2QLVB

Crystal structure of the heterotrimer core of the s. cerevisiae ampk homolog snf1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
252
structure length
155
Chain Sequence
SLMVPVEIRWQQGGSKVYVTGSFTKWRKMIGLIPDSDNNGSFHVKLRLLPGTHRFRFIVDNELRVSDFLPTATDQMGNFVNYIEVRQTTDIPAVFTDPSVMERYYYTLDRPPQLPPQHVVLNHLVTSSIKHNTLCVASIVRYKQKYVTQILYTPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Carbon catabolite derepressing protein kinase
publication title Crystal structure of the heterotrimer core of Saccharomyces cerevisiae AMPK homologue SNF1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/protein binding
total genus 21
structure length 155
sequence length 252
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04739 AMPKBI 5'-AMP-activated protein kinase beta subunit, interaction domain
B PF16561 AMPK1_CBM Glycogen recognition site of AMP-activated protein kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.290 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2qlvB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2qlvB01
5HHXL 5CEXB 1T6WA 4KU1A 4MD5B 4L8CB 3MLXL 1EEYA 3RP1A 4KKBC 3T3ME 4P9MH 4JFOB 1U9KA 3W0WE 5D7IA 4G8GB 2MCG1 1FV1A 4E41E 1DR9A 5GGRB 4YBQC 4LRNL 1N6QL 3PP4L 4X5XB 3UTQA 3TZVC 4YHKL 4XVSH 1FC1A 4O4YH 3ULVH 5FM4A 4RGOH 1SJHA 4C83A 1PX3A 2DDQL 4K7PL 1JGLL 4FQJL 4LLAA 1A1OA 4B50A 2Q7YB 2V5TA 3RDTC 1ES0B 4H5SB 3WS6A 4R2GC 1AIFB 4JKPL 4ODTL 7FABH 3MGOB 2C26A 4CGTA 1O5DT 3KPMA 1FFOA 4WGVB 5T1LA 4GLRH 3L3IB 3FO9A 1ZA3A 3L3GA 3RX7A 3P0VL 2QEJA 3EO9L 4YHPB 4UBDD 5I9QB 1HINL 1BBDL 2ZUWA 4RNRB 3SE9H 1BX2B 4C59B 3ARTA 4OUUB 3GMMB 3T0EA 1AGFA 5C8JA 5LBSH 4WIQA 1A8JH 4YDVA 3GIZL 1DEEB 4PLKC 4HXAH 1FNEA 4CU8A 4KK6C 4JQVA 4L9LA 4MNGE 2ZZUT 1FZMB 5DJDB 3RUGB 5BS0B 5EOTA 5KS9F 4KY1L 5CZVL 1PX4A 2HRLA 3FOLB 4PJ5B 1JHKL 4CNIA 4HV8A 4CRPA 3VFGL 4NUJB 5DMKB 4LSUH 3MNWA 2WIIA 1H0DB 3VWJD 5C0CD 1VA9A 5GSRA 2CSPA 3JZ7A 1F6AB 1MH5B 4TSCL 1G7MA 5GGQL 2NY2D 2DIJA 2YPVH 5E9DD 1S9YA 3LS5L 5EBWB 3HRZB 5IB1A 1KJ3L 4NUGL 4R26H 1OHQA 4LARH 4UZGA 2A83A 4Z76A 2A6JA 3ROOA 1M7DA 4U1SA 3V6FB 2JIXA 4G8GE 1VGEH 5DGRA 4QRUA 2K7QA 3WNNA 1KCLA 4ZO9A 5HHQB 3B8YA 3QWQB 5DUBA 2F19H 3O3DA 1A3RL 3LCYA 1LO0H 4JO4H 5IHLB 1J0KA 5IB2A 5D1XB 2O26U 4LDOB 4PJHF 3SHSA 1NDGA 3CIQA 4F7CA 4TSAL 1YEIL 2AV1A 4I1NB 3QUML 3GUTB 3ORJA 3CNKA 1CLZH 4KDTA 3VFSB 4FQXB 1YEKH 4UT6L 3ROLA 4FRWA 1HYSC 2X4QB 2WP3O 4S1QH 1KEGL 2GUOA 4F9PC 3ZSSA 2V2XB 1WBXA 3MNVB 5E08L 1UFUA 4YBLB 4XNXL 3QXDA 1IM9A 1H3VA 1CTOA 3UYRL 3Q48A 1MCWW 2MCPH 4LSRL 3VFVB 3OB0K 3QZWG 3DXAE 4H8WL 4LCWA 3TYGL 3RI5K 4G6AC 4XGZA 3G5VB 4M62L 3HNTH 3SPVB 4U2YA 3RPKA 2ICEB 4PUBH 4Y5XA 4NM8H 2H2PC 4HKXB 2DM7A 2OTWA 3RUGE 3TWCH 1R3LB 1KG0B 1G7JA 5IK3B 2AS5M 2DLIA 3R1GH 1KACB 3H9SD 4N8VB 1KELL 4MHHI 4AK1A 4PJ5E 5D2NB 4AT6A 1IILE 1RUAL 1KXQE 2ADFL 5FGCE 4WNQB 4OV6F 3C6LC 2NY0D 1AC6A 3W9DA 1MWAL 1I8KB 3MUJA 4G8EB 5FAAA 4TTDC 4EQ3A 1XGTB 1ZS8B 5CEYB 3O11B 3PNWB 4A6YH 1P9MA 5C6TL 1B0GB 2YPKA 5ANMA 1HYRC 4KJYB 2CKBL 3AU1B 3D2UA 1HHJB 4KK8D 1DVFA 4L4TD 1CR9L 3IDMB 1JFQH 4BUHA 1DBMH 5HGBA 4PGEB 4MWFB 1CICC 4LLUB 5J8OA 4M7KH 3VXSE 3ILPA 5DD6A 3A6BH 4P4KC 3RWJA 4LU5L 3J7HA 2FD6H 4PRBA 3QUXA 1JNJA 3STZB 4OQ1A 3VWKC 4AEHH 2GSGB 2IAMA 3QCVL 5ICYB 3SJVB 4HUUA 4HCRL 2BNQD 3QH3B 5E8PB 3T0BA 3T4YB 4UQ2B 3BPOB 1R5VA 2WM0A 3AB0C 1QRNB 5E94A 2ZNXA 1HI6B 1IGJB 5FYKD 1LD9B 1MJJB 2APTA 1DN0A 4ZUUB 2G5RA 5T5FH 3LV3A 1RZJL 4MD4A 5E6ID 1RZJC 1MNUL 3EOYG 4Y1AD 4GO6B 4JM2B 1EHAA 1MJ7H 4L4VD 4OBRA 3GSNH 4LBEA 4MNQA 4WV1B 3P2TA 3VFNA 1OTTD 5JIHA 4IS6A 1J8KA 5DJ2A 4RZCB 5CGTA 3ZE1E 1AI1H 1C16B 1Z9SA 2CIIA 2VDRH 4EUPH 2D03L 4FQ2L 1NMBH 5CD5D 3LKOA 1YDPA 2VITB 5JOEA 4H1LB 2IQAB 4JO1L 2XXCB 4K7PY 4PJBA 4LGRB 4Y5YB 2ZUQB 5DMGD 3KDMB 3ZE1F 5IM7B 3QG7L 1UZ6E 1CK0L 3PWPA 3QUZA 4Z18A 5CLWA 4PGDB 1OD9A 4GSDL 2XFXA 4M6OH 5D2NE 1JNLH 1P5UA 5IF0A 3SOBH 2ZOLA 4PJXE 3DV4B 4QO1A 5DK0B 4L3EB 5A2IH 5E5MA 1EHLL 5DD5H 1JYNA 4X98A 1FVEA 2ZG2A 4XPBL 4YXHH 3WIHH 1T5XB 2G9HB 4P2CG 4BH8B 3EDEA 3EZJB 4CADB 3ZE2E 5DA0B 1J11A 2JELH 3I6KA 3IFLH 5DLMH 4AG4H 1OP9A 1RJLB 3QULB 2CUMA 3O8XB 4D2NA 2R0ZL 2IADB 3WJLC 1S5IL 5CFHA 4X9HA 5JHDA 1IT9H 4NIKB 3DVNA 4DVRL 5ALCL 1TMCB 1P4LB 5ACZB 4MJIE 3ZT6A 4YHIA 4NO2A 5TDOA 1YECH 1YY9C 4M7ZC 5T5NF 5AZEH 2F5AH 2R69H 3PV6A 3GMOB 2EDXA 1BQSA 2AJ3B 5I1LB 3MV8B 1Z0NA 4J1UA 3IT8D 3DMMA 4K23L 3U2SA 5I75C 4E0RB 1QRNE 1N0XL 4OF6A 2AK1L 2NY4C 3GEWB 4YHYB 4GG6B 5INDB 3CXDL 1CXIA 5KZCD 5E7FA 4JR9H 5I1CL 5SWZD 3WDJA 1JZ4A 1MHPL 4X4ZA 4P2OD 1QLFA 3QUYD 2HKFH 4NQEA 4NO3A 5I1AB 2HFTA 5FDYA 2HAZA 2Y06H 2AABH 3UTSE 3DX7B 4JM2F 5I8KL 3DUUB 2VIRA 2VE6A 2X4TB 5DHVH 1RZKH 2G2RA 5TFSL 5I8CA 1MHHA 1T7YA 3MLTB 3RX8A 4JREB 4QWWD 4I0PD 2CUHA 1FAIL 4WY7L 2CD0A 4LNRB 1BZ7B 3SGEI 3NTCL 2AJSH 3UTTB 5BVPL 1KJ2L 1MJ8H 4UILL 3MSPA 3JV6B 4YC2B 1A3LH 3AREB 3RA7L 1L7TL 3HCVA 3WHE0 1YYML 1DLHB 4XCEA 4B5EA 4HX1B 5AG8A 4KC3B 4G6KH 1D5BB 4PRDA 5BRZB 1ZK9A 3QFJB 1MRDL 2HLFC 3G04B 4PIRF 1DBBH 1MFNA 1S7UA 4P23D 3JV0A 2J5LC 1GC1H 5BXFB 1WSST 3AVEA 1OGTA 5F1NA 1ZT7B 4NNPH 3EJYD 1YNLL 1H3XA 1NLDL 3I9GH 1ZLVK 4LK4A 2M26A 2WINA 4TVPE 1IAOA 2AJZB 3LRHA 1HXYB 1B3JA 1NC4A 4LP5A 2EE9A 4QXTA 3IAGC 2DLHA 5K9KA 4LQFH 4X8XA 5GJTH 1MFAL 1WCBA 5HYSA 3VG9B 5CS7A 3DX8B 3MLUL 2X89D 5CJ8A 3ARPA 5KVEL 3U0WL 3KLAB 3D3VB 2YA2A 3OAYK 4LSVL 4EXKA 5K9OB 1KNOB 4QRPB 1WIPA 3HAEA 1S9VA 5I0DA 5AD0B 3BP4B 3BESR 3WYRA 4Z5RA 3KPNB 1YMMD 1KPUA 1FGNL 2W9EH 1HH9A 4HF5L 4I3SH 5KSBA 2EH8L 3G5XA 3FO2A 1BBJB 3QQNA 5D7LA 4GG6F 1JGUL 5BVJB 3FT3B 1F3JA 4NQVB 1J0IA 5ENWA 4UT7H 3BWUC 3QZWB 4HGKC 5J56B 4Z77A 4OD3H 2C9AA 1K8DA 3OHXA 4N8CH 5I1EL 3HZKA 3TCXA 1Z5LA 2R0WH 4OLZH 1AHWA 2BVQA 3MRGA 2R1WA 4WI2A 3RZWA 3UTTE 4DGVL 3MV01 5I6XB 4D8PB 1TQBB 5IEKA 2HKHL 3UBXA 2XI9A 3QHZL 3ZKXC 3TE5B 2QSVA 4UT9L 2GQHA 1H3TA 5E2WL 3SDYL 3MCKB 5BRZE 3TVMA 2MMXA 2EIBA 4GRLD 4CDHA 4HXBL 4KJQD 2EDTA 3E8UL 3KYMB 2Q87A 4LFHG 2CO7B 4LPUA 3P4OA 4GKZA 4MB3A 4MNHA 1CFTA 3AM8A 4XXDA 6FABL 2E9IA 5DURB 5KVGH 1HILA 4KGJA 2EYRA 1J1OH 1XCQB 3TN0B 4Z7OF 4CUCA 1U93B 3RPIB 4YK4B 4ERSH 2A0LC 2R0LH 4O2EB 3KPQA 3QQ3A 2Q6WA 1BVLA 1FRGL 4ZPTB 3LQAC 3B2UC 4OM1L 1QNZL 1JNNL 3ALXA 3W39B 3TH2T 1NCDL 2D4FA 2W0KA 2X4SB 4X7TA 2EDKA 3LSOB 4GW5B 2P45B 3O4LA 5TE4H 3T0AA 5EU5A 3MXVL 5I74B 3O6FD 1Y18A 2BFVH 4MQXD 1J1XH 1E6JL 4CMHC 4X6FB 3P3YA 1I9RH 2GY5A 4R4FL 4UUJA 5IB4A 5IMOA 5DJZB 3K8KA 4R4ND 1K4CB 5IJKC 3S98A 1K6QL 3U30B 3DOSA 1ZE3C 3UEZA 3SO3B 2HFGH 4XNMB 4PRPA 4XCCL 4AENB 1IGTB 4Z6AT 5EBGA 1FYTD 2YXFA 5JPNA 3U6RB 1YYLL 3BUYB 4L29A 4M4RA 1C7SA 4P5TB 1ZVSA 1T22A 1QFOA 4Z7WB 4PRIA 5C0AA 3MUGB 2V9QA 1BM3L 1WFOA 3UZVB 3ARDA 5IBUG 3S35H 1UVQA 4LCCC 3MV9D 1S8DB 2RIKA 1KJMA 3EDKA 4QTIH 3QCUL 1DLFH 2IWGA 2R2EB 4JQIH 4TPRH 3WKMH 3HC0B 3HI1A 4HKJA 1XF5A 5BO1H 4FNLL 3PWVA 3QXAB 4NQDD 4UIKH 5IROC 3UAJD 4CKVX 4ONOA 4YXKL 5GRJH 5A3ID 2X70A 5DS8A 1FNAA 2NQCA 3GIVA 3G6JA 3E3QC 5DRWB 1F13A 1IE5A 3TIEB 3S7GA 5J7CC 5SWSB 2VXQH 5A43C 1J0JA 3BEWB 4R9HA 2P4AB 1JHLL 2DQUL 2FBJH 4Y19E 1KTDB 3O41A 1S7SB 4M9PA 1SY6A 1A6AB 1BQLL 2YEZB 3PXHA 1ZHLB 3P73A 2DMCA 1KFAL 3FOMB 2XXMB 2H32H 5D1ZD 4KMTH 1XCTB 1FVDB 3LH2H 2HRPL 1NCBL 5DWUH 4YUEH 5FHAH 3UDWA 3ME0A 3F5WB 2QSCH 2QQLL 4JLRB 4XCNB 5DTFA 3OG6B 4EVNB 1KN2L 1VEOA 4K3HA 2YUZA 2Z8SA 4OFYD 3VXUD 3V6OE 4GMTL 1RVFH 4Q9QH 3AMLA 4EBQL 5I8EA 2DWEB 4EUPG 1F58L 2VLJE 3SQBA 1NCWL 2V7HA 3WNOA 5HGGS 1FE8L 5F1OB 5FM5M 1ZGLB 1C5BL 4PD4K 4PJEE 3MBEB 1KTLA 4F2MB 3OAUH 4AIZB 4AM0B 2XN9B 3NACH 3ZDYF 3QRGL 2EYSB 2Z31D 3T8XB 4HJGB 4PJ9D 2IBGA 4QHKI 3U7AA 5B3NA 3CFCH 4YAQB 2OX5A 1QO3A 2E7LA 3IJYB 1KIPA 1KBGH 2ORBH 3O9WD 4MHHG 4OUOA 3S36H 4NM4L 4HPYH 2WK2A 3RIAK 3BH9B 1BVKB 3CVIL 2X44D 2G75A 2NY2C 1OVZA 3HZMB 3LN4B 1YQ2A 1UCBL 2F54E 1ZTXH 3OAYH 1UM4H 2MQ3A 4Z7WF 2CJUH 3BPCA 3C08L 1BD2D 1H5BA 1AGBA 2A6DB 1QLEH 2YXMA 3SKOB 3LDBB 2AXGA 4F15C 2QKIA 1S7XA 4GW4B 4QOKB 5CSBA 1UXWB 2ITCA 5C9JB 1U8PA 1DQDH 2WBWB 5SWSE 4QRSA 4NJ9L 2Q3AA 3Q1SL 3WXWH 5I1HH 3DUSA 1DUZB 3ARUA 2JK5A 4BSVB 5HDBE 3ZHKA 1FZKB 3MLXH 2LAAA 5HGDB 2IFFL 5B38A 4KJPC 3MLRH 4OGZA 3D9AL 1U3YA 1A7PL 3VXTB 4PYHA 1DN2A 4M1CD 4X7EC 1T80A 1UWXH 2FO4B 3FFDB 4R7DA 4LRNH 1N6QH 4OZ4A 3PP4H 4YHLL 4YHKH 4HAGA 3CVHA 4MAYB 5KN5B 1D5MA 5CIPA 3BKCL 1IARB 3S34L 2FZ3A 4FQJH 2IALB 1WAAE 2BY1A 3V4VH 3HHRB 4QEGA 4Y88A 1C08A 3BDYL 4MJ4A 1I85A 1FC2D 3CX5J 4Q74A 5E5UB 4BZYA 2LFGA 3OKOA 1S9XB 1LK3H 2PW1B 2UWEE 3EO9H 2DWDA 1U8KA 3PIQB 3VXRD 1BJ8A 4JFFA 1BBDH 1TETL 1NJ9A 2ITDA 4N0FA 3QG6B 1A7NH 1F3DH 2NY0C 4HAFA 4P0DA 3QCTH 3V0WL 3DTXA 2PYEE 3IXTA 2F53E 5GGTA 3TGXA 4GUPB 3SDAA 4BFGA 3GSQB 4JCLA 1G9ML 3BMWA 3H3PL 1G9MC 4IHOB 3ET9F 3DWTA 3DO7A 4KK8C 4XXCC 3D87B 2J6EL 3MOAL 2AXFA 3REWA 4Y16D 5CZVH 2C1OA 4P99A 5EUKA 4K94L 3TO2B 4K94C 5DVOA 4PJAA 5B4MD 2Y07L 1JHKH 2YSSA 4HW6A 4NHUB 4Y4FB 5TE7L 1WVZA 3VFGH 3CSYA 1FG2A 4AEEA 3DRQB 4IRJD 1T21A 1GGCL 4F7EB 3ZSTA 5SX4I 5C0GA 1N3NA 3MZTA 2YUWA 1JZ3A 4OCRL 1QEWB 4PP2B 5GGQH 3ZTJH 2CLZB 3CZFA 4KTDH 3SDDB 3ARZA 3U9UB 5FYKL 1KEMH 1KJ3H 1NDMB 2YZ1A 4DEPC 3L3DA 3ULVE 2IGFL 1VPOL 4MQSB 1F11A 3LEVH 3QDJE 4WWID 1JP5A 3PHOB 2R2BA 3C2AL 1LDSA 1OTTC 4I18C 3MRFB 4KH2A 2Y5TA 1C1EL 3RGVC 4IBLT 4KK9D 1U2CA 2Y4SA 5ICZA 5T1MB 2JJTA 1MFCL 2EDYA 1CE1L 4UT6H 1JPFA 1UGNA 3KS0H 3LY6A 3OXRB 4MLIA 1I1AC 2H26A 4PJDE 5BJTB 1KEGH 2YN5A 2YOCA 4G9FE 3LIZL 4RX4D 5E08H 1I8LA 3G08B 4XMLL 4DCQB 4O5LL 3I6GA 2NNAA 1QBBA 4U6YA 4XNXH 2FRGP 5IT2H 1G9EA 3UYRH 5IMKA 3NN8A 1UENA 4LSRH 4OB5L 3OKEA 4XCFL 3JV4A 5HYJD 3RGHA 4MNGA 2CRIA 3D0VB 1IC1A 2Z91A 2ZSVB 5HHPA 2OM5A 5C08B 4M62H 5F71A 4LAJH 1WGOA 5F70A 5IBUB 1G7LB 3W82A 1QR1B 3DX9B 3R0NA 3KLSA 3ARXA 1Y0LA 3QAZC 2QHRL 3O81A 2OQJA 4OD2B 3QI9D 4NFDA 4KRNA 2B4CL 1A3QA 2B4CC 2I07B 5JW4N 2BVPA 4MJ6A 4HGWB 3JWNC 2ADFH 1BECA 1HSBB 4XWOD 5CJBA 4ZFZA 5T1KB 5IWLC 3NCMA 3JWOC 4NKOA 5JDSB 4ZD3H 2DYPB 1BAFL 3MUY1 4HD9A 5MEOA 2X41A 2ZKHL 4X6DE 5C6TH 5ID1B 1DQLL 3V0VB 5C0BE 1I7UB 3CLFL 3SDCD 4JGMA 1HQ4B 2BY2A 2CKBH 4P3CL 4G8GA 1CR9H 1FFNB 3U7WL 3AC0A 3S3JA 1RU9H 1UKTA 4HJ0C 1AFVL 3OKLA 3PDOA 2ZSWB 1FIGL 1EJOL 4PJFA 5E8EA 4AY0A 4YHML 1XGPB 4GKNB 3HG1E 4LRIC 4LU5H 5LG1A 5DO2D 4L4JA 3KWWB 3U0PA 4NZJA 4JFEB 4P2OC 3QUYC 1G6RL 1UWEL 2VXUL 2V17L 4ORGA 1FSKB 3QCVH 4LIQE 2OI9B 4HCRH 3SKJL 3LPWA 5IW3A 1ACYL 3GSNB 5D96B 2CPCA 3Q5YA 5AWNH 4UDTA 2NY5L 2KQNA 3D6GA 2E6QA 4QWWC 4S10A 1KC5L 1XR8B 1LEIB 5I17B 1RZJH 4HHAB 4M5YL 4EUPB 4N1HB 2XACC 1IQDB 1WUNT 3TLRA 4J3XA 4OUUA 2MOVA 4Q6YA 3DXAA 3AFLA 1XIWA 4GKSB 5DZOA 1MCPL 1A0QL 2C3HA 2IFGA 4O2FB 3MMEB 3KPSB 4FQ2H 5C0ND 4YZFE 1ORSB 4OFPA 1RZ7L 5DJDA 3FFCE 4JO1H 1MI5D 5C08E 3AAZB 3I6LE 1PVHA 3GMPB 4WFED 4P23C 4L8DA 2YC1A 4RMSA 3UROR 1A7BA 4YLQT 3AUVA 1E6OL 2BOCB 3MPCA 3WFEL 2ENSA 3BGFC 1X5YA 4RRPA 5E6ZA 2Q7NA 3QG7H 4GXUM 4JHWL 4Q7DA 5LCVL 1BJ1H 3T4NB 1I7RA 4NUJA 1VERA 3HS0B 3TT3L 4C58B 5DMKA 1U92A 2VO5A 1F4WL 5DHYA 5MEND 4GSDH 1H0DA 4MXWH 1H15A 3AMKA 1EHLH 1KTKE 2OJEB 5CWSB 1LEGA 4D0BB 1IKFL 4V1DE 3HRZA 4GT7A 1ZHBB 3C8KB 2PETA 1D9KA 1YEHL 4LLQA 3SE4C 5I16B 4X0KA 5I30L 3AS2A 1MCQA 1XEDA 3VXSA 5FECA 4NJAL 2R0ZH 5D7KE 4JFYB 2I9LA 5CP3H 1S5IH 4XP5L 4KK5D 4UI2A 3W11D 2WBJB 3S5LA 4DVRH 5I73C 4YEEA 1XR9B 3IKCB 4FXGA 5AUMA 2BXYA 4L3CA 1W0YT 4JFEE 3X12A 1Q9LA 4HS3B 4QCIB 1U8JB 4RMQA 5HJ3B 4WW2C 5JHLH 4UOJA 2B5IC 2D9CA 4DAGL 5JDJA 4FQXA 1IAIM 2FBOJ 5T1LD 4JQXA 4ZXBB 3SCMA 2AK1H 3GSXA 5IESL 1KV3A 3RWFB 1EGJL 2V2XA 4WFFD 4XBGB 1JGEB 1R3KA 1G7PB 4PJGB 5DHVB 4PLJD 5ESQA 3IF1B 4BSWA 1QSFB 3BEVA 5I18L 3T0ED 3WJJC 1MHPH 4L8SB 2PO6A 4IDJL 3U0TB 3WDIA 2J8HA 3CCHA 4MA3B 3SGJA 3WS3A 5EWIL 5I8KH 1EK3A 5ALBL 1R3LA 4GRLC 5E8NA 2HG5A 2ESVE 4KJQC 1A4JA 2VLKA 4K55A 3GMQB 5FV1L 3L3KA 2GFBA 1FAIH 2V2WB 4WY7H 3RRQA 1GVIA 1L0QA 3MACH 5DJ0B 2F5BH 3UO1H 4JPWL 4PJXA 5EOCL 5GZOC 4PY7B 2W0FB 3VFMA 2BRRH 1RK0A 1S7TB 4GBXB 1J05A 1N6VA 5JR1H 5JA9A 1ZS8A 5CEYA 5EUOA 1L7TH 5I1DB 4WO4C 1I9EA 1YYMH 1M6OB 1KB5H 4JY6B 2Q86B 4J4PC 3WBDA 4Z8FL 2XQYG 1BP3B 1CGSL 1WBYB 3GMNA 1HHJA 1MRDH 2OOYB 4RDQF 3IDMA 4BKLA 3H7LA 5HHOE 1S7WB 4MA1C 5F7FA 4RISL 5BZWB 2VXVL 2R1XB 1YNLH 2ZCKH 4ZUSA 5LGKA 3PHSA 2BY3A 1JWUA 2JIXD 1MRFH 4MJIA 3LN5B 1HKLL 3PGDB 2MQCA 4AH2A 3OAZH 5TPWL 3V8CA 5F3HA 4OLWL 4RA0C 4KZDH 3SKMB 3O6FC 2ZWLT 4MQXC 5KVMC 4X6EB 5ICYA 5C0DA 1S9KC 2YBRA 1MFAH 3RL2B 4BZ2L 1LE5B 5MP6L 3MLUH 1CDBA 4TULH 3I50L 1N26A 1BOYA 2R9HC 5C0RH 5KVEH 2BSSA 3U0WH 1MREH 1OB1A 3BN9C 2X1QA 2QSQA 2A6KB 1Q9KA 3IFPB 2B1HH 3QIUC 4YDKH 3E2HB 2I25N 4FXKA 2J4WL 4K3EL 1G7QA 3RWEB 3PQYB 3CDFA 1PYWB 3QIWB 1OW0C 4G6JH 4M6NL 2FEDC 4O02L 3I02B 4PJGE 1C16A 1IM9D 3UTSA 2CIKA 1QSFE 4LQ1A 2YUVA 2BOBA 2EH8H 1PG7W 4LCWD 4LSDA 4Q9CA 5IBTL 3HFMH 2CR3A 4LLWB 1XGUB 3LKNA 3ARGB 3LVEA 1OTSC 2J8UE 4MQ7B 4HH9B 3F12A 5MERB 4PBVC 1FBIH 2APFA 5A3IC 3IJHB 4MMZC 5C0JB 1A22B 4DJMA 1YMHB 5F96L 4FG6D 4M6ML 3LQZA 5CZXD 2DLEA 1QVOA 2IH3B 1KCVL 4YHOL 4DGVH 1K4DB 3BGMA 2YK1L 2HKHH 3N85H 4L5FL 1WBZA 3SY0A 1NMCB 4OF8A 4HIHA 2G9HA 5CBEA 3S37L 1Q0YL 4UT9H 1ZLUK 4CADA 3I3EA 5I66B 4Y4HB 5F7DA 3MODH 1WWBX 3D2UD 1DVFD 3O8XA 3EUUA 1PG7H 4HXBH 1VDGA 4G5ZL 5D1ZC 3RWHA 4J7RA 5TF1L 43C9B 2DQDH 3E8UH 1J7VR 5LKNA 5FDWB 1E4XL 1HKFA 5F7KC 3CDGB 1DUYB 4OKVB 5FGBC 1U91A 1QBAA 6FABH 4HUMB 5MEPA 3QUXD 2HN7A 3RVVD 3MRQA 4BQBA 2IAMD 5EU4A 3BVNB 5KSUA 1AP2A 3MV11 3QR2A 1QSEB 4Y2DA 5I71C 4CDGC 2EECA 3LQAH 1FRGH 1NC2B 4PJFF 1DQQB 4PV9B 4I0CC 2NXYC 1P2CA 4OM1H 3BPNB 1JNNH 2R8SL 2HTLC 4QHNA 3KLHD 2Z31C 2VQ1B 1NCDH 5L0QB 4PJ9C 3I75B 3LB6C 5GJSL 1NL0L 4NN7B 3IXAB 4MNQD 1DL7H 1JUFA 3PQYE 2Y7QB 3DRTB 3MBXH 3MXVH 3OQ3B 5I1AA 4Z7VE 1E6JH 2X4NB 5D8JL 3EGSB 2RFXB 3QEHA 4O51B 4OZFH 3LKSB 4R4FH 1EH9A 4XNQA 3GK8H 3ZKQD 4PG9B 3F7YB 5EBLB 1NFDB 1CG9A 1W8NA 3E6HB 4KXZH 4XCCH 5GGVY 2Z35B 3LS4L 3MRNB 1FNGA 4K7PX 3BWAB 4B0MM 1YYLH 4EJ1C 1LEKA 3PWPD 3QUZD 4AL8H 4XC1L 4R0LA 3FQXB 4FS0A 3V8OA 2BHYA 4TSBL 1BM3H 2NY1B 1RURH 1JTOA 5EO9B 3S96B 1J0HA 1FGVL 1D5BA 5BRZA 3TNMB 4AEIH 2BSED 5EU3B 3IFOA 1SQ2N 1ZT7A 3OJVC 2APBA 4FNLH 4XNZC 2QL1A 4G6FB 2D7OA 2ZPKL 1DBAL 5EH1A 4YXKH 3K46A 5L7XH 1KCRH 5JHDD 3Q5OA 2YD9A 4APQC 2XKUA 3VW3L 4U1MA 3VGHA 5L2KB 1HSAA 3PDGA 1CWVA 2DQUH 5T3ZH 3VE0B 3MRRB 3RY6A 1F4YH 3SN6N 5IOPA 3BIAX 3QISA 2AK4B 3QPXH 4JJ5A 1WFUA 3MGTB 2PCPB 1QSEE 5DVMA 2AQ2A 3WHXB 4JG0L 4HK3N 4NN6C 4RFEA 1H3PH 1KFAH 2IQ9L 3FB6A 2HRPH 5ERWA 1NCBH 4LCUB 1PLGL 3BP4A 4JRXE 1FZOA 4RGND 5HDLA 2QQLH 5KSAD 2XRAL 3EJZC 1KN2H 3QPQC 1MCCA 1Q94B 3U4EB 4GMTH 4NQED 3ZO0A 3M07A 4EBQH 1RUQH 1HDMA 3B6SA 4QXUL 3C60C 1G1YA 5F1IB 4X6CB 1FE8H 2BC4A 1NMAH 1DE4B 1NFDE 5B39B 4XB8A 3TBWB 5C07B 1U8IB 2XTJD 3VI3F 4N9OB 5ESVA 3CFBB 3VD3A 1CGUA 3QRGH 3IRPX 3VA2C 3TPUA 2HWZH 4D0CA 4ETQA 3BKMH 1QTYT 4F7PA 4NM4H 3IDJA 1T6VN 3ZE0F 3MGAA 1BLNB 3D69A 2OL3L 3B9KB 3BZ4B 3IDYC 3FQUA 3C5SB 3HC3L 3FRUA 2DM4A 3ARQA 3EYVB 4XVJL 1ZEAL 4ELMB 3UTZB 3R4DA 1OAQL 5D6CA 5AG9A 5J1AA 1I9IL 3EFDL 1HWHB 1N59B 2QADB 3PE9A 4JCMA 3WE6A 2YMXL 4OCNC 3E0GA 4FTVB 1DBKL 3BH8A 4MXVE 3B5GA 1FZJA 4Y19A 4FZ8L 1U8HA 4NO0A 3TV3L 3Q1SH 1U93A 5L2KE 3HI5L 2FJHA 2C7UA 5HHNB 2Z4QB 1IAKA 3CSPA 3OJDB 4JFHE 2MFNA 3HE7B 2ZOKB 3MV7E 3HA0A 3TZVB 2HJFB 2IFFH 1B4JL 4P5KB 5I9QC 3ECBA 3QXTA 1VFUA 1A7PH 3RWIB 3LSOA 3BW9A 1NCCL 2PR4H 4FQLH 5CMAA 3RDTB 1JJUA 1X44A 1MRCH 5C3TA 4V2CB 2I26N 4R2GB 2MSPA 2HFFA 3GHBL 4YHLH 3V6OA 2AEWA 4X6FA 3KPPB 3X3FL 1SYVA 3E6FA 5F7WC 2XICA 3EYFA 3S34H 3BKCH 1UZ8B 1NEZB 2VLJA 1MIEL 3GMLA 3INUH 4H0IA 1J87A 1KT2B 4PJEA 5D7LD 3X13B 2A73A 4XNMA 3OB8A 5JORB 4R4BA 1JYWA 1PW3A 1PZ5A 4XMKL 4HMDA 3U6RA 1HIML 2P5WB 1JWMB 5HI4C 3VXQB 3BZFB 4G9DA 5C07E 1I3VA 4LEOB 4W4OA 3ULUD 2HVJA 4CW1A 2P42B 4X7CC 2ARJB 4X6CF 3GJFA 2GJ6B 1A6WL 1M05B 4PR5B 4YDLC 2F54A 1T83C 5LGJA 4XZUB 4X8JB 1U3HA 2AJVL 2R2EA 3HC0A 1G9MH 4KZEH 4XX1G 3PL6C 5K59E 1OPGH 2NXZD 1GOFA 1Q9OA 3VXOB 3TBSA 5IHUL 4K94H 1ZXQA 5F93C 3ARFA 2NY7H 2Y07H 2VJXA 4MS8C 5SWSA 4KUZH 5TE7H 5IVNA 1CDUA 1K8IA 1M7IB 1N2RB 3HB3D 1CBVL 3SGDH 4ELMF 1FJ1A 2W65A 4XCYA 4RFOL 5CUSL 4OCRH 2V2TA 3S97C 3GB7A 5GS1C 4RAVA 3H0TB 5FYKH 3WD5L 3JSSA 3AY4C 1XCTA 2EEDA 2IGFH 2GJZB 1VPOH 5FF6B 2YD5A 2XYCA 1NEUA 2CXKA 4P2QE 4F80A 3VGGA 3QUMB 3C2AH 3FQWA 1U95B 3CUPA 2UUDK 1WAAA 1UM5H 4HWNA 5KBNC 2E27L 2VR9A 3PWJB 1U42A 2AEPL 2WSKA 1R3IH 3H3KA 4GXVL 1G1CA 3RWGA 5C0NC 5CKAA 3ZKMD 1C1EH 4NKIL 4M03A 4TNWF 2Q8BL 4M9OA 1ZGLA 2UWEA 4X5WA 1EAJA 3K1KC 1AKJB 3OJ2C 4WCYL 3THMH 2DQCH 4PRPD 1Q8MA 1TZIB 3MRKB 4AM0A 3CMOL 4S0SD 4OF0A 1CE1H 4JM4H 1UJ3C 2ARJQ 5DK2A 2PYEA 4HC1H 2F53A 1ZSDA 4FFZL 5LVEA 4DUVA 5FXCH 3LIZH 3VFRA 1CU4H 1CL7I 4KI5F 4PRID 4QLRA 4XMLH 5C0AD 5EPMA 1EUTA 3ARDD 2EE6A 5FKPA 4OB5H 4XCFH 3LN4A 3TH3T 5HSFA 1FLRH 2GJ6E 2ZUYA 3NPSC 4NNXA 1OCWH 3C6LB 1T1WA 4F8QA 2G60L 1MWAB 4XNUH 1R3HB 2QHRH 4NSKA 4NQXB 1NGXB 4GW4A 2APXA 4NQCE 4NZTL 1RZ8A 4KK5C 1EHXA 2B4CH 1U8LA 1XH3A 4JRYD 3W11C 2HFEB 3KHQA 2CKBB 1F3DJ 1T03L 4TUKH 3JWOH 4NP4L 2DBLH 4YHZL 4NNYB 1BAFH 1FL3B 3VG0L 4O00A 1CICB 3GMRB 1MCKA 1DQLH 1S7VB 4XPTH 1IMHC 3FKUS 4XVTL 4NRXB 4U49A 4P57B 3VXTA 1IEBA 4IIQB 3QDJA 3U7WH 2OMBA 2P43B 2FO4A 4X9IA 3VWKB 4BQ6A 1QFWM 4NCC2 1GHFL 4BA8A 5J6HA 3AB0B 1T0MB 1D6VH 3QDMD 4PLJC 4PS4L 1D5XA 4EDWL 1HHHB 2VXUH 1G6RH 1UWEH 1IC7L 1IAII 4IOIB 2V17H 1RJCA 5HGAB 3SKJH 2QRDB 2HJLA 2FL5A 3NCEB 2ICWA 4JQVC 4U1HA 4JFDA 1NLBH 3W9EA 1CVSC 2PW1A 4D9LL 4PJDA 4R3SB 1CE6A 4G9FA 4P46A 4BK5A 4F33B 1NAKL 4YJZL 4OTXL 1JMXA 3V52L 2YD4A 4GUPA 2QV2A 2HLAB 3OKYA 2Y23A 3HNVL 3EOTH 1Q72L 1EBAA 3W5MA 4Y4KC 4WHCA 4YXLL 1RZ7H 4PJ7B 2Z92A 3HLAA 2BXZA 1UA6H 1C12A 2PYFA 5FGSA 1NCAL 5DK3A 2PTVA 1E6OH 4CVZA 4HWZB 3KPRE 2P8MB 1KGCD 4JHWH 5BQ7A 5LCVH 1DZBA 1XT5A 3MA7B 3TT3H 3OZ9L 1CD0A 3KS0J 2EXYD 4HS6B 5DZNA 5FM5O 4WU5B 1F4WH 4AZ8A 5ID0B 2NW2B 4DVBB 4BSJA 1FP5A 2ZNWA 4X6DA 1CFSA 4QRRD 3FQRB 1LK2A 2C3VB 2XZQL 4JFPB 3V0AC 5C0BA 2J2ZA 5GRVL 5GSVA 4QXGH 1BEYL 5HGHA 3UYOD 1BFVL 2X42A 1ZLWK 1HQRA 3IDXL 4UINH 1SM3L 4YDIL 4QKXB 1A2YB 2NPLX 4Q2ZA 4J3OC 5I30H 3OR6A 4M7ZB 4ZFOA 5T3XH 1ACZA 1IGCL 1RJZA 5D93C 3HG1A 3B5TA 4LF3A 2KZWA 4WUUE 4XP5H 5BV7L 5F9OL 1Z9LA 3OGCB 3D25B 3IVKB 1I9JL 4NDMB 4OT1H 2COQA 3ZT7A 2XPGB 3MROB 5HHVH 5J06A 2NY4B 1SJEB 1AXSB 2HT4D 5IIEA 4KTEL 5I76B 1IAIH 4GAGL 1FVCB 1WK0A 2GITB 4PD4J 5D1QD 4JZOB 2P8PA 5D2LB 4ODUB 4B41A 3WIIH 3ZL4L 2HYMA 3FCTB 4OSUL 5H35B 4D0DB 5B8CA 5FM8A 2VSCA 4JFFD 3X14B 4WDIA 2DJUA 1QHPA 3QQ4B 2WWMD 1MCOL 3QNYA 4YC2C 3RHWF 2IMMA 5CZXC 4DCQA 4JDZA 5IG7A 4NQSB 2NX5E 4KV5E 4DK3A 1A9BA 1HHGA 1DFBL 2ATPB 2BVOB 5J9PA 3D0VA 4LSTL 3FFCA 1GAFH 4IDJH 1U6AH 1YPZE 1P9MC 1OP5H 3LRGA 1MQKL 4JFQA 4QHUA 2OK0L 1G7LA 1GSMA 1MCDA 3P4NB 5ALBH 1F97A 1FO0H 4OD2A 3CDCA 1QR4A 2H8PA 4A6YA 4IOFD 1KB5B 1WZMA 1A1NB 3O2VL 1LO5A 1H9VA 3JV5A 4LKCB 2BDNH 4X4XA 4JPWH 4RGMC 5EOCH 5KG9A 1A7RH 4QGYA 5T1KA 1JZ5A 4PJ7F 4ZSOB 1D3CA 3QEUA 2J5LB 5DD1L 2BJMH 1UXSB 2Z93A 4V1DA 3RVVC 2IAMC 3UC0L 2XWJA 3VRJB 5MHSE 2ZUUA 4Z8FH 1A4KA 5E00B 1CGSH 2GAZA 3S3PA 5DFWH 3W0WD 4D3CH 4PJ8A 4ZFFB 3O6LL 4X99A 4RISH 5KTEL 1UC6A 5LGHL 2SEBA 4W6XB 2X4OB 4HIXL 3TCLB 5C9KA 1BJ1J 1HKLH 4ZUTB 1X5XA 4HUVA 3DVGB 4OLWH 3PWUB 1T3FB 2Z8RA 3QDHA 4I48A 4PRHE 4HKZA 5GIRA 4ODHL 4NQUA 4A2MA 2CDEB 5DQJB 4G7YL 3QEQB 3I50H 4EXPX 1CGVA 4Z0XB 1XR8A 2GK2A 3ZYIA 2OSLB 2VSDA 2W60A 3VDAA 5D2LE 2DLFL 5J6GB 5GS0D 1M71B 3MRHA 1X4XA 1RIHL 1T5WB 4U6HA 4W4NA 1I1RA 4BYHA 3C9NB 1QSVA 5F88A 5M7QA 1TQBC 2DBJA 4M6NH 4O02H 1P7QD 3NIDE 1JGDA 2OXHA 3T4AA 1V3JA 3CFKB 4U0QB 3NIGF 2YN3A 1YEJL 4J23A 3P4LA 3QNXA 5EO0A 4UNVA 2Q3ZA 5IBTH 1RIVL 2ESVA 5K9JL 4DQOL 1X5AA 5C0CA 4UOW0 4OCXL 1XGQB 3WIHA 3HS0A 1MFBL 3O6KL 1IGYA 1Z0MA 1ZAGA 5F96H 1CFVL 4XX1E 1KCVH 4DKDC 1HHKB 2OJEA 4ZSOE 3SEPA 1DEDA 3GGWB 1Q0YH 3S37H 1WLHA 5HHOA 2ZUXA 1HCFX 2A74B 4P48A 1ZHBA 5JXAL 5HI5C 3DMMC 2ATKB 5GRXG 2RCSL 1SJXA 4G8GD 1PKQB 5F9WC 4ZMAT 5TF1H 3ZDZF 3QP3A 4ODSL 2H3NB 1E4XH 3BRGC 5L9DL 2MNUA 4Z78A 5FOBB 4DKFH 4HLJA 1NFIA 2X4RB 3CZJA 4LKXB 2HTKD 5ADPL 2CLVB 2J3SA 5E95B 4UDUB 3TBYB 4XNYL 4HIIA 1D5ZB 1U8JA 4NGHL 3P11H 1P4BH 3WO3B 3IRZA 3U30C 2VQUA 3SO3C 1RMFL 3CPLB 5E1AB 2FJGB 3OMZA 3W2DL 4CMHB 3IYLW 2IPUK 2FLRT 4OZFB 4P5TC 1T2QL 2R8SH 1I4FB 4PJGA 3MNZB 5GJSH 2Q76B 2W92A 2BZDA 3DXAD 1XIWD 3N0PB 5AAMA 2PTTB 1WC7A 3GSVA 4GOSA 1UB5A 1XMWA 4E5XA 3PP3K 3D39E 3STLB 1U8NB 2J8UA 5DVNA 1P1ZB 4OZIB 2VDNH 5I19L 3GMQA 3QJHA 1PZUB 3C5ZA 1MLBA 4LCCB 3LS4H 3VGBA 1G0DA 4X4ME 4PV8B 2H2SD 3BD5A 3C09C 4M7LT 1UEMA 4ZUWA 5BOZG 4WTZG 1JPSH 5ITBL 1Y6MR 5JLZB 3IU4H 2GSIB 4TSBH 1QQDB 1ED3A 2YD3A 2VL5A 3BQUA 3B83A 1FGVH 1B0WA 3DX6A 2PXYA 4FA8A 1INDL 3CFJA 3L95A 3GJEA 2O93L 2IPTL 2LU4A 1KPRB 2BNQA 3TA3A 2FX9H 1YY8B 5HVGB 5EFIA 5FUCC 3VXSD 1SJVA 3VH8G 1PKQE 3WSQH 4OCSH 3GKWH 1RIUL 5C2BL 4TQEH 1OLZA 4GQ9L 4L4VA 4YFEA 1KLUA 1MUJA 5CJ5A 4QY8B 4OFIA 4F7MB 2NTSP 5IEHB 4ZTOL 4OZGB 4GS7C 4GAFB 2XQBH 3QFDA 3NAAL 1HEZA 3GRWA 1MVUA 4ZDHB 2VLRE 2VXTL 1I8IA 5IW6B 1ZT1B 4FQXD 1ZGLM 2HA1A 1F2XK 4OFDA 3QBTB 3PQYA 3T1WA 3FTGB 3ULUL 3ULUC 1PLGH 3P77B 4Z7VA 1T1YB 2E9JA 5IBLD 2YR3A 2XRAH 3BPLC 3OV6A 2VDMH 2WW8A 1OAXH 4YBHA 2D7QA 1L6ZA 4OGXL 3TJEL 2PO6D 1P84K 1UQSA 3DARA 4QXUH 4NRYB 4XHJD 3ARGA 2VZUA 3ZTNL 3TVMC 2EH7H 3VWJB 1NBVL 1N0LA 2X10A 4OZIE 3LDBC 2VLKD 2WLZA 5FB8B 1CDHA 4XTRC 2NY2B 4N5EC 5K9QG 3NA9L 2AKRA 2NTFA 2X2YA 1G7HA 1QACA 3QO1A 3T3PE 1EUUA 1S78D 3HUJB 2OL3H 3LKRB 1XZ0A 4X4YA 4WWKA 2C1PB 4F15B 4XI5D 3HC3H 1VFMA 3BP7A 3E3QE 4XVJH 2DQGL 5IB3B 3WUWA 2CRYA 1RJYA 1I9IH 3EFDH 2VDOL 5DRNA 4ZUVA 5T3ZE 1HOCB 2YMXH 1HK6A 4MJID 2DOCA 3MXWH 3S3SA 1DBKH 5JW4R 2BSRA 4FZ8H 4AMKL 5IW1B 1TZHA 4DZ8B 3FO1B 3TV3H 2QR1B 3HI5H 3FZUD 1R5IB 4M7JL 3X3GH 2WWKT 5EZLB 1KPVB 4WTWA 1HH6A 1QRND 5LAXB 4KKNA 3FQTA 2CQVA 2P5EE 4JZNB 4JFXB 1B4JH 3IDGA 4JRXA 4TUJB 2YRPA 4XRCB 1QLRA 3I75A 4NT6B 1NCCH 3O4OC 1X5LA 4C54A 5IMLB 3WFCL 2C4XA 2H1PL 5HVFB 3L7EA 1V8HA 4OZGF 4U3CA 5GHWH 5CP7B 4JDVA 3EGSA 1T66D 3PGCA 1EERB 3LKSA 3ARDC 4EDXA 3UTSD 3IJSA 1MIEH 4PG9A 2OTUB 4OLXH 4DGIL 3F7YA 3MLPA 4MLSA 4ZFGL 1CCZA 4OAWA 3OBAA 3MFFB 5CJOL 5EN2A 4XP9L 2NY0B 4BELD 3H8NA 4ZTPL 2J8OA 1NAMA 4XMKH 3S4SB 4U1IA 4EIZC 1HIMH 3IDUA 1D5IL 1S7QA 1AE6L 3IDIA 5E70A 1U8MA 5KSVA 4M61B 3K2UH 2XKNB 3S9DB 1UB6B 3VFPA 5DT1L 1NGPL 3LMJL 3O45A 4ZNEE 2LE9A 3L5WA 4UTBL 4ODXA 3HUJE 4Z7UB 5ECJE 5H94B 1WITA 1SY6L 4W6WB 4XWGL 3RX5A 1N5YH 4GAJH 2AJVH 1P7HL 3W81A 4N9GA 2VZ3A 5CJXA 1CXKA 4ONFL 3VXNA 5C7XH 3O8XD 4FQQB 2ID5A 4XT1C 1GZQA 3MRCA 2VN4A 5IHUH 5IHZB 1KIUA 4TVPD 5DUPL 4D9QD 1CDJA 1JZ8A 4JO2L 3L1OL 2B2XL 4MAUH 1E4KA 2IH1A 2QSTA 2BCKB 1CBVH 1K9TA 1IGIL 4DEPB 1I1FB 2H32A 1BIIB 3PP3H 3MV7A 4Y1AB 3WN5B 2FR4B 1MHCB 5TE6L 5CUSH 1AR1D 1MF2L 4N1CA 3T09A 4YHNB 2X9WA 1X4YA 4OV5B 4PYGA 4RAHA 3BP5A 4Y2DD 2DKUA 4I18B 4X83A 1QA9B 4DZBA 1XFPA 3WD5H 4U6XA 4QRTB 3MA9L 4LCUA 3DPBA 1JI2A 2VAAA 4KRPC 3RGVB 2VABB 5IFHL 5F9JB 4LOUC 3BRFA 1J8HB 1DP0A 1X7QB 4NBXB 3D48R 2E7LC 3EO1B 1ND0A 4FN0A 2ZJSL 1FNLA 1N64H 3KVQA 2E27H 5IVXB 2AEPH 1I3GH 4U1NB 1I1AB 4NKIH 5GZND 3B3IA 3FN3A 4OZHF 2R1YA 3UTPD 5C07A 2NLJA 4WCYH 3NH7H 3FT2B 5JZ7C 2DI9A 3EDDA 3FB8B 3GHEH 1NBYA 2OR7A 3UTTD 2VZOA 1AO7E 1MPAH 2FO1A 1NGZB 2AAVA 5F89B 4FFZH 3ARED 5TQ2L 3VRLF 1KIQA 3MJ7B 1MCWM 1RUPH 4DN3H 2VR5A 2AVGA 3P30L 3BKYL 5BRZD 4DN4H 1K5NB 5MEQA 3TIDB 2FECL 2PW2A 3NZ8B 2WIMA 1G9NL 3HN3A 1G9NC 1CGWA 4ONHB 2G60H 2XWBB 4ZQKB 1UEYA 1JRHI 2I9TB 2CDGA 5CD3B 3WL9B 2AV7B 4NZTH 5C0FB 4Z7UF 4C56E 3CD4A 3UPRB 3VCLA 4E42A 2Y25A 4U33A 3CVHL 1J86A 1KENL 4D9RE 4ELKA 1T03H 2GT9A 4MDIB 3QRFM 1ITBB 5FYKE 4K71C 2HT4C 2E5EA 3VH8B 4NP4H 3MOQA 4YHZH 4MCZB 3IETA 3TZVA 2Z8WC 4RMRA 3R06B 3BO8A 2ADGB 3DURB 1I85C 1Q9WB 5SWZB 4XVUC 2XA3A 4P2OB 3P9LB 4F9LA 4P2QA 5F7EL 3TNNB 3QUYB 1SHMA 2QQNL 1G6RB 3NCJH 3RDTA 5EC2B 4MJ5B 3MLZL 3QA3B 1GHFH 4NN5C 5D9SB 1NGWB 1V7ML 1UZ8A 1J8HE 4PS4H 5GGTL 2O5YL 4I0PB 4EDWH 4ZS7H 4NYLB 3RJDA 1JNHA 1IC7H 3ILQC 2IPKB 3SDAC 3O3AB 5JORA 2IEPA 4ZAKC 1T89A 1CF8H 5DJCB 4CMMB 2JCCB 2UY7A 4NPYB 3MLYL 4D9LH 1K2DA 3VA6A 1NBZA 1DQJB 1E27B 4IOFC 4EI6B 5EB9A 5IQ7L 5IVXF 3D0LB 4BJLA 3KNBA 3M8OL 2VKWA 5CJQH 4UU9B 2ARJA 4OTXH 2GJ6A 4P23B 3V52H 2YPLB 5ADOH 3HE6C 1OL0A 5DI8B 4EI5A 3BGFB 4TUOA 1CLOH 4PTUA 3HNVH 1JK8B 4OLYL 4YXLH 3AROA 5TGBB 5AZ2L 5IP4A 5IJVB 4NQCA 4YIQA 3AS0A 1T04A 2QR0A 4HDIB 5IVZA 3K80A 4R97B 3KPOB 2WBJC 5ILTL 4YPJA 3OZ9H 3NFPB 4O58L 4YDJA 4ZO8A 4Y19D 4QHLB 4NO0D 2EIEA 3SQOH 1IM3B 5DR5H 2ADJA 3Q6FB 4HK0A 5LXGH 1BEYH 1I75A 1BFVH 1X5IA 3BDBA 3IDXH 1SM3H 4YDIH 4LLYA 5I73B 1YMMB 5JQHC 5CSGA 3IB4A 2CGRL 1YN7A 1T1ZB 3VXME 3P0GB 3TO4C 1A1MA 5C0EB 3EO0B 3JTTA 4WW2B 4ODWB 2B5IB 2VC2H 3P9MB 1I9JH 1QKZL 3PWJA 2VLJD 3L6FB 1SMOA 2H9GA 3BHBA 1U8QA 3EYUH 1EFXA 3O9WA 5CGYC 5T1DL 1W8OA 2WZPD 1N4XL 3CK0L 2WV3A 3EKCA 4JY4B 1A7OH 1XF2A 1TZIA 3F6LA 3FAXA 3JWDL 1NANI 3ZL4H 2VXSL 1X6NA 3RQ3A 1OSPL 4MSWA 4BFEA 2Q8AL 2D0HA 1YQVH 4GBXC 1B0RB 3A6OA 2R4RL 4FMFA 4GRLB 2GTZB 2JCCF 3QUKB 1DFBH 3P4MA 5BW7A 2YPLE 3MJ9A 4FQHB 5TDPB 4LSTH 4POUB 4D94A 2F54D 1JPTL 4PTTB 3MJ8A 1MQKH 2D31B 1MEXL 3CFDB 3TEUA 1U3HD 4S2SA 1AD9B 3KPRA 2CDFB 4UIMA 1TPXC 3MOBL 1SMAA 1OAZH 4WO4B 4LHJB 1MCLA 1RZGB 1I7ZB 4XC3L 3O2VH 4G8IB 1TJIH 3ARFD 5ISZB 1KCSL 5SWSD 3U83A 4Q9BA 2KQMA 1KB9J 5HDQH 3V4UH 1Q38A 3DGGB 2CXGA 4KTYA 4MA1B 4N5UA 5DD1H 4GW1A 4G80B 2DD8L 4OGAD 3VFUB 2V5YA 1S7VA 5T3XE 4XH2A 4P4KA 3TPKA 4P57A 3MO1A 5MI0B 3U7YL 1B9ZA 1JWSA 1HZHH 1NCTA 2DL2A 4ZO7A 3O6FB 5EZOL 2O61A 3QHFH 4WUUA 5FOJA 3O6LH 4FXLA 5LGHH 4XBEL 4PLNC 3HPJA 3Q3GB 3QIWC 4HIXH 5EU6B 3CAFA 4K9EC 1J5OL 1FNSL 32C2A 3VI4E 4OIBA 3KJ6L 1HHHA 5C92A 5CEZE 1BOGB 1GYAA 1UYWL 1FYTB 3QIUB 3C5JB 2ZCLL 2YA0A 4ODHH 4G7YH 4S1DD 3MBED 4PJCE 1ZHNB 3OPZL 4WW2F 1C5DB 2CO6B 2K9UA 1MCEA 4JANB 2EEAA 3ZKSD 2NX5A 1DDHB 3SDXE 1X5JA 2PYED 3TYFB 2F53D 3P0YL 4GKOA 4RFNC 4P3DB 4N0YL 4LHUA 1YPZA 2FATL 2MQ0A 5ICXA 1YEJH 2BNUB 3HC4L 4Y4HC 5IFJA 1VADB 4W68A 2E8ZA 1FL6B 3DYMA 3VXPB 5K9JH 4DQOH 4LPXA 1AXTL 2IPUG 1D9KC 4OCXH 1S5HA 3O6KH 3ESVF 2H45A 1IEAB 1FORL 4I4WB 4HWUA 3RWCB 3L3HA 5ISZE 1IC4H 1ZV5A 2NW3B 3OTTA 2L0DA 2DICA 3EJJX 5L2JA 1BGXL 5D1ZB 2MPAH 2A9NL 4JZJA 2L4OA 3ES6B 3WUZA 4HUWB 4KJWC 3ULVD 4G8FA 3FQNA 1E4WL 4KHTL 5JXAH 1BQHA 4JPIB 4WHDA 1GGTA 2RCSH 4O2CB 2FJFB 1JHTA 5ACMA 3VXUB 1RD6A 4JQXC 5IV2B 3SCMC 3QDJD 1QG3A 5L0QC 4ODSH 5E2VL 1W0VA 5C0IA 5L9DH 3KYNA 5EU6E 5I71B 4PRHA 5D71L 5EOCJ 5J1SC 1VGKB 1AXSA 1AD0B 5J1TC 3ZDXF 5I76A 2RJMA 3PXJA 2DTML 4XNYH 2GITA 4NGHH 3TP4A 2Z31B 3QJFB 4PJ9B 3BYYA 4XHJC 2EDBA 5GPRA 3IDNB 5JIKA 3EOAB 3W2DH 2N4IA 1RZIB 5DEZA 2ZCHL 3GNMH 4G9FD 2P24A 4N8VG 4P46D 1IBGL 4R90L 1D6EB 12E8L 3EOBB 2I60L 1DQMH 2NY1C 4JB9H 1A5FL 2XG5A 3EFFA 3VFWA 5B3JE 2ED7A 5DJXB 1BD2B 3HZYB 3QIBC 2GK0B 5FYJU 5DHXB 3PABA 3VFTA 4DK6A 4PJIB 2V7NB 4I2XE 4HMEA 3KR3L 2VZ1A 3EYOB 3F7VB 1JPGA 4HUNB 4LNVA 5T5NG 5I19H 1KB5A 4ZO6A 1OGAE 1A1NA 1C7TA 1FLTX 3DV6B 4LGSB 2XKSA 3JTSA 1MCIA 4HH8A 4R96A 4ZSOA 4YQXL 3U36B 5CILH 4U1JB 4P59H 1IGML 5ITBH 1Z9MA 4FZEH 1YEFL 4LFHD 4K3DH 3PHQA 5C0BD 3MLSH 3MRIB 4DFIA 1OQXA 4BQCA 3RL1B 4QTHB 1ZWIB 4LSQL 3RU8L 3KYKH 4KAQL 1ZLSL 1INDH 4KQ3L 5FFLA 1QFWL 3BZEB 2IPTH 3BD3A 2X4OA 3TCLA 3M1BB 1YUHA 3BXNA 1RHHA 1KLGB 3HG1D 4GLRI 3HAEH 4TN9A 5DGQA 5J12C 5E99L 2P1YA 4ODVL 5GGRY 4TOYL 5C2BH 4GQ9H 4NN6B 2X4UA 4HFWA 1P7KA 3VXRB 2CDEA 5FK9B 5DJAA 2FSEA 4ZTOH 3ALPA 2ERJC 3O3BB 3NAAH 1A21A 5KS9B 2J88L 2VXTH 4JG1H 1I7TA 2FWOB 1M71A 4GRWE 1FH5L 5TDNB 5GGUA 2YD8A 3ULUH 3C60B 3LZFL 4I77L 5D7SL 2BRQA 3MRJA 4PY8J 4OLUL 4I0KA 3SKNB 5DJ8A 4Y16B 3B9KC 3D39A 3O2WH 3H42L 2WANA 4OGXH 3FFCD 3TJEH 3LKPB 4XP6L 2WP3T 3I6LD 5C08D 4X4MA 3WNMA 1ORQB 3ZTNH 3G6AB 1KJVA 4HFUL 1PFCA 4LDEB 2QADC 1NBVH 1OY3B 2DIBA 4ONGH 1INQA 4GG8B 1VFAB 2OL3B 3IDYB 3RTQC 3MRMA 4X5LA 3BP6B 3WLWD 3RIFF 4IMLB 5FA3B 2DLTA 2A6IA 4PJHB 2R29H 3DYOA 1TVDA 3GZKA 4PJIF 5DRZB 2EKSA 5T1KD 4PBWD 5EORH 3GGWA 4ZYKA 1NGYA 1MAML 4V1DD 5A2JH 3HE7C 3F7RA 2A74A 1EHNA 1SEQH 1M7XA 4WFHE 4QT5A 4BUGA 4Y2DC 2R0KH 4IRSC 4M93C 3X11A 2W0LA 5D7KD 4PJ8D 3FB5B 2BMKB 4H25B 5DYOB 4QHMB 2C3WA 2VDOH 4LCIH 1JF1B 4W6YB 4Z7NF 1XF4B 3DBXB 4Z7QF 5FO9B 3SE3A 4LKXA 4OI7A 5I1JL 4UMGA 2NR6D 4JFED 2OR9H 2DLGA 1T20B 5JMOC 2VLRA 1X6LA 3HR5B 5JO5A 2XA8L 4KI5C 1REIA 1T7WA 3C87A 5E1AA 1T7VA 5EIVA 3V5KA 2DI8A 3QWOA 1AC0A 2R4SL 3QO0B 5KS9E 3H9ZA 4PB9H 3V5DB 3VRIA 1OWWA 1SEBB 1I4FA 2A2QT 3CXHJ 5HYJB 2JB6B 2PUQT 5DEGB 3WFCH 2H1PH 4R0LC 3EHBD 4KROD 3CX2A 3MRLB 5EZJA 4NC1C 1U58B 3QI9B 5BZDB 1ETZB 4DGIH 3J8F7 5EA0L 1LO3H 5CJOH 1OAYL 4OZIA 4I8DA 2ESVD 1T1XA 4XP9H 2M2DA 1A7QL 2E7CA 2KL6A 4PV8A 5D7JA 2ED9A 3TF7C 4YDLB 4P4RB 1J1PL 4M3KB 1D5IH 3ULSA 5HXMA 1AE6H 4PRNB 4OF5A 2VH5L 1F4XL 3SDCB 5E24E 3PL6B 3LQMA 4NZUH 5DDHA 3M17A 4PJHE 1NGPH 5DT1H 3D18A 1KOAA 4UTBH 5H2BA 3RNQB 3MCLH 1YNTB 5HHOD 2LV4A 5F6HJ 1Z9OA 2HVKA 5E2TH 2X6MA 5FGRA 1GOGA 1JF5A 1FG9C 2A1WH 4KRMB 5DUPH 3WHE1 4JO2H 4KRLB 2B2XH 2XZCL 3L5HA 5JIPA 4YR6B 4K7FA 5GS1B 5FUOH 1QYGL 4NBYB 3QQ9C 1SYSB 2CH8A 5DEFB 1IGIH 2FEEI 4F7MA 2APVA 2DI7A 4M5ZL 5TE6H 1AGEA 2P5EA 1LO2L 1V3KA 4NKMB 2C4FT 4FQIL 2P7TB 1A9EA 1ZT1A 1EAPA 4JN1L 1HE7A 1ZT4A 1CT8B 4H8WC 3MA9H 3DYPA 5D70L 9CGTA 1HXMA 1N8ZA 3H7BB 4BFIA 1EEQA 1OWRM 1YC8A 3RKDD 1EXUB 4HG4J 5D5MA 1MI5B 5IFHH 5T33H 2NYYC 2AEIT 5BS0E 4LPCA 3KXFB 4NKDB 1ZA6A 1R24B 1JV5B 2ZJSH 2D7TL 4I5BB 4XBPA 5TJWK 3RNKA 1KSRA 1UJ3B 4IM8A 4CVWA 3CJJA 3PWNA 5IB5B 5MENB 4LCYB 1EPFA 1QFUL 5HY9B 4QRQB 4YGVA 4IEFB 3C5ZD 1IQWL 5A16B 5TQ0H 4PGJA 2LU7A 3NPSB 1FN4B 3L9RB 5IGXL 1TVHB 4EOWL 4ZNEA 4CJ1A 1EEYB 5HYFA 2XG4A 5TQ2H 1NQBA 3ARBA 3OX8A 3BQUD 3EDFA 3BKYH 4J8RA 2HH0L 2QJDA 1J10A 3O2DA 3UTQB 4OCYL 1G9NH 2PXYD 2V5RA 3V6BR 4IIQC 3E1F1 4Q9RL 4KFZC 1SJHB 5AYUL 3PJSA 1EO8L 2UYLA 4C83B 4XPAH 4L8BA 3TA3D 1EMTL 2HT3C 1A1OB 4CVXB 1U2HA 1IGFL 2DQHL 1CLYL 5JW5A 4RA3A 3V6OC 3CVHH 4F3FA 1KENH 3BOVA 1FFOB 3KPMB 3L7FB 1CFBA 5CIPH 3FO9B 3WFHA 5F3BA 1JCKA 1R5IA 3L3GB 3WFDL 3WIFB 5J13C 1SBSH 4JN2A 5LAXA 1CYGA 3UJJL 3FT4A 4HT1L 1DTUA 1YEEL 4XRCA 4NO5A 1AGFB 3CSGA 5ETUA 5C8JB 3UMTA 5F7EH 3RVWD 4YDVB 2IG2H 1NBQA 1W72A 3PQYD 4M1DL 4W4OC 5CP7A 4L9LB 3G9AB 1V7MH 1GGYA 4OI9A 4R7NA 1H8NA 5GGTH 2O5YH 5JUEH 2OTUA 3KXFE 5FCUL 3RWDA 2DQEL 5CHNA 3ARVA 1CZ8H 4CNIB 4HV8B 1U3HC 1CGYA 1GGUA 4WHTB 2FDBP 3ARGD 1UADC 3SBWC 2FIKA 1AO7A 3MLYH 3MNWB 3MLVH 5HVWA 5GSRB 5C6PB 2P8LB 2R23A 4PLOB 1G7MB 4M61A 5IQ7H 4Y4KB 4G3YL 4N68A 5DF0A 3M8OH 3HZVA 4C4KT 1RULL 1XGYH 2NZ9D 1S9YB 4LEXL 2VWEC 4WFGE 4Z76B 4OGAC 1QSZA 2A6JB 3ROOB 1M7DB 1JGVH 4H20L 5CSZA 4U1SB 3VGAC 3S88L 2JIXB 4JKWA 4WWKD 1R5WA 4QRUB 4OLYH 1ZANL 1OAUL 1F5WA 5DUBB 5AZ2H 3O3DB 5D6DC 4JKMA 5IB2B 4C56A 4NZRL 3GSRA 3DI3B 3SJVE 4F7CB 5D7IF 5J3HD 2AV1B 4O58H 2GHWB 5DVKA 3GBNL 1U8OA 1C5CL 1CS6A 4Y8DC 1A6ZA 3N1FC 2Z8VC 1FFPA 3ROLB 5FA4A 1YEDA 5D93B 1JZ6A 5KSAA 1QSED 2GUOB 4MB5A 1WBXB 2I5YL 2MKLC 4O9HH 3QXDB 1NC2D 1IM9B 1WCQA 2CGRH 4HEME 4JRXD 1WF5A 5DRXB 4LCWB 1J8HA 5FKAA 4I3RL 1X7QA 3IU3A 3EO1A 1UM6L 1P6FA 43CAA 2J1KA 4EN3A 3HI6H 1QKZH 2OTWB 4HKBA 4FABL 1P84J 1G7JB 3R0MA 4HC1A 3H6JA 2OBGA 4HBCL 5T1DH 5H37H 4AT6B 4LVNC 2AGJH 4Q6IC 1RV6X 3FT2A 5TH2A 3G5YA 3V4PL 5E4IA 3W9DB 2NZIA 5IKCA 2AI0H 3FB8A 2VXSH 4L3EE 1CFQB 3MYJA 5F89A 1OSPH 4H26A 2YPKB 5ANMB 2Q8AH 1U0QA 2R4RH 4QNPF 2BVTA 3D2UB 4KMQA 1DVFB 4U7SA 1AQKL 5ITFA 4LLVA 3DIFB 3LD8B 3TIDA 1OM3H 3U48A 2YD1A 5DUML 4XVSL 4RGMB 1MEXH 4G42B 4O4YL 3ILPB 3ULVL 5DD6B 3DHMA 3RWJB 2NY6C 2F74B 3MOBH 3MR9A 4PRBB 3WFBH 3CLEH 5CD3A 1OTUD 1LP9A 2IAMB 1VKXB 4HUUB 3F58H 7FABL 2EZ0D 1KCSH 1OT2A 3MV8E 1R5VB 4NCC1 3RZCA 4MDIA 2FX8H 5GGSA 5L2KD 5JPMA 5DD0H 5IUSA 1DN0B 4JFHD 2DD8H 4GG6E 3SE9L 3MV7D 5DQ9A 2ADIA 1NUDA 4LBEB 4MNQB 4UV7L 4PGBB 3VFNB 5LBSL 3NGBC 3TNNA 3VXMA 2OOXB 4IS6B 4HXAL 5DJ2B 3TBVA 1MSPA 35C8L 5EC2A 3AXLA 2CIIB 4P46C 4XBEH 1TTFA 1YDPB 3T65A 3OKDA 2XQYK 4C4KO 4HIJA 4K9EH 3KPTA 1FNSH 2NY3D 2A77H 5IQ9A 4PJBB 2FNBA 2EKJA 5HI3D 4HZLA 2ZCLH 3PWPB 1S9WA 3QUZB 3JUZA 1MAKA 5HYQA 2KZ1B 1UWXK 2XFXB 4YNYA 3OPZH 5IF0B 5C07D 3ZKNC 5DFVD 2ZOLB 3NIFF 5D5MF 3ZHDA 5E5MB 1IC5L 3N9GH 2YPVL 1FVEB 4TNWK 3QFJE 4MX7A 5JTWA 4ZPVA 1KULA 3V7AG 1T0NA 3P0YH 4XB7A 5I8OL 1U36A 3I6KB 2XNAA 2FATH 4Z7OE 4JVUA 3G9VA 2IBBA 3L3OA 4JKKA 4WENB 3T1FA 3HC4H 5HBBA 3QDAA 3DVNB 4HWEL 2IBZY 4YHIB 5TDOB 1TNMA 3LKQA 4NRZA 4ZFOL 2CK0L 1YEGL 3I3DA 4JEGB 1YA5A 1FORH 1G7IA 4KKBD 3GO1H 4J1UB 4XPGL 3DMMB 4LIQL 3U2SB 4KVCH 2F8VA 4WVRA 4CU6A 3D3VE 3DROA 3Q6FA 1W0WA 1NKRA 1BGXH 1VACA 3N50A 5F9WB 4KPHL 2VYRE 2CK2A 4S1QL 4QYOA 4QRPE 1UKQA 5C1MB 3TZVD 3IKKA 4RGNB 4RQQA 4B7LA 3IS0X 2ED8A 1E4WH 4KHTH 4YPGA 1LNUA 3NABH 4M1GL 2LVEA 4P2QD 5C09B 4NQEB 4NO3B 4RMTA 2E3VA 1VFBA 3RDTD 1IL1A 3PG2A 4PUBL 3D85A 4NM8L 2VE6B 3DSNA 1V3MA 1S7RB 3GM8A 2G2RB 5D71H 5I8CB 1MHHB 3L6FA 1AJ7H 1N5AA 3R1GL 4G43B 2XTJB 3OF6A 5FEBA 5D4QA 1CD9B 3EYQC 4MVBD 2DTMH 4PJCA 1ZHKA 2OZ4H 2VERN 3VD7A 3T2QA 1MLCA 3O3EA 3WJJA 4KKLC 4ENED 3HCVB 3NCYS 3SDXA 4PLKD 4A6YL 4PJBF 1CGXA 4L3AA 2ZCHH 4KVNL 4R90H 3WLWC 1IBGH 1PEWA 4HIEA 1T4KA 4PRDB 1I8MA 2BSTB 2JKXA 1FO0A 1FL5A 1A5FH 2G5BA 3V5HA 3DVFA 1JFQL 4U1LA 1B6UA 2AERT 2GJ6D 3KHOA 7CGTA 3WLBA 3I2CH 1X4ZA 5F1NB 1OGTB 4JRYA 4EI5D 4Z9KB 3C09B 3A6BL 4OFKA 4OD1L 2D9QB 4NKQB 2PKDA 1IAOB 2DQIL 2C5DC 3KR3H 1NC4B 4XP1L 1F3RB 4NQCD 3HKFA 5DC9B 5K9KB 4J2XA 4J4PA 4U6VH 4G8IA 2WUBL 1WCBB 5HYSB 5J4MA 2QQKL 3CC5A 4BH7A 4YQXH 3IFNL 1TTUA 5JMRA 1X5HA 3QEGH 1IGMH 2NR6C 5T5FL 4JAMA 4UBDC 3VFOA 1MJ7L 1YEFH 2FEEL 5IR1A 5F6IC 4KUCD 3VU2A 3VD4A 3QDMA 1EIBA 5FYLH 1WIOA 3HAEB 1L9MA 1S9VB 5SV3A 3RU8H 3SE8H 3I84A 5JOFA 1PEZA 4Z5RB 4KQ3H 1KPUB 3HMXH 2VDRL 3ZDYE 1II4E 1NMBL 5KSBB 3GSWA 3G5XB 3FO2B 1CXFA 2ENYA 5EU6A 4MD0A 4XPHH 5C09E 1F8TH 5D7LB 4GS7B 4EEEA 1F3JB 1MCJA 3EHBC 4KROC 5E99H 4U31A 5ENWB 5HPMA 4ODVH 4TOYH 4Y2OA 1JN6A 4Z77B 1K8DB 3OHXB 3BE1L 1JTPA 3HZKB 1Z5LB 1QRKA 1EFXD 1AHWB 2BVQB 3MRGB 1ZHNA 2R1WB 1C5DA 4Z7WE 4WEMB 3SOBL 3VWJC 3BPLB 1PKOA 5IEKB 5EG6C 5EOQH 3UBXB 1FH5H 3WIHL 1GH7A 5HVHB 1DDHA 4FQCL 4G6AD 4PPTA 3H9HA 3WXVL 4RDQG 3CH1A 4GRMA 2JELL 3LZFH 3PWLA 4I77H 2H2PD 4AG4L 3TVMB 2RAMA 1XF3A 1MHEA 1NCNA 2HJKA 3MJGX 4I2XA 2ZG1A 2XWTB 4TYUA 3RHWK 1OGAA 4QRRA 1YJDL 3P4OB 3ARSA 4GKZB 1YJDC 3KPRD 1CFTB 3T77A 3N06B 4XXDB 2B20A 2R69L 2EYRB 1VSCA 4RMVA 5HHXH 1BF2A 1KUMA 3VJ6A 4HEPG 3REVA 3UZQA 2JE8A 3KPQB 3QQ3B 2Q6WB 1BVLB 1LVEA 4WUKL 4HSQA 1R3JA 3FB7A 3LRSA 5EO1A 1MAMH 2GCYB 1HHIB 4X7TB 1WISA 4P4KD 5HHMB 1LE9A 3OKMA 1LP9F 1QHOA 3O4LB 3T0WA 2DDQH 5EU5B 4JHZA 4K7PH 2HKFL 1Y18B 1JGLH 4LPTA 2VZVA 1CD1B 4UUJB 4WUUD 5IB4B 1B4RA 1RUKL 2BK8A 5D1QA 3IAQA 4JKPH 4ODTH 4AQ1B 4I13B 5F9DC 5I1JH 1AXIB 3P0VH 4PRPB 1HINH 4RAUA 4NC0B 1MJ8L 2XN9E 5KOVC 1HWGB 4Y5VC 5KSBF 3O4OB 4WU7A 3UPCA 2XA8H 4L29B 1ZVSB 1T22B 2VDLL 3B2VL 2EYTA 4R6UA 5C0AB 3G5ZB 4P2RA 2WQ8A 3GIZH 3UJIL 3ARDB 1UVQB 2ZUSA 3C5ZC 1BZ9A 5CBAA 4RBPK 1KJMB 1EEZA 3SGKA 5KOMC 2R2HA 2BHZA 2NX5D 1DBBL 3ULUF 4LPVA 4KY1H 3HI1B 4LHUD 2E9BA 1XF5B 2YWYA 4HKJB 3PWVB 4Q97A 4XP4L 3BQUC 1DSFL 2X70B 5DS8B 5EA0H 3G6JB 4MMXC 4QOKE 3F7VA 4GXUN 2DAVA 5FYJD 4DFHA 4N8PA 1A7QH 1WZ1L 5ACLA 1A6TB 3TH4T 3TA3C 1BFOA 4DOHB 3MUHL 4TSCH 3ZYOA 4JDTL 1J1PH 1NSNL 1MCSA 3O41B 3W0WA 4U1JA 4K8RD 3LS5H 5ESAA 4E41A 4NUGH 1F2QA 5E6IC 3ABZA 3P73B 4LSSL 3WN5C 2WUCL 1UH2A 5CINL 5MHSD 3JUYA 4GAYA 4OIAA 1QZ1A 2JB5L 2K3TA 4APQA 3GRWL 1A3RH 2W9EL 3BISA 3GKZA 4I3SL 5HHME 3MRBA 5CD5C 1YY9D 3O4LE 4JE4B 5L88L 2E7BA 2CLRA 4TSAH 1YEIH 4YFLF 3QUMH 5I8EB 1AGDA 4UT7L 2V7HB 4XAKE 4Z95L 1QYGH 1E28B 1JYVA 5DMGC 1BJMA 4PRHD 4KKCD 4OD3L 2NY4D 1KTLB 5FK9A 1HNGA 1AQDA 3O3BA 4U7MA 4M5ZH 1P7QA 4KRPB 3RFZC 1LO2H 1TCRA 3WEXA 1F6FB 4FQIH 5EIQA 1QO3B 2I24N 3OAZK 4JN1H 4ALAL 5JW4Q 4FOMA 4LLMA 4H8WH 3TYGH 5D70H 2BERA 2G75B 4RRPG 3PDDA 4QF1A 1QBML 2M8XA 5DC4B 4I9WE 1WT5A 2DM3A 4WI9A 2XTLA 4YWGL 3BIKA 2D7TH 1KELH 1H5BB 1AGBB 2VLME 4HUXA 1RUAH 2AXGB 3H9YA 2QKIB 1S7XB 1RK1A 1ORQA 2ITCB 4U1KA 1MWAH 3V7AE 1BQUA 5EIIA 1U8PB 2CUIA 5D72L 1QFUH 4QRSB 8FABA 1DQTA 5CEXA 4MD5A 3B9AA 4L8CA 3DUSB 3OL2A 1GZPB 4DOHE 4ERSL 2R0LL 1JL8A 4PJHA 5IGXH 4JFOA 4EOWH 3G6JF 5B38B 3MRPB 5GGRA 3S5LG 4X5XA 1JI1A 4OQTA 2HH0H 4R7DB 4OZ4B 2BFVL 4OCYH 1J1XL 3I85A 3CVHB 2Q7YA 1D5MB 5CIPB 4NWTL 4QHMA 4Q9RH 3B5HA 5AYUH 1EO8H 1ES0A 4H5SA 4K71B 1AIFA 2DQFB 2FZ3B 3RVTD 3MGOA 1XF4A 3DBXA 3LEYL 1X9QA 3L3IA 1IGFH 2NY5C 1C08B 1TVBB 4YHPA 2AEQL 2DQHH 1JMZA 1CLYH 2P44B 4I0PC 1BREA 4RNRA 4BFBD 3HR5A 3OKOB 1MNUH 5IVOA 3MLWL 3WFDH 2DWDB 1U8KB 1BX2A 4JFFB 2AJYL 3GMMA 3EW3B 1NJ9B 3P40A 4NN5B 3UJJH 1DEEA 3S35L 2VDPL 5KAQF 1NAML 1FNHA 3IXTB 3HNSL 2D03H 4FQPA 3SDAB 2EDLA 1FZMA 3RUGA 4ZAKB 3ZMRA 5BS0A 4JQIL 3MRLA 4M48L 3FOLA 2OS7A 1LQSR 4PJ5A 4UIKL 3OR7B 3DO7B 4S1SL 3EJYC 2AXFB 4F7TB 3GJFH 5GRJL 3REWB 1CK0H 2C1OB 5EUKB 3D39D 5FCUH 4RIRB 4PJAB 2DQEH 3FL7A 3K8MA 2VXQL 3NZHL 3BZDA 5BCAA 3CSYB 1XGRB 2PN5A 1F6AA 2FBJL 5CJXC 1FIEA 1MH5A 1T21B 3HE6B 1T2JA 5C0GB 1N3NB 4R97C 4XPBH 4UAOC 4KDWA 3K4AA 5EBWA 4JJHA 4G3YH 3PL6A 3FHAA 2EDRA 3V6FA 1NUGA 5GS3A 3GI8L 4LEXH 3L3DB 4OF7A 4F57L 5HHQA 2LQRA 1TNNA 4L9DA 5DWUL 4YUEL 1F11B 4H20H 4K3GA 3S88H 2QQQA 5D1XA 5ALCH 2BNRB 1ZANH 4RBPH 1RVFL 1TITA 5GGVL 3F62A 2Y5TB 3AGVA 3GUTA 5GS1A 2A0LD 4LHQB 3VFSA 2NY3C 4K23H 1N0XH 3OAUL 5ICZB 1C5CH 1ZMYA 1P69B 2Q20A 3B2UD 2X4QA 5HI3C 3CXDH 4LVHC 1F4AA 3MNVA 2VLRD 1JPFB 3TO4B 5F7NC 4DW2L 3CFCL 2H26B 2ORBL 4BZ1L 5I1CH 4NFBA 3S36L 3VFVA 4YFDB 1QP1A 3MFGB 3I6GB 5B39G 2NNAB 3C8HA 3G5VA 5IMKB 3SPVA 4YX2L 3OKEB 1EXUA 3KPSE 2ICEA 3H3BC 3JV4B 5GQBA 5M95B 4MNGB 3VMOA 4HWBA 4HKXA 2Z91B 1ZTXL 5HHPB 5TFSH 4RWYL 1KG0A 4OLEA 5IK3A 1UM6H 3MQIA 1K3IA 1CXEA 4N8VA 3CFIC 5D2NA 1QLEL 1Y0LB 1UACL 1UJ3A 3NTCH 1P5VA 3BIBX 5F7MC 4WNQA 2OQJB 1KJ2H 4UILH 5BVPH 1I8KA 4G8EA 4KKAD 4HBCH 3EZ8A 1A6UL 1XGTA 2BVPB 4MJ6B 3RA7H 3O11A 3PNWA 5I1HL 1E0OB 1B0GA 4ZFZB 5D7JD 4NKOB 4KJYA 5MEOB 1TVHA 3AU1A 4PJAF 3MLRL 4JGJA 5AEAA 4TNVK 3EDJA 4PGEA 5E1HB 1TPXB 4MWFA 4LLUA 1AQKH 1NGQL 4LPWA 1QPXA 1NLDH 3OKLB 3PDOB 4MJ2A 2Q1EA 4PRAB 1JF6A 5DUMH 5MI0C 1ADQA 2X1WL 4PJFB 5E8EB 3TESA 3STZA 3T3MF 2BNRE 2GSGA 3SJVA 3QH3A 5E8PA 3U0PB 3T4YA 4R4NC 4F9LC 5T3ZD 4UQ2A 4CVXA 3V4VL 4ORGB 2RR3A 1QRNA 1HI6A 1IGJA 1GGBL 1LD9A 1MJJA 4DKEL 4ZUUA 1H8OA 3L7FA 4UDTB 2PTUA 1LK3L 1J12A 3K4DA 4JM2A 3WIFA 4LSVH 1NEZG 4WV1A 3G6DL 4MVBC 2X5PA 1A7NL 1T89C 1PJ9A 2P5ED 1EEUA 4RZCA 3QCTL 3KYAA 1FGNH 4UV7H 5J11B 4HF5H 3DXAB 4ENEC 1XIWB 2VITA 3DSFL 3T2PA 4H1LA 2IQAA 35C8H 1JGUH 5CAYB 4JFZL 4KXZI 4Y5YA 4CJ0A 3KDMA 5IM7A 5HYEA 4N1EA 3UAJC 4L8DB 2YC1B 2JJVA 5I1EH 4PGDA 2B39A 4EI5C 5FGCB 1J88A 3OKKB 1I7RB 4WHTA 5DK0A 3DV4A 1U92B 4L3EA 5DHYB 4RFNB 2FIRT 3VGEA 2AXJA 3QHZH 1T5XA 3P9WB 2P8LA 4BH8A 4AQOA 5E2WH 4Y4KA 1H15B 1IC5H 5JW3L 1IKNA 2JJSA 3SDYH 5E4EC 4KTDL 2F15A 3ZTJG 1LEGB 1RJLA 5EBMB 1KEML 3QULA 2IADA 2YD2A 5I8OH 1D9KB 4LLQB 3LEVL 4X0KB 3IAPA 3TBTB 1WFTA 3VXSB 3ARBD 1NH6A 5FECB 1P4LA 2I9LB 5ACZA 1BF8A 3S5LB 4HWEH 4PJFE 4KQ4L 3GMOA 2D3VA 1UCTA 1EZVY 4FXGB 5AUMB 2AJ3A 4L3CB 2CK0H 3FMGL 5I1LA 3MV8A 1YEGH 1A6PA 1LDPL 3X12B 1Q9LB 4E0RA 4KJPD 1VESA 5H8DA 5B22A 5INDA 4GG6A 4XPGH 2EC8A 3BGAA 4LIQH 4ZS6D 3WO4C 1QNZH 3SCMB 3GSXB 1N6UA 4KPHH 5JOPD 1ITCA 3BYTA 3O9WC 1R3KB 3KYOB 4HBQA 5IT2L 5ESQB 4BSWB 3BEVB 3N1GC 3DX7A 4M1GH 5DRXA 5A2LH 3DUUA 3Q0HA 2X4TA 2PO6B 3MLTA 1G84A 1K6QH 3CCHB 3WS3B 3N1PC 1JZ7A 4LNRA 1BZ7A 1WZKA 2BHUA 2E6PA 3BT2L 2F8XC 5HD8D 3UTTA 5E8NB 2HG5B 1JVKA 3MJ9L 1A4JB 2VLKB 5BW7C 2GFBB 3L3KB 3JV6A 5E8OB 3AREA 2DKMA 5IMMB 2Y6SD 4OGYL 4LLDB 4PJXB 3VFMB 1DLHA 1RK0B 5EU7C 1J05B 3RUGF 4HX1A 4ZD3L 1CFQA 1AO7D 3QIBB 5EUOB 3QFJA 4UV4L 5HDOA 3G04A 4WI4A 4KVNH 3QCUH 5BXFA 3GMNB 4BKLB 3DIFA 1RU9L 4M1CC 4ESKA 2AJZA 1HXYA 4G42A 4ZUSB 1JWUB 4MJIB 3BUTA 4OD1H 2F74A 4AH2B 2DQIH 2VUOA 5F3HB 1JHLH 4XP1H 4PGCB 4F37F 3DX8A 4ZOAA 3ZYJA 5C0DB 1VKXA 4HPOL 2YBRB 4C56D 2WUBH 5AWNL 2QQKH 3KLAA 1BQLH 1AR2A 3D3VA 4D9RD 3IFNH 5K9OA 2BSSB 1KNOA 4QRPA 1OB1B 1TQCC 1CDGA 1Q9KB 5AD0A 1UKSA 3U79A 4FXKB 2IF7A 5I2IB 3QWRA 3KPNA 3RY5A 1G7QB 4PGBA 5J12B 4P49A 4LVOC 2Z0BA 1BBJA 1GL4B 3VI3E 5BVJA 3FT3A 3UTSB 2CIKB 4NQVA 2BOBB 1F58H 3O0RL 3RGVD 1NCWH 5KANG 1B2WL 1J8HD 2ERJB 3QZWA 1C5BH 3ZE0E 4V2BA 4Y16C 3LKNB 4EN3D 4HK3J 5B4MC 2W1NA 3F12B 2VLKE 4D8PA 3BE1H 1I1AD 3NOIA 5FYJL 4IRJC 4MXWL 3LQZB 1QVOB 5I15L 1RUML 3BGMB 2ICES 3CVIH 2DQJL 1UZ6F 1WBZB 3SY0B 4M6AA 5EUOE 3MCKA 4HIHB 5CBEB 4FQCH 1UCBH 3GBML 4K8RL 3WXVH 2EE3A 4K8RC 2Y9RT 4K2UL 4PJXF 2DL9A 2X1PA 3C08H 3Q5TA 5F7DB 3KYMA 1O7SA 2OP4L 5EUOF 3RWHB 1ONQB 3RTQB 4JZJC 3ZE2F 3L5IA 1F4HA 2D7NA 3SGDI 1IEHA 2QLVB 1KB9K 4LASL 4J3SA 1YJDH 4NJ9H 3TN0A 1XCQA 2XY2A 3RPIA 1U91B 1EO7A 3FAWA 5MEPB 1CI5A 3DNKA 2HN7B 4O2EA 2A38A 2FH6A 3MRQB 5JHLL 2K7PA 5EU4B 4KK9C 5FCSH 5KSUB 4ZPTA 1AP2B 2UZIL 2AK4E 1Q1JL 4Y2DB 5FYLE 3D9AH 4IRSB 4M93B 4KKCC 3RZCD 3W39A 4WUKH 4HJ0D 2X4SA 4NBZB 3T0VA 4GW5A 4MA8L 2E8YA 1UH3A 1GIGL 2X4PB 1P2CB 3K74B 4IJ3B 5KW9L 4QHNB 3C8DA 5EDXA 4GFTB 1JUFB 4TRPL 5DJZA 1FYHB 1K4CA 5C09A 3VXMD 3QEHB 3OSKA 4XNQB 1RUKH 3BDYH 2UZXB 4P2YA 1S7RA 3NPZB 4AENA 1IGTA 1CG9B 4X6CE 2BVEA 4G43A 3BUYA 3QI9C 4P5TA 2IANB 3MACL 2F5BL 3UO1L 4Z7WA 1FNGB 1TETH 3MUGA 2BRRL 1LEKB 2W38A 1FCCA 2VDLH 4R0LB 4XWOC 5JR1L 1S8DA 3V0WH 4UQ3B 3B2VH 1KB5L 1U41A 3UJIH 3HMWL 3SDCC 2BSTA 2E7MA 3H3PH 3QXAA 3IFOB 2YPLD 2J6EH 3MOAH 4ELME 2P48B 5DRWA 2ZCKL 3TIEA 4XP4H 4N90E 1MRFL 1DSFH 1MIML 5JA8B 3BEWA 1L6XA 4FTVE 4D9QE 3OB0H 4KZDL 4P9HL 5DO2C 4P9HC 4M43L 1GGCH 1KTDA 1WZ1H 4U1MB 3NCBB 1S7SA 1HSAB 1F00I 5HPOA 1A6AA 3RVTC 2LABA 2IBZX 4JDTH 4TULL 2YEZA 1ZHLA 1NSNH 5C0RL 5IOPB 3FOMA 1OP5K 1MREL 2FGWL 4JJ5B 4BQ8A 2VNCA 1RZFL 2ZG3A 3JXAA 1FVDA 2B1HL 4LSSH 4YDKL 4RFEB 5T3XD 2WUCH 5CINH 3F5WA 1F45A 4JLRA 4XCNA 3FB6B 4EVNA 4G6JL 5ERWB 2JB5H 4BK4A