8MB 3ARFA 3QG7H 5C0IA 5K9OA 4O4YH 2IEPA 2VDLH 5IMOB 1YNTA 5JW3H 3DSFL 4JG0H 2BVOA 4ZUWA 5IV2A 4R4BB 2VLRA 3P0YL 1I4FA 4HIHA 4RAVB 3EIFA 2AJUL 3DUUB 3IDJB 4PJ8D 4DN3L 3FFDA 2V9TA 4W6WB 4IRJD 2FJGA 4YWGL 4Z9KB 2R0LL 3SBWC 2GJJA 3VXUD 4NHUA 3R8BB 3UTOA 5JLZB 4PUBL 4WEUD 5D5MF 1UQSB 4F37F 4WHDA 2BNQE 1A0QL 1JGUH 1W72A 3BGFC 3DHJA 3RBSA 1BLNA 1XF2A 1WTLA 3L7EA 1F6LL 1FDLH 3O4LB 3D25A 5D7LB 3OKOB 2H45A 1N7MH 4JO1L 2H26A 1MCBA 4ONGL 5EZOL 4KHXH 4YXLH 1B0GB 3BPLB 4HHAA 4K7PL 4MS8C 3ZKNC 4FFVC 5I66A 1CS6A 2R2HA 2E9BA 2R0KH 5C8JB 4KGLA 2CDGB 5FDWA 1EO8H 2P42B 1DDHB 1FRGL 1ADQA 1RQ5A 4WI8A 4Q0XH 5EBLB 3SDDB 4ODXB 1P9MC 1RZKH 4IM8A 3V5HB 3GMMA 1IC7L 4PTTB 1E0OB 3B5TA 3BO8A 3KPTA 5FHBH 5IEHA 4ZSOE 1ES0B 5BVPL 3P0VL 2RFXA 2GIYA 3TO4A 1DBAL 4I48A 3WEXA 5GS3A 2VO5A 4JZNB 2ITCA 4HMCA 1RZKC 1T2XA 2AXJA 3KPNA 4XNYL 1IM9A 1J05B 3O3DA 3ARFB 3SDCD 3LKPA 5C0IB 2WBJB 4MJ2A 2UWEB 3VGEA 2Y07H 4LCIH 3K0WA 2BVOB 4ZUWB 1QSZA 4PR5B 4WWKA 2AKRB 1BBJB 4JM2C 3Q48A 3S9DB 1QR1B 2YD9A 1KPRA 1D5BB 4UUJA 5JPMB 4W70A 3O9WD 4GBXD 1OAZH 1CDHA 3PQYA 5D72H 5EC2B 1BLNB 3BN3B 3T3ME 1SEBA 1N5YH 5DJAA 1ZAGA 1MVFA 2LVEA 1LO4H 4P4KD 1DVFA 3MO1B 4HPYH 1PW3A 1SJHA 2A6DA 2EDQA 1G0YR 4PRHE 4KPHH 4JZJB 1SJXA 1YYML 1AE6L 4HXAL 4POZD 5I6XC 5JHDA 3PXJA 1LP9A 1YEIH 4KTEH 4ZXBB 5BOPA 4NP4H 1G7MA 2FYYA 4OFPA 3MCKB 4FQLH 2AXHA 4U1GB 4UOW0 3QH3B 5DC9B 1DBKH 2X4PB 3HR6A 3D39A 1V8HA 5T3XH 1LEKB 3R06B 2EYRA 2VISA 3BKCL 5C0AA 1PLGL 3ALPA 4OLXL 2FJHA 1WCBA 1C16B 4I3GA 4ONOA 5IGXL 1OTTC 4PJBE 1T6WA 1U58B 4I48B 3PWPA 1H5BA 3BVNB 3WEXB 2DM3A 3BIKB 2FIRT 2ITCB 5KVDL 1S78D 3GIZL 4JFEE 3PGFH 1RJZA 4PJ9C 4KKLC 1OTSD 3K3QA 4L4TE 1L0XA 2CD0A 3U7YH 1CDYA 1UGNA 4ZPVA 4YIQA 4B5EA 3VXPB 4YDJA 1QBLH 4ZPTB 1IM3A 1CICB 4GAYA 1UJ3A 1YMMB 1U3ZA 3CPLA 3RU8H 4Y5XB 4UUJB 1A6UL 3QUZC 3MLWH 4PJAA 3PNWA 3UO1L 1J0YA 5BW7A 4OM0H 5TQ2L 1H3PH 3O6LH 3OGCB 4RGOH 4NZDA 5CEXB 1CG9A 4PJEA 3LPWA 4X6CB 4BJLA 1AHWA 5I75B 1C7SA 4PJFE 1KIPA 4PJXA 4L3EA 2A0LC 3ARRA 5D7JA 1B3JA 1MCRA 2DYPD 4YGAB 3VE0A 3EOAA 3B5GA 3C8KB 4X9HA 4K94L 4WTXA 4L4VE 2DAVA 5C0ND 1LP9B 3LQMA 2JJTA 3TIDA 5KSBA 3RIAK 3LD8B 3LDBB 2ADGB 3RX7A 1EUUA 1WEJL 43C9A 1NQBA 2P5WA 4YEFA 2BNQD 1OF2A 1U8NA 4ZAKA 1UH2A 4NUGL 3K1KC 5EO9A 2IANE 1RZ8A 5C0AB 2VISB 1M6OA 5ESAB 2Z92A 5SWZD 1T04B 3S35X 5DRWB 4FQHA 3NCYS 3QQ4A 4GXVH 2PO6D 3QO0A 4NRYB 3S37H 3QEQA 2I5YH 2OMNA 5I71B 4U33A 1KG0A 5FYJH 4RISL 2JCCF 4HIEA 3QXTA 2EKSA 1KTRL 3G04A 5CIPA 3TCLA 1MREH 5ANME 4ZPVB 1Z5LB 3T0EA 4TTDD 3QHZL 4HC1A 2Y36H 4YDJB 2DQJH 3F5WB 4X4MA 1OCWL 2FSEA 1UJ3B 2LTQC 4JQIL 3B83A 1QVOA 1NFDA 4PJAB 4Z0BL 3G5YA 1CLOH 3VH8A 3ZKMC 2XKNA 3FONA 5CAYB 5DJZA 5DJDB 3TPUB 4LQFH 1XF1A 5A16B 4RGNB 1CG9B 4JQXC 5F1OB 4GG8A 3TZVA 5FOJA 3BKJH 3KWWA 3M45A 5C2BH 1A2YA 3BE1H 3VXME 3VFGH 4L3EB 3MJ7A 4OTXH 1DEEA 1A7NL 3AUVA 3HMWH 3O41A 5T3ZH 4MJ6A 3VE0B 1Q9OA 4ETQB 1JPTH 1K8DB 3TJEH 1R0AH 4JFFE 3BH8B 1IMHC 2G5BA 2PETA 1HWGB 4KUCF 5D8JL 4JO2H 4JQVC 5DR5H 3CMGA 3C6LC 2BSSB 4Z8FH 5E2VH 1OF2B 4ZAKB 1N0LA 1KC5L 3V6OE 4XZUA 2NZ9D 5F7DA 1RZ8B 1ZHKB 4ZFGH 4Z0XB 3SDYH 4N1EA 5HVHC 3P3YA 1JHLL 2NNAB 2PXYC 5HDQH 3M8OH 4DTGL 5EG6C 3WXWH 5HHOB 4FQHB 5JTWA 4PRHD 2MPAH 1K6QL 2NY7H 2OOXB 4RX4D 1EPFA 5JW5B 4JREC 3FB6B 2EZ0D 4KGJA 3UBXI 2XTLA 3ARYA 5CP7A 1UKSA 1J8HE 5E8PB 1FZKA 4APQC 3RWHA 5CIPB 5CCKH 3WDHA 3UXFA 4KK6D 4ENED 5EU5B 3NFPA 1HQRB 3GI9L 4CNIA 4KROB 2ZZUT 5KSBF 4OJFL 2Y4SA 1XGRA 2XKNB 3FONB 4MB3A 3HZMA 2DBLL 1RJLB 2VIRB 4EN3D 4JDTH 4JFED 43CAB 4P5TA 2YD5A 4OLWH 5E6ZA 2V9QA 4R2GC 5GGRY 2OXGA 5J1SC 3GBLA 4GG8B 2AI0H 3TZVB 5E1AA 4JFOA 2G60L 3EOTL 4L4TD 4TSAH 3WJJA 4LARH 1Y18B 5D93B 4RZCA 1T66D 4MX7B 4GAJL 1FO0A 4E9LA 3C5ZC 2NXYB 4C56A 3O41B 4Z7QE 1Q9OB 3EDDA 4DQOH 1OAQL 3SKNB 1LO3L 3FMGL 5F1NA 3QG7L 3OX8B 4O4YL 4LP5A 1AKJA 1FFNB 4UNVA 4CU8A 1CVRA 3MREB 3AREA 3GUTA 2XICA 4S0TD 5C1MB 4WNQB 2E6QA 2X1XR 2Q3ZA 1MJ7L 3EFDL 4WFGE 2BNUB 4HULB 3MV01 3CFJA 1NFDF 4HS3A 4LHUB 4JAMA 4G8FA 4XCFH 2Z4QA 3SCMD 1ZHLB 2X9YA 4NO0A 1QYGH 3RVXD 2DM4A 3QRGL 4L4VD 1GIGH 1VDGA 4G6KL 1FDLL 1W0VA 5CP7B 3RWHB 1HSBB 3TBVA 4D8PA 4NNPL 3HMXH 1UZ8B 4KHXL 3RZWA 4YXLL 1RUAH 5DJXB 2QKIA 2CK0H 3ZE2F 1FNSH 3OXRB 2R0KL 3BPOB 1N3NB 2R1YA 4YHYB 1RHHB 3U36A 1HOCA 4WTZG 5A2FA 5CWSA 2ORBH 1I3RB 5D1QB 5EIIA 4D94A 1CF8L 4OZ4A 1C5DB 3UYRH 1FP5A 3DVNA 4PB9H 3IDYB 1JUFA 2X4UB 4M02A 5FHBL 2CRZA 4IRSA 3BPLC 2XN9E 1CFSA 3C60A 3HPLA 5FGBC 5JR1H 5INDA 5LAXA 2ADIA 1P6AB 1IQDA 1KENH 4HGWA 3F7QA 3FT3A 5AWNL 4K8RD 3SY0B 2QV2A 1JE6A 3O2DA 1KCVH 1AKJB 4I3SH 5E56A 3SDDC 3GUTB 4HK3N 2HVJB 4X7FC 3DSNA 5EOCL 1LK2A 3ZHKA 4NKOB 1JNHA 4BQ8A 1D6VL 1U36A 1FG9C 2X10A 1JNLL 3MXVH 2ATPB 3VXMD 4M6AA 1XCQB 3TN0D 1JK8A 5DHYA 4FQIL 4G8FB 2Z4QB 1OAKH 3MV9E 2WBJC 4NO0B 5AEAA 4LSPH 1JWSB 4JFFD 3OWEA 1D5ZB 1RPQA 1I85A 3PXHA 1N5YL 2AJSL 1W0VB 4JB9H 2EDNA 1JZ6A 2P8LB 4JZOA 2APBA 2Y7QA 2DB8A 3PG2A 3PP3K 3OF6A 3QEHA 3KR3H 1MAMH 3LRGA 3FZUC 1TZHA 2WIMA 2QKIB 4TVSa 2R1YB 4KTEL 4MAUH 1Y6KR 2VE6A 4F7EA 4LVHB 4P46B 4M6MH 4X5XB 5CWSB 2HT2D 4U6HB 3DXAA 3WFHA 3IS0X 4Y0GA 2HJLA 5CGYD 5A40E 2DICA 1D3CA 4OZ4B 4DEPB 5DMGC 1J8HD 3BZFB 1J86A 4ALAH 3DUSA 4JEGB 3OGOE 2YC1A 4J3XA 4JZJC 2JCCE 2OXHA 4M6OH 5D1XD 5D2NE 3ZTJG 4JN1L 5FYKL 1CFVH 1FZJA 1ZT1A 1SYVA 3NCJH 4ZXBC 5EO1B 4HGWB 1RI8A 4PGEA 4U1GC 5C08B 1NCAH 3VFUB 2LU3A 1S9XB 2OZ4H 3U7YL 4MD5B 2AK1H 4OM1L 3QCTH 2BDNH 1QBLL 4HX1B 5H35A 5ILTH 3MLWL 1AXIB 1QA9B 4J3TA 2V5TA 1YZZA 1MLBB 4NQXA 1U8QA 4U1JA 5JIIA 3STLA 3S8WA 3MRDA 4KK8C 4QRSA 4OSUL 1HEZB 1YECH 4KK9D 1CICC 2FIKA 3I50L 1D9KD 1EGJH 2FBJL 4P57A 4X99A 1MCNA 4JG1H 3KPSA 5IMMB 2AV7B 3N1QC 4Y5XC 2X4SA 4R6UA 5ECJE 2ESVA 4WFGD 2A83B 4EZMA 3JTTA 5KG9A 1K85A 5B21A 3UPAA 3MRPB 3RZCA 4PRIA 1U8OA 3QIBB 1M71A 2A77H 4EVNA 2WIIB 3WFHB 1A5FH 2J88L 4UDTA 2R29L 1S9WB 2DQHH 5I75C 4PG9A 2AEPH 1T2QL 2XI9A 1CE6A 4EI5A 3TM6A 5IW1B 2P1YA 3UP1A 25C8L 5HGDB 2YC1B 1T1YA 3IDGB 1X4YA 4QHMB 4PY7B 2WM0A 1RK1A 2WSKA 3BN9D 3LD8C 3LDBC 4PB0L 5FM8A 2FX7H 3NIGF 4BUHA 2X7LA 4BZ2H 4R7DA 1INDH 1MREL 5H8DA 1YY8B 5FGCB 1HIMH 3DIFA 2W38A 1QLRA 2Y36L 2GTWB 1PZUB 5GRVL 5EOTA 4XP5H 3RI5K 1ZLSL 1CD1A 2I25N 2XNAA 3V4UH 5DURB 5I71C 2XN9D 1OQOA 3ZDXE 5GGUA 5FFLA 2BOCA 1A1MA 2X41A 1T22A 3IKCA 1X4ZA 2JIXD 2W92A 3BP5B 4NUJA 3STLB 1V05A 4U0QB 4ZFOL 4ERSL 2X9WA 4FQPA 3NABH 2BSTB 5B8CA 2Y25A 3OKMA 2D0GA 3B9KB 3MROA 1MFBH 3BE1L 3VFGL 4GMSL 3G5ZA 2R1XA 1BVKA 2NY0D 3WE6B 3HC4H 2EXYC 4KXZH 1RIVH 2X4SB 3A6BL 4GMTL 3TJEL 3W81A 5C0CB 1UXWA 3OAUL 3ZKSD 1HHIA 2DN7A 2VXUL 1GGTA 2OL3B 3RNKA 1QG3A 2DM7A 3PHQB 3GSOA 2JTDA 5KSUA 4RGNC 2LU7A 5DR5L 5HXMA 2APWA 4EVNB 2YMXH 3MV9D 2DBJA 1G7JB 2M2DA 1CE6B 2A9MH 4PJ5A 1T5WB 3FB7B 1N59A 1CLYL 4PBWD 5DA4A 1P2CA 2HRPL 3L7FB 3W0WA 5DVKA 4NRXB 1QFHA 3WXWL 5KSAB 3HKFA 2P8MB 1GXEA 1K4DB 5BXFB 3RKDD 5MHSE 2V7NA 1X5LA 1CDBA 5JXAL 4NQEB 1U3HA 4NYLB 1BWWA 2X7LB 3OAZK 3Q6GL 2W9DH 5HI4D 4R7DB 1URLA 2CKBA 3HI6H 5D6CA 3DIFB 4GKOA 2YD4A 4OD3H 2NXZB 1B4JL 1XF4A 3OB8A 1UCBL 2V17H 1RHFA 3QUYB 3BZ4A 4MA8L 4UZGA 1ZVYA 2X4RA 2HLFC 3K81A 3WFBH 1SJEA 1LMKA 1T22B 1CU4L 3GJFA 5SX5K 4ZTPL 5HHPA 1G6VK 2FHFA 4ELMA 5LGHH 5B8CB 3TIEB 3MJ9A 4LARL 5D71H 3NIFF 3G5ZB 4XVSL 3OKYA 1PEWA 2OK0H 1E28B 4KROC 5IB4A 4PV8B 1AO7A 4LRNL 3P73A 5F3HA 5F96H 4Q9QL 2BRQA 4OCRL 5E7FA 4JHWL 4BYHA 3UTSE 4OGYH 2NTFA 3MGOB 3TZVC 5IFAL 3KYMA 5E5UB 1E4XH 1JRHH 3BHBA 3CSBA 5EU6B 4NBYB 5JOFA 5D93C 2VDRH 4BZ1L 1DLFH 2VR9A 1N59B 2NXYC 1JF5A 3IFLH 1LDPH 5HHNB 4BSWB 1KB5B 1NDMB 4KUCD 4QWWD 3QI9D 2MTPA 3EHBD 5C09E 3SO5A 4P4RA 2HTKC 1XCTB 3HA0A 4XCYA 3S3SA 2D7TL 3LIZL 5EWIL 3A6OA 1OSZB 4LCWB 3LS4H 4QHKI 4X8JB 2EE2A 3HMXL 5ESQA 5L2KB 3FN9A 1P7KB 2J8HA 5IKCA 1XF4B 1L6XA 3QJHB 4KQ4L 1PSKH 3DLQR 3HNVL 1FNSL 4J3SA 2IJ0C 4IHOB 2X4RB 2VL5B 4BSVB 1YNLH 5FKPB 5DQ9A 2R0ZH 3FQXA 3L3HA 1TIUA 1SJEB 5L2JA 1NFKA 3DVFA 5CJXC 3SQBA 1BD2E 5I19H 3U9PH 2HVKA 4HKZA 2F54E 1UEMA 5FUOH 4RWYH 1EIBA 5ALBH 3UYRL 5BS0E 1XGYH 5ITBH 1U8LB 1NBYA 2EDYA 2PNDA 3P2TA 4HBQA 4M7LL 1ZK9A 3VA6A 3HPJA 3BPOC 3IFPA 3V0AC 2DLHA 1INEH 1ZLWH 2BVQB 4R97B 5F3HB 1KCSH 3ZSTA 3IJHA 1VA9A 3SE8L 1MPAH 4ONHA 2GJZA 4WW2A 1FCCA 4I0PD 4B50A 1KEGL 5D1QC 3IDYC 3KYMB 1B0RB 2P5EE 2GJ6E 3WO4C 3BEWA 3WXVH 3BUTA 4YBQC 1I1YA 2RCSH 1K8IB 1HYSC 3MXVL 4G6FB 4NQSB 1UJTA 3QXWA 5BJTA 1VADA 3KPLB 2ZUUA 4PRNB 2P8PB 5F9AC 1QSEE 3PV6A 4Q9BA 3G6AA 5E8OB 4BELD 1SQ2N 3DGGA 3MRQA 3EYQD 1W72L 2Z8VC 3K2UH 3MYZA 3BQUB 4PJCA 1VHPA 4UOW1 4AK1A 1D5MB 5IKCB 3KR3L 4X6EA 2C9AA 4M43L 3RPKA 5HBBA 3QDJA 4UT6L 1RK0A 4GOSA 3MOQA 2IBGA 5IB3A 3M17B 2W91A 3ECBA 4I1NB 4OLVL 3RWFB 5DQ9B 4PG2C 5EBMA 3OKKB 4F2MA 5L2JB 3HAEA 4YDVA 5MHSD 1G1YA 1PFCA 4G9FB 3N1GC 1ADQL 4H20L 1MRFL 4N0UA 3BH9A 3NIGE 3IXTB 4M6OL 4PRBA 1UA6H 3ARGD 3HPJB 2Z31C 4LSRH 5BZWA 1WZ1H 3NCJL 2ED7A 1DL7H 4KAQH 4LVHC 4P46C 5E1HB 5BOZG 4N5ED 4YNYA 2AVGA 5C0RH 1UYWH 4PLJD 5E6YA 3SKOB 3O2VL 4DEPC 3IU4H 2SEBB 4AQ1B 4I4WB 3QCTL 2BDNL 3BEWB 4FQJH 5C7XH 1CFQA 4N0CC 4Y5YB 1OD7A 3QNYB 3TWCL 1HXMA 5F21B 1CFNB 2H1PL 3VXRB 3SDXB 5ILTL 4XH2B 5KW9H 1PZ5A 4P2RE 1DQML 2GCYA 1ODAA 5BJTB 1OPGH 1Q94A 3O6FD 1VADB 2F74A 4KKBC 1I8IA 4Y89A 3O3AA 2F9BT 3MRQB 4Q2ZA 1J0JA 3PABA 1BX2A 15C8H 1WICA 1BZQK 1F00I 2F8OA 4P5KB 4J1UA 2Z8RA 2UV3A 2YOCA 3E2HB 4KWUA 1NUNB 3LKRA 5DSCA 1ITBB 3FN3A 4GXUN 3VDCA 2XXCB 4C55A 2VQTA 1FVCB 4QXWA 4WDIA 5FHAH 4XMKH 3MOBL 4WW2F 2Q8BH 3ULUH 1U93A 1UXSB 2C1OB 3NAAH 3WHXB 5C09D 4LLDB 5DFTA 4QGTA 1M7IA 2XWBA 2QRCB 4RA0C 5IOPB 2VXSH 1TVDA 5KOMC 5LCVL 3QISA 4RFEA 3QZWG 2QL1A 4U1MA 2XQYK 1F58L 2JJSA 1YEEL 4QXGH 5CHNA 4LPXA 4RQQB 4G6ML 4Z5RA 3SKJL 3ULUC 5BZWB 1JNJA 4P2OB 1YQ2A 1MHPL 2OMBA 1GC1L 2R23A 4KU1A 5FO7B 3VCLA 3BZDA 3QIBC 3VFSA 5FKAA 5CKAA 3X11A 2Y1VA 4JFPB 4AT6A 5JXED 1S5IL 1Z2KA 2O5YL 4YNYB 1SY6A 4PJCF 1HZHL 5IVNA 3V79C 3FRUB 3PP3H 3VFPB 2A1WH 3ZYIA 1BD2D 1ZEAL 1OAXL 5ICXB 2F54D 1RJYB 4XP5L 1DZBA 5BS0D 1IGFH 4QRQB 2HWZH 1X5KA 2NLJA 4K3JH 3V4UL 1Q0XH 3N1MC 1DQJB 3AY4C 4XVUC 5E70A 3NIFE 1FLTX 2F74B 3D9AL 5MEQB 2EYSA 5BRZE 1LEGA 3O3AB 4OLYH 3NABL 1PKQE 1JZ2A 3CGTA 1BX2B 3E6FB 2XPGA 3S36H 3H42L 1N6UA 3BPCB 4XRCB 3U9UB 3LKQB 5CFHA 1KN4L 2P5ED 2GJ6D 3MFGB 5J6GB 2OX5A 3VXOB 2GK2A 2PR4H 3GO1L 4JPWL 5F9JB 2OP4L 2HKHH 1MHCA 3NGBB 4GRWF 3VDBA 4P3CH 3GNML 3H9SA 2KH2B 3CSGA 3MV7A 2A9NL 2X4TA 3KJ6H 3B9KC 2OL3H 2XWBB 1QSED 4K3EL 3ZT5A 1Z9OA 2VQUA 1P7HL 1YEGH 1H0DA 2X09A 4A6YB 1N0XL 4Z5RB 3D2UD 1MFAH 2XY1A 2UUDK 2NPLX 1V7NH 3I2CH 4TSBL 5J89A 4WHTB 4YHOL 1LO5B 5GGSB 4DKFL 5ISZB 3GHEL 2OR9L 3SPVA 1YDPA 1NLBH 3EJJX 1OOAA 3BP6B 4DUWA 3G08B 1KBGH 4GO6B 1CDUA 1NFIA 4YQXL 1HINH 3MRHB 3UTZA 4Y2OA 2V2WA 5DVNA 1AFVH 1QRNE 2OJZH 2V17L 5ID0B 1ETZB 4PGCA 5KSAC 5A2KH 4HJGB 1S7RA 4PV9A 3N1PC 4Y1AA 2W60B 5HY9A 4KK5D 1HYRC 3MUJA 4TVPH 3WD5L 3FO9B 4IMKC 3L5WA 1EEUA 4YZFF 1LEGB 2BCKB 1OWWA 3HLAA 4XPAH 4RMWA 2VXVL 4Q9RL 2NXZC 1MCDA 2OK0L 3QUYC 2NW2B 5C07B 3WNOA 4MLSA 3HG1A 5A1AA 2DWDB 2A6KA 2C3HA 2FR4A 4I3RH 1NCTA 4P2RD 2ZCLL 3QCUL 4RCAA 4AIZA 4Z95H 2VUOA 4HLJA 1TNMA 5JDSA 1E4XL 4GG6A 4XCEA 5IBUG 2VDRL 3BMWA 5T3XE 4JY5H 4N9GB 3SQOH 1FVEA 2IH3A 4CU7A 1NMAH 1FN4A 1T1WB 3L3KA 2FLRT 4G6AC 3V52H 4JFHE 2RBLA 4MDJA 2F19H 5IJKC 2G2RA 1KB5H 3AXLB 2ZWLT 3SKMB 4YPGA 2QSTA 3L9RB 3LS4L 2AV1A 3Q3GA 1AY1L 1UWEL 2DTML 3IVKB 3FFCA 4UBDD 3H6JA 3VD7A 4Z7NF 4S1SL 2V2WB 3EFFB 4HS8L 1VFUA 3FQTB 1YNLL 3PWJA 1KN2L 2A6IA 1LE9B 3GZKA 4F7TB 1VFAA 1A6WH 4XNQB 4Y1AB 5SWSA 2H41A 3HE7A 2AK4B 1FVDA 3MRBB 5A2IH 2EDHA 3U9PL 5DD6B 1NGQL 3U0PA 1WQVT 3TBSB 3JWOL 4RIRA 5FUOL 2VDPL 1UC6A 1IEAB 5HYQB 4HUXA 2XRAH 1EUTA 2L7UA 3O45A 2VLJB 4M5ZL 3VJ6B 4U31A 4QXUL 4BH7B 3IFOB 1INEL 4JY4B 1OGTB 2VDMH 2BC4A 3IU3B 3KPMA 1I1RA 1FO0L 1YN6A 4IRZL 1AGCA 2A6KB 2QQKL 4DZ8B 4GKZA 4DN4L 2R15A 1RZ7H 1MPAL 2YN3A 4W68A 1XH3A 1J1XL 3DECA 3BKMH 2GK0B 4YXHL 1IKNA 4WU5B 5JDSB 4UU9B 4MXQD 3WXVL 1Q72L 3ZKND 3T2QA 4MS8D 3H3PH 2DJSA 4FFVD 3DNKA 1X5XA 3EYSH 3V7AG 5F9OH 1UM4L 5HGGS 1N4XH 4OAWA 4JJHA 4NN6B 1DE4A 5CJOL 4R90L 5F89A 3WIHH 4R97C 3L3KB 4EXPX 4ZNEA 2YRPA 3RX5A 3L5XH 5SX5H 5TF0A 1DBMH 3MBEA 3I6LE 5LBSL 2ZSVA 2EC9T 1FL3B 1NGZA 4Y4KB 1OVZA 1EX0A 5FYJE 4ZMAT 3B4NA 3GBMH 3K2UL 4R0LA 3UJTL 5C0BE 3KYKH 4Y16A 4YHKH 3I02B 5IFHH 4FQXC 1NGWA 2CSPA 2PW2A 5FIEA 1NPUA 3AS0A 5L6YH 3QG6B 3UTTA 5JORA 2A6IB 1VFAB 5GGVH 1HILA 4QRRE 3S4SB 2HFGH 3BEVB 3VWJA 1CQYA 3JXAA 4G9DB 4KZEH 4ODUB 3BQUC 3HB3C 1T7VA 1I9JH 1EVTC 2I07A 3DMMA 3BP4A 2VOTA 3RUGB 3KPPB 3ZHLA 1T80A 4NQDA 5IEKB 4I77L 1UA6L 3U7WH 4LSRL 4AM0B 5HSFA 1LWRA 1WZ1L 3UMTA 5T3ZE 4GW5A 4L8BA 4FQQA 1QRND 1DL7L 1XGPA 1TENA 5KANI 4JFZH 1FYTB 3B2VH 2PYFA 3F6IA 3WS6A 4U6XB 3O2DL 1IAKB 1NC2D 1FC1A 4FQJL 4KJQC 4MZ3A 5CJ8A 5D2LB 5GRUH 1HH9B 3RWEB 5ID1B 4XMLH 5BMFH 1R24A 3REWB 2VXTH 4JGJA 1F4XL 3DX9B 5FCUH 3UEZA 2ZJSH 1PY4A 3N50A 4AQOA 3IDIA 4P9MH 1UWGH 1VFBB 1CI5A 4LDEB 5IM7B 3UTPE 1XGQB 3MBEB 4PRDB 2D7MA 4UDUA 5DEZA 5K9KA 4R8WH 5JUEH 1KJ3L 1OGAE 4MQTB 1MFEL 3KYOA 4R0LB 4Y5YC 3QXDA 1OTTD 1A14L 2OJEA 3FT2B 1O0VA 5T3XD 1MFDH 3BDBA 5KN5A 2A73B 1A7QL 4PJ9D 4KKLD 2F8XC 4OFDA 2Q8BL 2HMID 3ULUL 3OKNB 3NAAL 2DQEL 1G7HA 4JFHD 1Z3GL 1E27B 2CKNA 2HJKB 2VXSL 3ARPA 4DZBA 3QO1A 1H3XA 4ZUSB 2UZXB 3MUY1 2I07B 4GFTB 4I2XB 4M4PA 4I0KA 3WYRA 3BP4B 3FQNA 2VDQH 3IF1A 4ZODA 3E2HC 3QUZD 1RFDL 4TQEL 2IF7A 4GS7B 3O4OB 3QUMB 4HLZH 3BRFA 3E8UL 5DUML 4FQQB 2ZPKL 5DJ8B 3EAKA 1ZVSB 1XGPB 3UTQA 2EDOA 1CE1H 4Z18A 1U8KB 3ARXA 1LDSA 2R2BB 4JANA 4X8XA 2HT4D 5AZEL 4QOKE 2A0LD 3MXWH 4U6YB 3K8KA 5JIKA 4ZFFB 1JF1A 3RY6A 4MXVF 5LWYH 4X6DB 4YZFE 4LHQB 4P2OC 4H5SA 4DKEH 4MA3B 2Y5TA 1I9RH 1BFVL 3GFUA 3IDIB 3P9MA 1MY7A 3I85A 3FT4A 1WIOA 4MDIB 1C08A 2CXGA 2XFXB 4HS6B 5CD3B 2OQJB 4AYFA 4BFBD 4JFDA 3BAEH 3UJIL 1VPOL 2AEIT 1MOEA 3QXDB 4ZDHB 5BZDA 3G5XA 1RV6X 4X7TA 3VWKA 4FN0A 3O4LE 5KS9B 1IEBB 3SE4C 2DQFB 1BQLL 1BQHA 4K3GA 3L1OL 2PCPB 2GITB 4UQ2B 3REVA 2CMRH 1QKZL 1XAUA 4OZHA 2CUHA 5FUCC 4TNWF 1NGPH 1BBDH 4PJ7A 1G7HB 2BZDA 3L5JA 1WBZA 3GSNA 5FYJD 1A1NA 4Y2DB 4YHPB 3IF1B 1U92A 1E4KC 4RFOL 5C0BD 3ZKMD 1CDJA 5GGTH 1MCKA 4JRXA 2EECA 3OKEA 1V7NL 4A6YH 3NGBC 4AENA 3C87A 1RURH 2X1OA 4G8IA 1BFTA 2DI7A 4LQ1A 4N8CH 1KB9K 2DLTA 3WS3A 3B3IA 3H7BB 4QRRD 4KMQA 1KV3A 1KBGL 2MQ3A 3ROOA 1QBMH 4Z7VA 2O61B 1RVFH 3LN9A 2CDEA 1IEHA 5JA8B 3MRLB 2QHRH 2UWEE 4WUKH 4OIIL 3T77A 4W4OA 3LOWA 1BECA 5AD0B 5DLML 4MA7H 4OQTA 3KPRA 3C6LD 1ORQA 2BXZA 1CIDA 4NT6B 4TVPL 5T3ZD 4YHML 3MRCA 5HGBB 1QO3B 3HN3A 4XCCH 3MNWA 4HCRA 2IPTL 5MEPA 1CTOA 1E4XI 4PJIA 1T3FA 1CXEA 2PXYD 4YGVA 3T0VA 2FBOJ 5I76A 1S7WB 5DQDH 3G5XB 1AQKH 5J57B 1NJ9A 2I9TA 3PP4L 4PREB 4MJIB 4LLYA 3MV11 4H8WH 1IC5H 5DO2C 2VKXA 3WL9B 4KDTC 4APQD 1QHOA 4OZHB 4JDZB 2V7HA 5DHVA 1CL7H 3UTPD 3FAXA 4RNRB 1MI5A 3PGDA 3X12B 1WBZB 1A21A 2VH5H 4YDLB 2ICES 4JY5L 4FQ2L 3QPXL 1OGAD 2FX8H 4H8WC 4QRPB 1NMAL 5CMAB 3QA3B 3WLWC 1I1AA 2F8VA 3V5DB 5IBTH 1MIMH 4IDJH 4MNQA 5DWUH 3R8QA 4N8VB 1KB5L 4XBEH 2DMKA 2R56H 3RAJH 2YZ8A 2AEQL 1G9NH 3LKOA 5CSGA 1BEYH 3C5ZD 1W0YT 4K2UL 3ROOB 3JWDH 3FHQA 2MFNA 4CMMA 4GQ9H 3MCLH 3TT1H 3L6FB 1I8KA 3D0LB 2CKBL 2AGJL 4ISVB 4YHZH 1A6WL 1FNGA 1G9NC 1NBZA 4OZGA 3ROLA 1NEZA 4QHNB 4ZYKA 3O3UN 4R4FL 2BRRH 1YMME 3JWDC 2BSED 2EE9A 2HLAB 5DUPH 5KSVA 4NO3B 3RWCB 5EUKA 3NACH 2QBWA 3MNWB 5DJYA 5J7CC 5DK2A 1JCKA 2FGZA 3MV8B 4G8EA 5I76B 3U4BL 4QOKD 2UUDH 5T1LD 4X6CE 1EHLH 4U1SA 5JMOC 1NJ9B 3PV7A 4HBCL 4X4YA 1AGFB 5L7XH 2I9TB 3TBYA 4FP8L 4JDVA 1XIWB 5KVMC 2BVYA 3PDDA 4HT1H 1FV1A 4NBZB 1KPVA 3WFCH 1P1ZA 3GSQA 5D4QA 5CS7A 1DQLH 1RU9H 4Z7VF 1D7FA 5T1KB 2DQUL 3PGDB 3H3PL 3R0NA 4NKDB 3MR9A 5F9OL 2HRLA 3U2SB 1N4XL 2NYYC 2ED8A 3KYNA 5TF1L 3WIHL 4MNHB 2APTA 5I16A 1MLCA 1EAPA 2MCG1 3ETBF 3L5XL 3O4LD 1V3MA 1X5FA 5AYUL 4PLNC 1EJ6A 2JK5B 1CLCA 1N6QH 5GRZA 4PJIF 1VFOA 1A8JH 3VW3L 3GBML 4GRMB 4XBPA 4IEFB 4AY0A 3E6HA 4RBPK 4FQ1H 4YHKL 3UZVB 5IFHL 1J1PH 1I7ZB 1JPSH 1QHPA 5EFIB 1LE5A 4NN6C 4CMMB 2FNBA 4JFXA 3IAQA 1HH6A 3EO0B 3T65A 1L7TH 4HIIB 1HXYB 4U7SA 3HTLX 1IGIH 4OZIB 3SDDD 3STBA 5D7IB 2IQAB 5IWLA 4Y4KC 2DKMA 3RVUC 3QCVH 2P24A 3D85B 3L3DB 4OLUH 1E6JL 4H88L 4LSSH 1S9YB 2BSRB 3S5LA 5F6IB 1HKLH 2ZSWA 4OCLC 5E8NA 5CUSH 3U7WL 4RGNE 1KXQE 4K71B 2WBJD 4PY8I 4FTVA 4WO4C 4IOIA 3HUJB 4YH6A 2ARJB 3OHXB 5F6HJ 4JRYA 4OIAA 3TBYB 3N9GH 4JDVB 1L0QA 4G8GA 3FJTA 3U0TA 3WV0A 1TETL 3B2VL 4F33A 1FV1B 2QQQA 3D3VA 5LXGL 2YKLH 3BGMA 3C09B 1WUNT 3MFFB 4LEOA 1JHTB 3Q6FB 4DK3A 2IPKA 4H0HB 4UILL 5HYJB 3FZUD 3B43A 1UT9A 1MH5A 3MR9B 4XAWH 1GPOL 4F8TA 1PYWB 3KJ4B 4F7CA 4XT1C 3U0WH 2YPVL 3EYFB 2FX9L 2F15A 5B39A 4OZGF 4UV4L 1MLCB 4FMKA 1NCBL 3RDTB 4ZTOL 1P4BL 2IQ9H 4BM7A 4Z76A 1JYVA 4R8WL 5HHOE 5HVWA 2Y06L 2JB6A 2VDOH 5F88B 3MLZL 2VDNH 5GS1A 4WEBL 1KOAA 3WLBB 3W2DH 4ZXBD 3RJDA 4UT9L 2EE6A 3TT3L 2BY3A 4O2FA 3WIIL 5M7QA 3PGCA 3NH7L 32C2A 3C5SA 4G3YH 4B0MM 1T21A 3CLFH 1L9MA 4MA1B 3T0WA 5HDBE 3G6DH 1AR2A 8FABA 3D5OF 1AR1D 2IBZY 4LDLB 3HR5A 4IIQA 3GGWA 3KDMB 5CP3H 1ZHBA 2E7BA 4KV5F 1N5AA 4KVNL 1IGCL 3EZ8A 4Z7UB 3QIWA 3TBTB 4FTVB 4FG6C 3SDAB 3ZDYF 3CLEH 5IB5B 4NSKA 4JRYB 2B4CH 4HXBL 4LBEB 4KK8D 2NX5A 4M62L 3QUMH 3U0TB 4F33B 3H0TA 2OSLB 3ALWA 1BGXL 1YMMD 3P11H 4U1HA 4XPHH 3AROA 2GT9A 2H9GA 4GS7C 2B4CC 3O4OC 3GMNB 4NQTA 2YPLB 3ZTNH 1CLZH 3RA7H 4DGYL 2CR6A 1MEXL 2BOBA 4FQCH 5MERA 5EA0H 1EEYB 2D7QA 5IVXA 1ZA3B 1L7IL 5GISH 3FO2B 4Z6AT 3LZFL 4J4PC 4DJMA 5HYSB 3T4AA 3PWVB 4AEEA 3MRFA 4JFQA 2JB6B 2XIDA 1UZ6F 3C5JB 1ULVA 3C9NB 3VRJB 3ESVF 4WUUE 1FFOA 3HE7D 1MCFA 1TJIL 2VITB 4AEFA 2APVA 5CJBA 2VL4A 3PGCB 1M7DA 2J8UA 4PLOB 3C5SB 1IVLA 1JGEA 2ZUSA 5C0DB 3TV3H 4FA8A 5HDOA 1HHHA 3RIFK 4UB0H 3GRWH 4HK0B 4NO5B 5E8DH 4LIQH 4DKAA 3TO2A 5KVGL 5FYJU 4N0RA 1NC4B 3O3BB 4NM8L 3CMOH 3UDWA 5B22A 1N5AB 2WQRA 3MBXH 4LVNB 1AXSB 3O3EA 3QPQC 4WWID 3HE6A 5AG9A 2NY6B 5FXCH 1DUYB 1SEQL 2DQCL 4Z7WA 4CAGA 3VFNB 4N8CL 1NDGB 1ORSB 4LVOB 1NCWH 2JE8A 5D7KE 1MQKL 4HJ0C 2YXFA 4QY8B 4E41A 5IW6A 5ADOH 1DUZB 5I0DA 4MNGE 4Y2DC 2EXYD 4Y88A 4N0FA 5F7YC 4WUKL 4URTB 1SY6L 4OZFB 2H9GB 2DTSA 3ORJA 4KZDH 3LMJH 5KVFH 4JJ5A 1Y6MR 3ZZ1A 4BA8A 4RGND 3RI5F 4P5MA 2DQDL 5GGRB 2DKUA 2XWJA 3GK8H 3FOLB 4TOYL 2Q8AL 2XZQL 1EXUA 2GUOB 4WJ5A 1ZGLM 1VGKB 4XCNA 3V6ZA 1FIEA 1AQKL 4PP1C 1C5CH 4P2YA 1AIFA 4QTIH 2ADFL 2W59A 1P4LA 5JMRA 4M7JL 1NL0H 1UH3A 4H8WL 1IC5L 3MNVB 3V5KB 4JR9L 1FFPA 4QHLB 5I8KH 4LLQA 1RULL 1ZA6B 1EFXA 4K7FA 1MVUA 1PX3A 1F4WH 3ZO0A 1PX4A 4WI6A 3RTQA 3OB0K 1KJ2H 5CINH 5TPWL 2VH5L 5HHOD 3T8XB 4TSCH 3VXNB 2HLFD 1MCOH 1BZ7A 4L4JA 4H1LA 3T2NH 5IVXF 2DKSA 2FH6A 3O3EB 1UWXH 4RMSA 3D87B 5FK9B 5FA3B 4NN5B 3IJYB 4U1KA 3HE6B 3NN8B 5E6IA 4CRPA 1A47A 4GLRH 1F02I 2XG5A 5IBTL 5I8OL 5DWUL 1EEZA 1KLUB 1M4KA 1WGOA 1IFHL 2WMPA 3RAJL 1U6AH 5C71A 3TBWA 1G9NL 1BEYL 4LSTH 4WW1A 3KS0H 4X6FA 3ZDZF 4GXUM 3DVGA 3K7UA 4YDLC 4KROD 2DWEB 4UIMA 3AC0A 4H1LG 5C08E 4N0FB 4MD0B 4GQ9L 3RWIA 4ZUUB 5B3NA 1CFTA 4PIRF 5I1KH 2PTUA 3VI4F 4LGRB 1MCPH 3E0GA 4JO4H 2UZIH 3CAFA 3PE9A 1BOYA 1QRKA 5E9DB 5KZCD 5DTFB 4P5MB 4RMUA 1IBGH 1JPFB 5DUPL 3MGTA 2OTWB 3MSPA 2NXYD 1PQZA 1JV5B 2VLLA 4GW4A 5I8EB 5KVEH 1VB9A 4XCNB 4X80H 5J1AB 2I60H 2VWEC 1A6ZB 5B38B 2D2OA 2M1KA 3V0WH 3TC9A 2Z91A 2HTKD 1AIFB 2BX5A 3CFDA 4Z7WF 1DFBL 1A9BB 1DP0A 1CTNA 3OQ3B 1FFPB 4AZ8A 4HT1L 4DWHA 4EUPA 4J6RH 3ULUE 1DANU 2X4OB 3GSUB 2WW8A 3EYVA 3VFRB 4HLZG 1I75A 1MVUB 4TN9A 4YO0A 4LHUD 3RTQB 4MQSB 3J8F7 1T1ZB 3DURB 1KT2B 2ZKHH 4ZOBA 3MACL 3X14A 4WCYH 4WUUD 2E9JA 1F11B 1XIWC 4EUPG 5D9SA 4XBGB 4LSUH 3LS5H 3L3GA 4XP1L 5I15H 2D7PA 5I1JH 4QEGA 3DO7B 2YPKA 4FQ1L 4OFVA 1YPZB 4IS6A 4RMRA 3VXTB 1JPSL 3HC3H 3QUKA 4Y4FA 2WZPD 2H32A 4ZS6C 2AJYH 5TE6H 1CFTB 3V0VA 5EZJA 5DD3L 4HWEH 5FGCE 4MJ4A 5CSZA 2BERA 4U3CA 5F3BB 4X4ZA 5D1QD 3MA9H 4EDWH 2IG2L 3B2UC 3QCVL 3U6RB 3V4VH 1KCUH 4YBQD 3P77B 1MFCL 2C26A 5D7KD 4YDKH 1HYSD 2KBGA 5INCA 3C6SB 4JY6A 3FTGB 3BT2L 4TNVK 1N8ZB 2Z91B 2VN4A 3RGVC 4LP4A 5JQ6H 5DYOA 3CFDB 2NY3B 2QSCH 1RSFA 3V2AR 4ZUTA 1YC7A 2AJVL 3D69A 3QULA 3BYTA 3MRIA 3HCVB 1QZ1A 5DRZA 5C0CE 4NIKB 2DQGH 1X9QA 2NY2B 4LLUA 3LEVL 4XAWL 5DUBA 4U2ZA 1JPST 3OBAA 3I9GL 3ARDB 4PBXA 2P7TB 5HTSA 5FDYA 1VENA 2DLGA 3WN5B 3MZGB 5BCAA 1JIBA 2Q7YA 4PJ8A 2H6PA 3C09C 5IF0B 2JELH 1T83C 2VDNL 3VXUA 5HHMD 4F80A 5MP6L 2WK2A 2Z31D 3U4EA 3GIVA 3KJ4C 4S1QH 4NQEE 2FL5B 4GUPA 2VSCA 3NOIA 3WJLA 1AGEA 1LD9A 5CEYB 4P46D 5BVJB 1AGBB 3MRGA 3RDTC 4N5UA 1I3GL 5CSZB 1OB1A 2XQYG 4G3YL 4NQVA 3RWJB 3VFOA 1BJMA 1KJVB 2WINB 1ZANL 2PYEB 3W5NA 4TVPE 3PHOA 4GRLB 2Y6SC 3GMQB 2C5DC 4N0CD 1FE8H 4QO1A 3BKYL 3M1BB 5F7KC 4XMPH 3EJYC 1GHFH 4WFHE 5C08D 3QXAB 4L8DA 4OGXL 4P2QB 1OT2A 4KKBD 4LFHG 2FEEL 3HI5L 3MJ8B 5DYOB 1KFAH 4MA1C 4ZUTB 3QUML 4KH2A 2Z0BA 3O6KH 3MRIB 4RBPH 5GJTH 1QQDB 1MJ8H 5DRZB 1GAFL 1FSKB 4TNWK 2YK1H 4XPHL 2X70B 2L4OA 2W1NA 4YJZL 5MENB 5IJVB 3SDCA 3FO1B 3LKSA 4HKBB 5EORH 3SDAC 3LEXB 1CQKA 3BP7A 5EU6E 1L4IA 1R3LB 3WFEH 2PTTA 5C86A 3IDNA 4XP4L 3HFMH 5K9JL 4QT5A 2H6PB 2ZUQB 4IRJB 2G75B 2LAGB 1YQVL 5FA4A 1KIQA 4QHUA 3LCYA 1WJ3A 3TNMA 5I30H 1PG7W 2CIIA 1FORH 1MIEH 3IS1X 4LEXH 1AI1H 3O9WA 5LJYH 4GBXA 1BFOB 3GIVB 3BOVA 4HDIA 2CR3A 4LCWE 1AGEB 1C7TA 3M07A 1LD9B 2J4WL 3QIBD 5L2KE 1VACB 4HSQA 3CUPA 4X98B 3VFOB 4P4KA 3QWOB 2BY2A 4PRAA 1SM3H 4JGUA 3OPZH 4ODVH 1BFSA 5IBLC 4JM4H 1MRCH 5IIEA 2CXKA 3ZE0F 1YC8A 2KZWA 2YD7A 1H3UA 3MBXL 3VG0L 5ACZB 6FABL 4KI1A 2WBKA 2UZYB 1ZMYA 5SWQA 3IGAA 4XVUD 1RZJH 1BM3H 1V3JA 4L8DB 5F7MC 3LHPL 3K4DA 3ZDZE 4NQCB 2VQ1A 3A0OA 3TNNA 4FZ8H 3CNKA 3D0VB 1FAKT 3QIUB 1RUMH 2CUIA 3O8XC 5DVOA 5ADOL 1CZ8H 2R1WA 1RZJC 4QTHB 1ZT4B 5DURD 3IFNH 4LVNC 3PDOB 2LABA 1HDMB 2H2SC 4EOWL 2ZCHH 3LMJL 5HYFA 4MJ5A 1IKFH 2NY6C 4PJGB 4KQ3H 1QEWA 4ZS7H 5EUOF 4OZFH 1WIPA 3IDNB 5DFVD 3B9KD 5JIHA 5EC1B 1GGCH 3MYJA 1IILE 4HQQH 4XGZA 2IH1A 3DBXA 3TLRA 5I1CH 3QDMB 5C0CD 4RSVA 4WHYG 1MFNA 4GBXB 4EI6A 5IQ7L 1DBBL 4M48L 4KMTL 2D9QB 4QTIL 2PF6A 3F12B 3IDXH 3O6MH 2OTUA 3IETA 4D2NA 2DQIH 3CUPB 2W9LA 3S4SG 3I75B 5DD5L 5I8KL 1JPGA 2ZUYA 4D9LH 2R0WL 4OF6A 4G5ZL 3ULVH 1AGDA 2DYPA 4Y19B 5L8JB 4EIGB 4CW1B 3CFBA 1S3KH 5ITFB 2VZ3A 3MLRH 5TDOA 4JPKL 5E2WH 1NUGA 5KSAD 3FQUA 1B4RA 2KQMA 4HF5L 4BQ9A 5ICZB 4F58H 1S7VB 1CGSL 2FECL 4G9FE 4J3VA 1MUJA 2BNQA 5SWQB 4J8RB 3GSNL 4NQED 3ULVC 3KNBA 1G7IA 1JZ8A 2BMKB 4WVRA 4ZO9A 2XXMB 3UPRB 3BWUC 5SWZA 3BIAX 4LRIC 3CH1A 1HHKB 1U6AL 2NXZD 4ETYA 2E3VA 4JLRA 4LSTL 1EZVX 4C83B 2FEDC 3QUYD 4TVPD 4OF7A 5T1MB 3RPIA 2PO6A 5DJ6A 3CDFA 3P0YH 1MHHB 3FL7A 5I1KL 1WT5A 2AJUH 1ONQB 3HZVB 1MCPL 3K74B 4NN5C 2EE3A 2EDJA 4DN3H 4YHLL 2UZIL 1QEWB 2ZNWA 4YWGH 4JFYA 4YAQB 2C1PA 4BK5A 1YMHA 4WFHD 4WTWA 1IBGL 3VXRE 4PUBH 4UQ3A 3SDXE 1X44A 3CDYA 4WGVB 5FYLL 4EJ1C 3MYJB 4OQTL 2IH1B 3QXVA 5KVEL 3CU7A 2YSSA 3DBXB 4U7MA 4X80L 4ZSOA 2Q76A 4XB7A 1U91A 4G6AD 4HCRL 3FB5B 3CSYA 4XPBH 3V0WL 4JO1H 4ONGH 5EZOH 1A9EB 5GRYA 2E7HA 1Y0LB 1GRWA 2GW5A 5JPNA 4K7PH 4FFWC 5F7HA 1JPGB 5C3TA 5EU6D 1T89A 3QFDA 1FRGH 1JGLL 2VR4A 3QIWD 1AP2A 1B6DA 5HHXL 1H8NA 4OKVA 4L29A 1MCWM 3K80A 1IC7H 3FRPA 4WCYL 1FHGA 1A6TA 3P0VH 3QQ3B 4LCWD 4Y5VB 5BVPH 3JWNC 1DBAH 5FO8A 5L2KD 1PVHA 3ZL4L 5SWZB 2IBBA 3UPCA 3CH1B 4XNYH 4X6BA 1L6ZA 4MWFB 1V7ML 5E8EA 3RUGF 2A6JA 2B20A 3U1SL 4PRHA 3L3IA 5DEFA 4YPJA 4RX4A 3EDKA 4HUNB 3FRPG 5TE6L 2A74A 3TVMB 2YEZA 3H9HB 2AJZA 1YNKL 4WV1B 2R8SH 3QHFH 3GMLB 4ZO8A 3MMEB 1NKRA 4UNUA 5C6TH 4MCYA 3MA9L 3ZE1E 5HGAA 4PGDA 1IC1A 4OFIA 2VUYA 1XGUA 2UYLA 3OB0H 2DM2A 5HI5C 2B0SL 1GJIA 4GT7A 4KFZC 2AQ2A 4YDKL 4BSJA 5F93C 5D70L 1VKXB 3SGJC 4NKMB 2Q76B 4I18B 3CVHA 4PJBA 1TMCB 5FUCE 1NAMA 3CSYB 2ATKA 4EN3A 3PWNB 4JFEA 1I3VA 3VFVA 1GGYA 4E42A 2VMFA 4HGMA 4KHTL 3KXFE 5JPNB 1AE6H 5GRVK 5I1HH 1FL6A 4L4TA 3T0AA 1KEML 2BY1A 4FQXD 5K9QG 1NKOA 1J5OL 1K4CA 4G6FD 2CLVA 2I27N 1IRAY 2CLZA 1RZGB 3G9VA 3BKCH 3CFEA 1PLGH 3L95A 2DLIA 4L29B 1OAYH 4OLXH 2NY3C 4KTDL 4E41D 2J12B 1A6TB 1GZPA 2VJXA 3BQUD 2H8PB 4GW1B 2QJDA 3HB3D 5AAWA 4K55A 3O0RH 1R3HB 2J6EA 3GDBA 3SGKA 4PJDB 2YBRA 3QUXB 2NY2C 4OCWL 4PJFA 3NTCH 1H15B 2HFEA 4PRHB 3JVGC 4S1QL 3SCMA 5BQ7B 4NCDA 5ISZE 5I2IA 2Z93A 1MHEA 3ARDC 2VLKB 4L4VA 2QR1B 2X4NA 2A74B 2FZ3A 2KZ1B 2F53B 2AJZB 2FEEI 3ZE0E 2K1MA 3WN5C 1DN0A 1K2DA 2R4SL 3NA9L 4G9FD 5HJ3B 4BFIB 2ZOKB 1A6UH 2V5MA 1YEFH 4KJQD 2UYLB 2IANA 3PL6B 5TQ2H 3EYUL 1ZTXL 3LV3A 2V2XA 2BFVL 3CVHB 3MRNA 1GHFL 3PWLA 5F1IA 4YBHA 2ICWB 4DCQB 4EN3B 3VXSE 2JKXA 3T2PA 1LNUB 1JWMA 2RQ8A 3RL2B 4E42B 1S9VA 4K94H 5C07E 4GRLC 3VXQB 5GJTL 2JJVA 4G42A 1MJ8L 3ILQC 5ANMA 3VXRD 3F7RA 1PJ9A 4QRUA 1WEJH 2HJFB 5EUOE 4HIJA 2CLVB 5GS0L 1YEHL 2PUQT 3OJDB 5IUSA 4K94C 2B5IB 4NUGH 1U2HA 5EORL 4CVWA 1NLDL 2K7QA 3KPOA 4D3CL 4MAYB 1MQ8A 4P23C 4EBQL 3WFEL 3OXSB 2VB5A 5CBEA 3F7YA 5C0FA 4AH2A 3HFML 5FF6B 5EU3B 1JMZA 2C7UB 5F72S 1FSKC 4JVPA 3CX2A 5DRXB 4JN2B 4DGIL 3PJSA 3VXMA 1G7LB 5IB1A 3TN0A 4U1NA 3U83A 3S96B 1HWHB 4JFFA 2X4NB 3QHZH 1P4IL 1G9EA 5HI3C 1I7TA 2A38A 3LRHA 1OCWH 2OCFD 5J8OA 4G7YL 1K2DB 1SM3L 4TULL 4JO3L 4P49A 4Z0BH 4UTAH 2ZUQC 2IMMA 4IRJC 5IG7A 1S7XA 5D1ZB 4U1IA 5FM5M 4GJTB 1I1FA 2AK4E 2V2XB 4P2OD 1I9EA 3JUZA 4CVZB 5IESL 1HCFX 1QFWL 4PP2A 3I6GA 1RZJL 2Q86B 4HGKC 1NCNA 3QB7C 1A7NH 2DRUA 1WK0A 2VLJE 4YEEA 1J8HA 1RZIB 1JYXA 1TJHL 4PJFF 2ICEA 1A3LH 4X9GA 1CZ8L 5D8JH 5EPMB 5D1XA 4OD2A 4HJJL 4NNXA 2KUTA 3MX0A 2X4QB 3Q1SL 4WFFE 1Q1JL 3OR7B 3OJMB 5IROA 4BFGA 3DGCR 2R2EB 1UB6A 1KC5H 1WWWX 1XR8B 4UI2A 4ELKB 5J9PA 2IADA 2NQCA 1JGDB 1YY9C 1JHLH 3H7LA 5DDHA 2EDTA 3LN5A 4O51A 4DTGH 3F7YB 3QIUC 5CD5C 1K6QH 2W0FB 4BK4A 4AH2B 3KXFD 5F7NC 1ZV5A 2HG5A 3X17A 4PJHF 1FNFA 1SMAA 5I1CL 3RJQB 5IB1B 1FPTL 4MCZA 1WBYB 4F15B 3FB8A 2JB5H 2FECI 3NZ8A 5I1AA 4JFFB 3UCRA 4AEIL 3IDXL 3OKDB 2X89D 4GLRI 2DQIL 4HUUA 5J13B 1HHJA 4IDLA 3BESR 2VR5A 3WNKA 3GI9H 4DW2L 1NMCB 4XPGH 5I1LB 1D9KA 4OJFH 3ULVL 3WIFA 2CK2A 2GAZB 3OR6B 5D5MB 2VC2L 1S3KL 2DBLH 4POUB 1S7XB 1UACL 3DHMA 3MLRL 4GBXC 2VXQH 1I1FB 5EOCJ 4X0KA 5GRXG 3I3DA 3U46A 2V9RA 3A6CL 4JKLA 3AM8A 3I6GB 1MNUL 2G60H 4M8QB 4I9WE 4HUKB 3BI9X 5ISZD 4GAJH 3MRRA 3RUGE 3KHOA 4H26B 2E7LC 2VZTA 2VZVA 1X7QA 4HUVB 1J8HB 1RUQL 1OAQH 5ICYA 1LO3H 1KPUA 1BWMA 3FMGH 1G6RB 1IZJA 5DC0A 3VMOA 3LSOB 1ZGLB 1FYTE 2L7JA 3NCCB 3WUWB 2YWZA 1QLEL 1MJ7H 4ORGA 4X9IA 5DO2D 1LEIA 5J9PB 3EFDH 1MWAA 2IADB 5D2LE 3GMPB 2CQVA 1QLFA 4HV8B 1T20B 1OW0C 4O51B 4Y4HB 4GKNB 3VXSD 4XNZB 3QRFM 2YS4A 5F44A 1T7XA 1S5HA 3QRGH 5C07D 4G6KH 4DVBA 3UC0H 4V1DB 2XN9A 3WLWD 3QDGB 4S2SA 1CT8A 4F9PA 3FB8B 4XPBL 4H25A 2EKJA 3HZYB 4LFHD 1A4JB 4NNPH 5DQJB 2H3NA 2JIXA 3H9ZA 5ESVA 4FHBD 1WVZA 4HAFA 3KPQA 4HUUB 5F71A 1HHJB 2UVEA 4O9HL 2GSGB 3D18B 4JGMA 3CFCL 5GQBA 2YA2A 3HS0B 4BH8B 1JZ3A 3GKWL 1OP5K 2AJ3A 3OAYK 1CF8H 5DZNA 5F7EH 4L8SA 3U82B 4XVJL 4NWUL 5C0GB 1JZ5A 1T2JA 2HFFB 3MV9A 2I26N 4I2XE 5EN2B 4XXDA 4LPUA 1K5NB 3MRRB 1CVSC 4O2EA 1NMBL 1P7QB 3C08H 4UINL 1Q9KB 4BKLA 2DF3A 5IK3B 4NZUH 3WBDA 2BVPA 3ARBB 5AWNH 1A6PA 4LLWA 5EBWA 5ENWA 5K9OB 4OI8A 1YNTB 4EEEA 3S98A 1IAIH 4Z7QF 1QBAA 2YUZA 1NGXA 2YN5A 3TP4A 3AAZA 5IV2B 1FG2A 1JNNL 2VLRB 3O2WH 1I4FB 2IC2A 4HIHB 1W2KT 2AK4D 2VKWA 4ORGB 4R7NA 4X4XA 1QSVA 1RUKL 5EOCH 3FFDB 4OT1L 3QHFL 3N0PB 3SEPA 2R8SL 4Y5VC 1D6VH 3VMNA 2FJGB 3W9DA 4J3UA 5C6TL 1JNLH 2EH8L 2XYCA 1QFUH 4NHUB 4X6DE 4LGSB 1OL0A 4FQIH 1W72B 2VLJD 1S5HB 2NYYD 2VAAA 4OFYD 1OWRM 1YEDA 1XF2B 3LQZA 1IJ9A 2IALA 3BW9A 4DUXA 2O93L 3L7EB 2AJSH 5I18L 2XN9B 2JCCA 3D25B 5D2NA 3TVMC 1K9TA 2H26B 4WFFD 2OOYB 4WV1C 5JO5A 1A6AA 2HP4A 1TZIA 4CKVX 3K2MC 4HHAB 5I1HL 4Q6YA 1RIUH 5I66B 2R2HB 3BDYL 2WWKT 5FDWB 5KS9E 2K9UA 3X13A 5DJCA 1RD6A 4LIQE 4HWBH 1PG7X 1F6AA 1R5WA 3GHBL 4I18C 3CZJA 4DGVL 5T33L 1MAJA 1OAYL 3GMMB 4Y4KD 3BO8B 5GPRA 1REIA 2DMBA 3LQAL 3RVUD 5IEHB 3MUHL 4OCXL 1GOHA 2RFXB 3TO4B 4JN1H 5FYKH 2O5XH 1T89C 3DX7A 3O0RL 3DV6A 4FMFA 2AEWA 2BVPB 3KPNB 1IM9B 3O3DB 4LLWB 3LKPB 3KLAA 3NTCL 3T08A 3WNLA 3QI9A 1F45A 1FH5H 4WO4D 1WITA 4U05A 4WWKB 5HDLA 1BQUA 1N2RA 4OM1H 4MHHI 2FD6L 3P4LA 5DRNA 5JOPE 4F9LC 1KPRB 3T1FA 1KTDA 2VNCA 4G80A 4NC1C 1WV7T 4ODTL 2C3XA 1YEFL 3UBXA 3QUXC 3PQYB 1U8HA 1CK0L 1FCGA 2IALB 1SEBB 2LV4A 5DJAB 1U95A 1MCQA 2JCCB 5D2NB 4OSUH 1Z9LA 1DVFB 5IHZA 1SJHB 3I50H 9CGTA 5I0ZA 2FBJH 2A6DB 1FYTD 5CEZL 4V2BA 4HAGA 3K4ZA 2EEDA 3UBXG 4OV5A 5JHDB 1NGYA 4LSVH 3QAZB 2ADJA 3NFSH 3PL6C 4IBLT 5LVEA 1GOFA 1F3JA 4XX1G 4NGHH 1G7MB 4MJIE 2FYYB 2J88H 1F6AB 2R29H 1DLHA 1F3DH 3AVEA 3D39B 3MLTA 1T2QH 3WCYA 1JF6A 2EYRB 2BVEA 4LKCA 2CPCA 5E0QA 1HHGA 2HYMA 4I0PA 2FJHB 1WCBB 4HKXA 25C8H 4ZQKA 4PJHE 4HZLA 3SOBL 3IRZA 5ALCL 4QRPE 3PWPB 2DLFL 1H5BB 4RRPG 1VEPA 2CUMA 2CO7B 4AG4H 4KDVA 1RJZB 4QYOA 3VI3F 4PB0H 3KLAB 3OV6A 3RGHA 5EOQH 3T0DA 3EYOA 3ZYJA 3DX8A 1QFWI 2B5IC 4FG6D 3MUZ1 3LY6A 4YIQB 2X1PA 3MODL 4MAYC 1P5VA 1IM3B 5DRNB 4GAYB 2COQA 3CPLB 1ZLSH 1KTDB 2VWEE 1ZHNA 1Z6JT 4UTAL 3PNWB 4IOSD 2AXFA 2F5BH 1U8HB 4M1DH 4CADA 5F97E 3IXAA 3CSPA 1D5XA 4PRPE 4PJEB 3S34L 4ERSH 1AHWB 1P53A 1JL8A 4GSDL 4QCIA 4J4PD 3TH2T 1KIPB 4PJXB 4M61A 2ZOLA 4GMSH 3JV5A 3GMOA 5D7JB 4Y8AA 3MV8E 2CRMA 2XT1B 1UKTA 5EO0A 2YUWA 3EOAB 3PUCA 3A6BH 4GMTH 2CDFA 4LSDA 3OAUH 3TIDB 2G9HA 1A3LL 2VXUH 5TGBA 5KSBB 3SE3A 3LN4A 2C3VA 5D1ZC 3ARGA 4FOMA 43C9B 4JHAL 2P5WB 5M95B 5AG8A 3BD4A 5F9DC 1U8NB 4YK4B 1DLHB 4E5XA 5FB8A 5EO9B 1M6OB 2Z92B 4W4NA 3UROR 4ESKA 1CLYH 2ZUXA 1HHGB 3P4OA 5HHVH 3F58L 2HRPH 4HZLB 1E4WL 4K8RH 3GI8L 1E4JA 4RFNB 3V8OA 5DI8A 2MNUA 3QQ4B 3TYFA 3QO0B 3QEQB 4MSWA 1ZLWK 3T3PF 5BO1L 1IQWH 1KG0B 4TUOA 1G7PA 5JXAH 3QPQD 4HIEB 4YE4H 5JA9A 2Y5EA 2EKSB 2V5SA 4K8RC 3G04B 5F8RC 3Q6GH 1IAOA 2JB5L 3O6FA 4UIKH 3TCLB 3TFKD 1A7PL 2DI9A 3T0EB 4RWHA 1JGVL 1U8PA 5TE4H 4P3DA 1GSMA 1B4JH 4YUEL 3GMRA 1UCBH 1I9IH 2FSEB 4MA8H 5T1DH 4XPGL 3UTSA 1QVOB 1NFDB 4WI5A 2BP3A 3G5YB 4Y2DD 5ERWA 3VH8B 3NVQA 3OZ9L 5DJZB 3FQWA 4OZIE 1CU4H 2GTZA 5D7IE 1CGXA 4ZTPH 2VXQL 1A7OL 3RIFF 3IXAB 2VAJA 1D5XB 3FN0H 3ZDXF 5EIVA 3KWWB 5C09A 1A2YB 1Q0YL 3CFKA 4XVSH 5J13C 3T4NB 3MJ7B 1DEEB 4NDMA 4MJ6B 4LRNH 2CDFB 5JOPD 5LGJA 1U8JA 4G43A 1EFQA 2G5BB 2NY4C 2D31A 4JCMA 2G9HB 4NHCH 5TGBB 3HUJE 3GSXA 4E0RA 4Q9QH 3KAAA 4OCRH 4JHWH 4PP1D 1TXKA 2R69L 5DMJB 5IFAH 3VFTA 1G6RH 2HT2C 4XZUB 5F7DB 4JPIA 4BZ1H 1QP1A 5JXEA 2IAMC 2GEEA 3P4OB 5HYJE 2D03L 3B6SA 3L3JA 2WQ8A 4GH7B 1DR9A 1BD2A 4PBVC 4CN6A 5DS8A 2F54A 3N1FC 3P0GB 3TYFB 3LKNA 5BS0A 3ILPA 5LKNA 2BJML 2D7TH 3LIZH 4TUOB 4WTZA 3UC0L 5EWIH 4C58B 4XNMA 1FZKB 4MJID 3AS3A 5E4IA 4PGBA 4YHNA 2YHGA 1NBVL 2IAND 3NFPB 4KQ4H 4OCYL 2GFBA 1NCDL 1CR9L 5HHQA 3HNVH 4Y4HC 4CNIB 4XNZC 4HFWA 3W9EA 2WUBH 3IJSA 4XTRC 5GGVY 1XGRB 2P5EA 3MNZA 2GJ6A 2I9LA 5SV4A 3EO9L 4QRPD 4U2YA 3HZMB 4U1LA 3FQWB 3MA7A 2GTZB 5GZNC 3MUGA 4P5TB 4LCCA 1XFPA 5KTEL 5F7EL 5E1AB 4JFOB 4RZCB 4M7LH 1FO0B 1EH9A 1QSEA 3C08L 4KK9C 4C56B 3DETC 4NDMB 4OUUA 4Z7UE 1IT9L 4NZUL 5LGJB 4G43B 1NAKL 1HE7A 5F1NB 1EO5A 3D2UA 3SE8H 3PF2A 3WO3B 1IAIL 5FOBA 1KEGH 3AREB 2MCPL 3O2WL 2X5PA 1GYAA 2CRYA 2O26U 5EDXA 3OKLA 1F13A 2AXGA 4PRPD 1U9KA 1MCIA 1T1XA 4M8VA 3B6SB 3CFJB 2VZSA 2D4DA 3DROA 4HS3B 1Y6NR 1QFUL 1FLRL 2YPLE 4L9LA 4C4KT 4JAMB 3ARBC 3VFMA 3MV8D 3ARFC 5E5MA 5BS0B 4QF1A 1I8LA 1FL5A 2VABA 5EB9A 1UG9A 1W72H 5TDNA 5CBAA 3TBVB 2PKDA 1CXLA 4D8PB 1XIWD 5JHLL 3RBGA 2B7DT 3V9FA 4HMDA 4M03A 2HA1A 4M43H 5HPMA 1RIUL 1RY7B 5HHQB 4UT6H 5T1KD 4N1HB 5ADPH 3W9EB 5IP4A 1IGYA 1JN6A 3W39A 4OLVH 3U36B 1HOCB 1TITA 4NZRL 2FJFA 4M7KL 5D6DA 1CGUA 4HWBL 4CVXA 2FH8A 3DV4A 4F7PA 5C92A 5EIIB 1ADQH 1YEJL 3DVNB 1JUFB 4P2RA 4H20H 4NFBA 4QXTA 4LKXA 1MRFH 4IRSB 3VI3E 3AMKA 1CFSB 3C60B 3HPLB 5INDB 2O5XL 4CGTA 5LAXB 4Z7OE 2ADIB 1IQDB 5E7BA 3FT3B 3DX6A 3MLSL 3JUYA 5FUZL 1F90L 5FOBB 4LPYA 1FH5L 3NFNA 3RGVD 4XPTL 3O2VH 5A2LH 2RR3A 4O00A 5GZOC 4M3JA 1LK2B 4TYUA 4PD4K 3TWCH 1JNHB 4Z77A 1G84A 1R5IA 3TO4C 1JWUA 1T1XB 3D85D 2H1PH 1JP5A 2QR0A 3MJ6A 3DROB 3OSKA 1JK8B 5DHYB 3NBNA 5ETUA 1DQMH 2HAZA 4DAGL 2VSDA 1OP5H 3CDGA 3F8UB 1F6FB 3OAYH 5HGHA 4S1RH 3V4PH 4ZO6A 4YX2L 4WWKC 3KLDA 5TDNB 5CBAB 4CUCA 4JZOB 4FNLH 5DC4B 2Y7QB 1TQBB 3ME0A 1C5BL 2EDKA 3CVHL 3QEHB 2ZUWA 2IBZX 3VU2A 1KJMA 2NZIA 4NRZA 4LSVL 1TZHB 1KIRA 1NAML 1Q9WA 4TNVF 1BIIA 3NFSL 1DTUA 3SBWA 5HYJD 1T0NA 2MQ0A 1QNZL 1IGYB 1JN6B 2VE6B 3W39B 4F7EB 3DRQA 3MOBH 4NGHL 3ULVE 2WWMC 1T03L 3DXAB 3HI1A 1LO2L 1IARB 5TE7L 3RDTD 2LE9A 1DVFC 4HEME 4OGAC 2HJLB 5EU4A 5LCVH 3DTXA 4XP6L 1AD9A 3T3PE 1F58H 5L88L 3DUSB 4LKXB 1YEEH 4XX1E 5GRJL 4G6MH 3SKJH 4MGXA 2Y6SD 4OGZA 3BUYA 5DZOA 5BRZA 1BVLA 1FZJB 3GSRA 2HH0L 1ZT1B 1SYVB 1MHPH 1GC1H 1OSPL 1PKQA 4AG4L 1J0HA 4NJ9L 5DK3A 3WNMA 4PGEB 2YR3A 5EOQL 4HPOL 4NM4L 1S5IH 2O5YH 1R3JA 2J6EL 1HZHH 1FJ1A 1C12A 1P9MA 1ZEAH 3MGAA 1OAXH 2E8ZA 1GC1C 2HKFH 4CDHA 1D5IL 5I1EL 3RVTD 2B8OT 3OJ2C 1JWUB 4OD1L 2QR0B 1H5BC 5DMKA 5H35B 3L3OA 2F5BL 2XZAL 1K3ZA 4NQXB 1U8QB 3G6JF 2Z35A 4U1JB 4M1DL 3D9AH 3DOSA 3RY5A 3BZEA 3PWUA 5E9DE 2AABL 3SDAD 3MRDB 1EJOL 2KKQA 4QRSB 2EH7L 3P9LA 2ARJQ 2FIKB 3H42H 3CC5A 1UJ3C 4P57B 4X99B 3KPSB 1KN4H 1S7UA 4NFDA 1KJMB 4NRZB 2PN5A 2ESVB 3GO1H 1KIRB 4JPWH 3Q5YA 2OP4H 5BW7C 4UV7L 3JTTB 5KG9B 4IMLA 2VDKH 5E94A 2ZNXA 4PRIB 3GNMH 3RZCB 2XQBL 2YPLD 2X2YA 1U8OB 1A7RL 3BGFB 1M71B 4HUMB 2A9NH 1QRNA 4UDTB 1AHWC 2MMXA 4PG9B 4PTUA 1N64L 4K3EH 4TUJA 4EI5B 4DVRH 3DTXB 1TVHA 3RWGA 5HHVL 5D7JC 3R1GL 1XR9A 1N0XH 4K8RL 3D48R 3GJFK 2UY7A 1T1YB 5DEGA 5IBLD 1NC2A 4XNUL 3GSVA 3ZLQC 1S7QA 2JJTC 3GSRB 4TSBH 1R3KA 1RK1B 1M7XA 1J10A 4YHOH 4HUWA 5L8LB 4OF3A 1IQWL 2E27L 1KNOA 1JHKL 4DKFH 3GHEH 2OR9H 4YE4L 4YK4C 4ZAKC 3X3FH 4N0YL 2XWTA 3FCTA 4NNYA 5FO9A 1FJ1B 4UIKL 2J3SA 1RJCA 5GGQH 1QLRB 4YQXH 5TE4L 5EOTB 1YPZE 1I9IL 1GOGA 3SE9L 4RFNC 5CIPH 1CD1B 5T1DL 3O8XD 3JV6A 5DMKB 2XNAB 4HC1H 1NC4D 4HWZA 3VRIA 4FXGA 5IMKA 5GGUB 3TE5B 2BOCB 1A1MB 3WD5H 1D6EA 3IKCB 2H2SD 1BQSA 3ABZA 4NUJB 3BZEB 3PWUB 4YFEA 4PJ9A 4OF8A 1TZGH 2NY6D 3FN0L 1CDCA 3OKMB 3T0EC 3MROB 3BD5A 3E1F1 2VXVH 4Q9RH 1NSNL 4NOBA 4P0DA 2R1XB 1BVKB 4WIQA 1A3QA 5I17A 4GQPH 3H8NA 1OTUC 1UXWB 4YFLI 1HHIB 3QUZA 2CIKA 3CCHA 4NHCL 5E94B 1ACYL 3RNKB 3VA2C 3GSOB 2JLLA 5KSUB 2ZCLH 3QCUH 1CGVA 4N9OB 4HFUH 1OQXA 3OG4B 3ES6A 5DMIL 1G6RL 1X5YA 2XZCH 4JKMA 4PJ5B 3S97C 3MRJA 1TCRA 4P9HL 1P2CB 3W0WB 4YDIL 5DEGB 5TFSL 1EZVY 2DD8H 2WAHA 3ARWA 3V95A 4TUKL 4EDXA 4KJWC 2AERT 3MQIA 5EU7C 3S7GA 5KOVC 2V7NB 1HI6A 1ZS8A 2ERJB 4YFDB 3WKNA 1U3HB 2MKWA 1UKQA 1XF3A 3ULVD 1AY1H 1UWEH 2DTMH 2XACC 1FGNL 2CKBB 3INUL 4JM2F 5D6CB 4S1SH 3UJJL 5F1KC 4Z78A 3X3GL 3BZ4B 5IFJA 2WNGA 2WUBL 4HS8H 2FEDD 1KN2H 1WLHA 3BXNA 1BAFL 3VRIB 5IQ9A 1DCLA 3F65A 4FXGB 5IMKB 2Q6WA 2E8YA 1IGJA 4LPCA 1IAII 3GJFB 3QT2A 1IAMA 5HHPB 1NGQH 3QWQB 2PYEE 3JWOH 5AYQA 4ELMB 5CZVL 5SX4I 4YBLB 2VDPH 1B2WL 2F58L 4F7MA 1ZT7A 3BMVA 4M5ZH 1QFPA 1F8TL 5GIRA 4QXUH 5CSBA 5IB4B 2EDRA 1AO7B 3OL2A 4YHYC 3JWOC 4H0GA 3P73B 2P44B 1FO0H 4IRZH 4P2QE 2NY5H 5D7SH 2QQKH 5C0BA 1T5XA 4DN4H 1EERB 4HWUA 1FNLA 4P5TC 4BQ6A 4HIXH 1J1XH 1VESA 2NTFB 4KVCL 4YXHH 4TPRL 3ES6B 4O02H 2R4RL 3WJJC 5EH1A 1RAMA 3BHBB 4JQXA 1Q72H 5JOFB 4FFWD 4HKJA 5IVZA 1MRDL 2NY5C 1UM4H 3PIQA 4QRRA 2EC8A 1C8PA 2ZP0T 5MENE 5CJOH 4R90H 1AXTL 4OUOA 1MWAL 4EDXB 3BFOA 1H8OA 4ZFOA 4P4RB 5LBSH 2EEBA 5CZXC 4XCYB 5DF0A 1ZS8B 3AREC 3DI2B 1CXKA 4JQVA 1CBVL 4OB5L 3C6LA 3UJTH 5ESQB 5HPOA 4OLZL 4MQ7A 4M7LT 3OMZA 1PG7L 4LCYA 2PXYA 4L8CA 5ADPL 3DO3A 4S11A 5F6HI 4FZEL 1FIGH 3FQXB 3L3HB 1DQQA 4NPYA 5IR1A 3MLYL 3SKUD 1RZFL 2EEAA 2HVKB 1OARL 4HKZB 1QSFE 1AQDA 5C6PB 4APQA 1J0IA 3BRGC 3HNTL 4D0DA 1NBYB 4F3FA 5H94A 4I77H 4X7SH 2QQLL 5GIRB 5HI5D 3IFPB 3WFZA 5EZIH 1OGAA 4I5BA 3IJHB 3VMPA 4NQCE 5L0QB 2X1WL 1PKOA 4ONHB 2GJZB 4WW2B 3S37X 1AD0A 1MCWW 3O2DH 4NJAH 4X7CC 3H3KA 5K9QI 4IRSC 2G5RA 3G6JE 4HKJB 5IVZB 1I1YB 3C60C 1LO0L 2ED9A 2ICWI 3C5ZA 3VFWA 1KUMA 1F4XH 2B2XL 3EDFA 1I7RA 2BHUA 4PJGE 1H3WM 2N7BA 1RUPH 1B0WA 3PV6B 4KY1L 4L1HA 3G6AB 4S1RL 3V4PL 3DGGB 3TA3D 1KJ3H 2DIAA 4FFZL 5E00A 4KJYA 1MFEH 2NY3D 3NA4A 3BRDA 1CIUA 4PJCB 3UTSD 4FNLL 3NZHL 1WBXA 3UZEA 1A14H 3QDME 3QZWA 4X6EB 5HVHB 3QDJB 3MOAL 1RK0B 2PXYB 1CWVA 4O2CA 1A7QH 5IB3B 4QOKA 3ECBB 5T1LA 2DDQH 1U8MA 3QWRD 4M00A 5DA0B 5C0EA 4MLIA 4OI7A 2J8OA 3ARDD 4O58L 5IMOA 1I85C 5EBMB 3S35L 4F2MB 2DQEH 5M94B 1Z3GH 3HAEB 5GSVA 2YRLA 3ZTJH 4YDVB 1YJDC 4KK5C 5J3HC 3MLXH 4I13B 4RAVA 4Y19E 1TQBC 4APQB 3DUUA 3IDJA 4EQ2A 4F3FB 3I6KA 4N0UB 1RFDH 4TQEH 3BH9B 4PRBB 2BK8A 4CU6A 4KRPB 3E8UH 1UQSA 5DUMH 2ZPKH 1MCCA 4BQBA 5IT2L 1Q8MA 3WDJA 2YZ1A 1QFWM 3HMXA 4GRWB 5JQHC 4AL8L 1C1EH 3WUWG 1HN1A 3O4LA 5AZEH 5A3IC 3OKOA 1AD0B 4N8PA 1EV2E 5DT1L 1CFQB 2HKFL 2PYED 2MHAA 1HXMB 4GRLD 4AEHL 3ILQD 2QSVA 5FCSH 5FGBA 3WNNA 5C8JA 1BFVH 2CDGA 1VEMA 1PZ5B 2GCYB 1DDHA 1Q94B 5DGQA 1EHXA 2Q87A 2C4FT 4UTBL 1VFMA 3VD9A 1I8IB 4P2QD 3SDDA 4FS0A 4Q2ZB 4ODXA 3UJIH 3PABB 1VPOH 4P23D 2DI8A 2H2PD 3DWTA 4POYA 4J1UB 4PTTA 1KELL 4XWOC 5JOEA 1ES0A 3LKRB 4Q74A 5DSCB 2AQ3A 1BQLH 4JZNA 4O2CB 3L1OH 4OLEA 2VDKL 4EKXA 2OTPA 4WDIB 5MEND 1X5AA 1QKZH 5C0EB 1U93B 2WBJA 5IMLA 3IT8D 4LOUC 2UWEA 4DOHB 5GSVB 1M7IB 5HI3D 4A2LA 4PR5A 2EDLA 1MCLA 4DVRL 1F4YL 3DI3B 2J2ZA 4RFEB 1NCCH 2AKRA 4U1MB 1BBJA 1U3JA 4RFOH 3I6KB 5CHNB 1QR1A 1D5BA 1VGEH 4ODWA 5JPMA 2R23B 3RZCC 1DBJL 3VCLB 3ZYZA 3WKMH 3VFSB 5FKAB 3X11B 1GH7A 5EC2A 3RVVC 5CILH 2VZOA 5CGTA 3X3FL 4AT6B 5SWZE 3I3EA 4EI5C 4FABH 2VYRE 3MO1A 5GGQL 1QSFD 1H3VA 2MHAB 4OIIH 1EBAA 5E2UL 4MXQC 1EVUA 4JZJA 5HD8C 2NLJB 3LEYL 4P59L 5DLMH 4HC1L 4ODHH 2MQCA 4ZXBA 1JBJA 3S88H 3ARSA 4YHMH 3MCKA 2EYSB 1H8SA 3QH3A 4YXKL 1TZGL 2IPTH 2X4PA 4NQCD 1TJGH