2QLVB

Crystal structure of the heterotrimer core of the s. cerevisiae ampk homolog snf1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
252
structure length
155
Chain Sequence
SLMVPVEIRWQQGGSKVYVTGSFTKWRKMIGLIPDSDNNGSFHVKLRLLPGTHRFRFIVDNELRVSDFLPTATDQMGNFVNYIEVRQTTDIPAVFTDPSVMERYYYTLDRPPQLPPQHVVLNHLVTSSIKHNTLCVASIVRYKQKYVTQILYTPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/protein binding
molecule keywords Carbon catabolite derepressing protein kinase
publication title Crystal structure of the heterotrimer core of Saccharomyces cerevisiae AMPK homologue SNF1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 21
structure length 155
sequence length 252
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04739 AMPKBI 5'-AMP-activated protein kinase beta subunit, interaction domain
B PF16561 AMPK1_CBM Glycogen recognition site of AMP-activated protein kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.290 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2qlvB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2qlvB01
1I1AC 3ROLA 1NAKH 4JPWH 4LKXA 4UV4L 3U83A 3S4SB 1JV5B 1KOAA 4XWOD 3NCBB 3HLAA 1JWMA 3SDYH 1FP5A 4OFIA 1MCJA 2OR9H 1D6VL 5ICYB 4P9HC 3DURA 4D9QD 2J8UF 4WWKC 2HFEA 4N1CA 1TZGL 5A2JH 2ADJA 4PBXA 4HIHA 4NN5B 3VGEA 3I02A 2F19L 4R97B 4FA8A 1A8JH 1JNHA 3ZKNC 3QIUA 5SWZB 5MP6L 2D9QB 4P59H 5ADPH 4WW1B 3CVIL 3TN0C 3G5XA 4LP5A 1KYOJ 5I1KL 1QLRB 1U95B 2J5LB 4XP1H 3T1FB 5DA4A 5CEZD 2FR4A 1JCKA 1A21A 3KAAA 5E2TH 3HRZA 3PP3H 3S37X 5BV7C 1LEIB 3WNOA 3VXPB 1NGPL 1YN7A 4JR9H 1LDPH 1R3LB 4P9MH 3RAJH 4F7PA 3IDIB 3QEQE 3KPQA 2NLJB 5J1SC 5DO2C 1IKFL 3RVVD 4OD1H 1FNHA 3RDTB 3ZKMC 2Y36H 5GGUA 4XP5L 4OQTL 2DWEB 1FLTX 4FHBD 1EXUA 3BP6B 1A5FL 4PYHA 1G9MH 3MBEC 3FB6B 5GRZA 4L4TD 4G8FA 1EGJA 1F8TL 4M9OA 3VE0A 1SJVA 4NBZB 4B50A 3IDMB 1ZVHA 1T2XA 1DBAL 3TPUA 3SDDD 4XVJH 1UXSB 2VH5H 2AV7B 3M8OH 4KRPB 2DM3A 2N7BA 1CDIA 5F44A 2AXFA 4C59B 5LCVH 3REWB 1HQRB 2B5IB 4FFWC 4PJXB 4ODHL 4PV8B 4JFYA 4MS8C 4JAMA 5JQ6H 3H6JA 2QKIA 4ZO9A 3HG1A 3TIEA 4HUMB 3KYNB 1NL0L 4YC2C 5F6HJ 3GSWB 3QNYA 1MHEB 3MACH 2MKLC 5CJBA 1ORSA 4QRPE 5EU4B 2CLZB 4R7NB 4ORZC 2VN4A 1OB1A 5HJ3B 5DSCA 5T3XD 1ACZA 5J6HA 1AP2A 2Z35B 2YN5A 1RK1A 1OTTD 3JXAA 4H8WC 1MCPH 1EO8L 5J89A 1YNKL 3AS3A 3WMSA 4Y1AD 2PR4H 4HKXB 1JE6A 1I7RB 3KDMA 3VGDA 3DV6A 4Z9KB 3HUJB 3CDGA 3G5VA 1RHHA 3FCTA 4YDVA 1AJ7L 4P46C 4EN3D 3AFLA 3MLYH 3QYCA 2IH3A 3LAFA 1EMTL 4PJ9D 5IFAH 4KV5F 1FORH 2GUOB 4IIQC 4WCYL 5MHSE 5GGVL 2FSEA 1S9XA 3VG9C 1NAMA 3ARFA 4JGUA 3EO0B 5ANMB 2H9GA 4RGNC 1EA9C 3W39B 3DYOA 2Z8SA 1YMHA 5DUBA 3VFNB 4NOBA 4LEOB 5B39B 2AQ3A 1CGYA 1PG7L 2OP4L 4KKAC 3V5KA 2DQEL 1OAKH 3MV9B 4YH6A 4AT6A 3EDDA 3PWVA 4MZ2A 4OKVA 4LMQE 4PJ8B 2OZ4H 4Y7MA 5GGTA 5GGVY 3T77B 1G7HA 4X83A 4N0CD 4QTHB 3ROOB 5TE6H 5EG6C 5GS0L 4GSDH 5J1AA 1NGQH 3Q48A 3CH1B 3PWUB 4Z7NF 1OAQH 1WFTA 3RGHA 5DJAB 5DD0L 1F4HA 1IAIL 2B4CC 4ZAKD 2EYTB 3OKYA 3OGOE 2VDPL 3VRLE 4DGVH 1NMBH 4PLOB 5IVXA 2I5YH 3MBXL 3P11H 3AY4C 3ROLB 3RTQA 1T7XA 3BN9C 2IQAA 5I75B 1ZA3B 4LKXB 5FCUH 5C0EA 1OPGH 2BJML 1DBBL 3HLAB 1EBAA 1JWMB 1ADQH 2YUZA 1Z2KA 3QFDA 2JJTC 3QAZC 4DKFH 2EIBA 4GOSA 3DURB 2DQIL 2HFEB 2VDQL 1AFVL 2B2XH 1LE9B 1IAKA 2ADJB 3X3FL 1K6QL 4HIHB 3I02B 1WTLA 3T2NH 1JNHB 4NQXA 3V6OC 5E4EC 3QIUB 3SQBA 5I30L 5C08A 1U3HC 3G5XB 1HIML 5IM7A 4RGNE 2HAZA 5FM8A 2FR4B 5DMYA 4YEEA 1HYSD 4X5WA 3HNTL 3IT8D 3HPLA 4MJID 4WI5A 2UY6A 3HRZB 5F6HI 3B9AA 4L9LC 3IJSA 2MSPA 4NQDE 1ODAA 1YN7B 4O4YL 1LEKA 4TSBL 5C0RL 2KZ1B 1BZ9A 1JYNA 4F7PB 2DD8H 2ZCLL 2Z0BA 4OBRA 2NXYC 3KPQB 3VD5A 1ZLSH 4LKCA 2AK1H 5CSBA 3H2WA 2FIRT 1M4KA 3O4LE 1EHAA 1I1AD 3P0GB 3U82B 1MCOH 2FYYA 3WIFA 5GGUB 4KUCD 1PKQA 1K4DA 3FQUA 4LVNB 1ND0A 1BJ1J 4G8FB 2XY2A 3VE0B 4LNRA 2OQJA 1KCVH 1QO3A 4K9EH 3TPUB 2PYED 1RI8A 5HYEA 4WWKD 4Q9BA 1QBML 4OJFH 4OZGE 4IJ3C 4JKPL 4CN6A 3ZKND 1U8JA 5HVFB 4ZNCD 2LU7A 4HFUH 3QCUH 4JFYB 2JJUA 4JAMB 3V6OE 1KCKA 4KZDH 3KGRA 3TIEB 1BD2A 2QKIB 3TN0D 1BM3H 1Y6NR 2HT3C 5BRZA 3QNYB 2H32H 3GJFK 1ORSB 5HI5C 3PIQA 4OF0A 3BW9A 5BJTA 5HY9A 2C4XA 1OB1B 3K4DA 1FGVH 1IFHH 4RMQA 5DSCB 1RIVL 5J6HB 2FEEL 1AP2B 1FL5A 1KYOK 3U7AA 5DFVC 1RK1B 5K9OA 1UADC 4KK5C 2DOCA 1Z3GL 3NN8B 4K8RH 3KDMB 1U6AL 3DV6B 4PJIA 3CDGB 3IF1A 2Z92A 1H8NA 3G5VB 1RHHB 2VNCA 4YDVB 5DO2D 43CAA 4Z78A 5T33L 3X11A 1D7FA 4PJ7F 2IH3B 3ZKMD 3QDAA 2NMSA 4MDJA 3BDYL 5F1NA 3WNKA 3MBED 2FSEB 3C08L 1S9XB 5ILTH 5IR1A 1NAMB 3ARFB 4L5FH 1OAYH 1Q0YH 4FZEH 2H9GB 5IBUG 4PJFF 2CKBA 1CR9L 1YMHB 5DUBB 1T2QH 4PRIA 2F5AL 2WLYA 1KEGH 3V5KB 4I0KA 4Y5YA 4FFWD 3PWVB 1DQMH 4OKVB 3QT2A 5H37G 1G7HB 4MS8D 4ERSL 35C8L 1ZS8A 3H3KA 5J1AB 4I77L 2VZVA 2XPGA 4X6BA 5D2LE 1FVDA 1IAMA 2YSSA 4OI7A 4JFQA 1K3IA 5F3HA 4PRHE 4DUVA 4Y4KA 1I9RL 1QFPA 4ZD3H 1XF2A 1MI5A 1S3KH 2J3SA 1BBJA 3SGDI 12E8L 4XHJD 5IVXB 1LP9A 2OR7A 3S36H 3CD4A 3MRFA 3BP5A 3WO4B 3ARWA 3QXUA 1G9NC 4UI2A 4GT7A 5M94B 4C56A 2EEDA 3FT4A 4RAUA 4P46D 3QFDB 5I1HL 4YJZL 3OF6A 4LPTA 4GAGL 3DVNA 2CLRA 3QWQB 1IAKB 3L1OH 2P1YA 4NQXB 2BHZA 3T0VA 4E42A 4JQIH 5ISZA 4RFOH 3BRDA 4RGND 5LQBL 4LBEA 5CJOH 5C08B 3SEPA 1CDBA 1MQ8A 3BPOC 5A2KH 5HYFA 4Z8FL 4KKAD 1I3RA 1W0YT 4HULB 1H3PH 1MSPA 2DKSA 2EDOA 4J3OC 4Z7WF 2H41A 3HPLB 5DQDL 2X4TA 3PL6C 2NPLX 3IJSB 3NAAL 1JUFA 1MY5A 3BKYH 1LEKB 2K9UA 4ZOAA 5CZKA 1K3ZA 4U1KA 1BZ9B 3MRKA 2VDLL 4I3GA 1A4JA 1UJ3C 2A9NH 4LKCB 3O4LD 1NLDH 5CUSH 4DN4H 3G6DH 2WP3O 1MWAH 4Y4HC 2IANA 2FYYB 3BN9D 4XPFL 3N1FC 3WIFB 1PKQB 1K4DB 3FQUB 4K94C 4XBGA 1ZTXH 2I07A 1ND0B 2A1WL 1N8ZA 4U31A 4LNRB 4DZBA 1TJIL 2OQJB 4NWTL 1QO3B 3BPCA 4YNYA 3UTQA 5A1AA 3MZTA 5L0QB 4KJPC 3B43A 1UVQA 32C2A 1WICA 3V8OA 4FQXA 3T08A 1R24A 1N7ML 2ICWJ 3CU1A 3D18A 1U8JB 1R3KA 4K3JH 1PYWB 1UKSA 4Y5XC 2A6JA 2ZUTA 3WNPA 1BD2B 1NC2A 1U3HD 5CKAA 5D7LA 3I3EA 4KI5F 5BRZB 2BFVL 3UO1H 3UDWC 4R7DA 3PIQB 3BW9B 5BJTB 3QULA 5HY9B 4AIXA 3O6KH 4FTVA 5F3BA 3PGFH 4HG4J 4XP4L 1F97A 3VXRE 1KTLA 1BPVA 1AO7B 3C6SA 3B2VL 3CK0L 3HZKA 4FZ8H 5K9OB 4R90H 4H20L 5F96H 5FHBH 3FZUC 5DR5L 4G8IA 1A7NL 4HMCA 1JF1A 4U1GC 4GS7B 2NXYD 2ATPA 1T0MA 4LSQH 4PJIB 3IF1B 2Z92B 3BIAX 3REVA 3PWNA 4Z78B 43CAB 3CX2A 3X11B 1RUQH 5I8OH 4AL8H 4LSUL 4Z6AT 4IEFB 4P2RE 3ZE0F 5T3ZH 4JQVC 4J4PA 4MDJB 3P9LA 5IIEA 4HPYH 5F1NB 1MFAH 2B7DT 3NIDE 5IR1B 2GT9A 1EEQA 1IGCL 4C4KT 4NC2B 2WLZA 4AMKL 1J1XL 2AQ1A 5I6XB 1S7SA 4Z18A 4KKLD 4OIAA 4RRPG 1YYMH 2CKBB 3LKQA 5CIPA 2NY7H 3GSOA 4PRIB 5IMOA 4UNUA 5EWIL 2VITA 5JDSA 4IRSB 3HC3H 4Y5YB 2FX9L 3I9GH 3OXRA 3KLSA 4HCRL 3PWPA 1EFXD 3IFLH 4OLZL 2Z8RA 3MQIA 1ZS8B 4XP9L 2HT3D 3GIVA 2F15A 4G3YH 4X6BB 2XPGB 1U8HA 5HI5D 4PRHD 1FVDB 3GBML 4JO4H 3JWDC 4JFQB 5F3HB 3BWUC 4Y4KB 5H2BA 5ETUA 1MFBH 1XF2B 1MI5B 1ZLVH 5J8OA 2C3HA 3D3VB 4R0LC 5DFVD 1BBJB 4JO3L 1LP9B 3UROR 4KK5D 1KXVC 2X5PA 4KGJA 3MRFB 4YUEL 5L9DH 3WJLA 3M45A 4GRWE 4UT6L 1FBIL 3B5HA 1RUML 1BMGA 3HZYA 4C56B 1FO0A 4Z77A 2XXCB 1N3NA 2A9MH 3FT4B 4RAUB 2NR6C 1AXSA 1F13A 1X4XA 5ESAA 3LKOA 1CGSL 2IFFH 1MJJA 5BOZG 3I6LE 2CLRB 2KKQA 3QWRA 4MXVE 4HWBL 3V0VA 1FG2A 3FQRB 5ISZB 1VCAA 2J2ZA 5E95B 4LBEB 5I15H 4HX1A 1MJ8L 4KDTC 5GQBA 4K3DL 1RIHH 1I3RB 5HHXL 1B0WA 1YC7A 5AYQA 3OJVC 3KVQA 5I1JH 1JGDA 4J2XA 3WS6C 1JUFB 1J8HD 5C0FA 5IJKC 5IOPB 1FLRH 4U1KB 1MRDH 1Z9MA 3MRKB 2VLJE 3BPLB 4XAWL 3KPLA 1A4JB 1UFUA 4PD4J 4EI5C 1S7VA 5T5NG 4HK3N 3AS2A 4W70A 4M5ZL 4LEXL 5E8DH 3MRJA 5TE7L 4G9FA 1TVDA 2G75A 2IANB 2NY6B 3QPXH 4ONHA 4MXWH 4XBGB 2I07B 3L6FA 4Y2DA 5LAXA 4PJGA 4M7KL 1V05A 1N8ZB 4LL9A 4DZBB 4DGYH 4PLNC 3BPCB 3BKCL 3TO4A 4YNYB 3QXWA 3UTQB 3QIBC 1UVQB 4L3EA 32C2B 4U7MA 1ZT4A 4FQXB 4D2NA 4PJDF 2NX5E 4M1GH 5HPMA 1OP9A 1R24B 4JANA 3D18B 1UM5H 5FGSA 1R3KB 3L3IA 4BQ6A 2A6JB 4KY1H 4OLUL 4EDWH 1NC2B 4WGWB 2JB5L 5D7LB 5D8JH 2HYMA 4R7DB 4FQJL 4HMDA 1J0IA 4OCNC 3QULB 3VXRD 4AH2A 4BJLA 1FDLL 5F3BB 4FTVB 4NO0B 5KAQG 3WFCH 1KTLB 3RY6C 3SE4C 1CL7I 4MMXC 4WI8A 3PL6D 4P4KA 3C6SB 2WV3A 2XI9A 2YOCA 4GBXC 3CX5J 3HZKB 1HXYA 3MRMA 1NMCB 3PV6A 5KSBE 4WTZA 3EDKA 1JZ3A 3MA9H 1OTSC 1VA9A 4HKZA 5I9QB 5E7BA 1JF1B 1QSEA 4HUXA 2ATPB 1T0MB 3BDXA 5CWSA 4P2RD 3PWNB 4NO3A 1IGYA 4APQC 2AS5M 3K4ZA 2YEZA 4B41A 4Y4HD 3P9LB 4F57L 2BVTA 2XN9A 5FYKL 5IIEB 3K8LA 4CMHB 4XVTL 5B4MC 3SKOA 5EZJA 5H8DA 1LO4H 2GT9B 5LGHL 4YHIA 2H3NA 1V7ML 2D03H 3I84A 1S7SB 5ID1B 1JHKL 3EFDL 4KJPD 3LKQB 1XCTA 5CIPB 3MLRL 3GSOB 3GKWH 5IMOB 2VITB 5JDSB 3VD3A 1KCLA 4X4YA 3OXRB 3PWPB 3UMTA 1KSRA 3VFTA 4PFEA 3RVTC 4YBQC 4U3HA 3GIVB 3NPZB 5C07D 3QZWA 1U8HB 4KTYA 2QL1A 4U1HB 4KC3B 3LEVH 1G7PA 3LQZA 1MFDH 3BOVA 2FECI 1I9EA 2BXZA 1FAIH 3EYVA 3GIZH 2HWZH 5H2BB 5JXEA 3IXTA 5ETUB 2NY2B 1LVEA 1OGTA 5ERWA 1IC4H 1KG0A 3WIHL 5BW7C 2D0GA 3FZUD 4RA0C 2DAVA 1VFAA 1HZHH 2QQKH 3X14A 3QDME 1MJ7H 5KOVC 3HZYB 2RBLA 2UYLA 1FO0B 3KYKH 4Z77B 1VFMA 1NSNL 3X3GL 3I6LD 1AXSB 5ESAB 3J8F7 4URTB 4W4OA 3RY5A 1MJJB 3FQTA 4BK5A 4ACPA 1F2XK 5MI0C 4MNQA 4W4NA 3CXDL 3MNWB 2FCBA 3NA9L 2Z31A 3O2VL 5T5NF 5AZEL 3VMNA 3V0VB 1P4LA 1FG2B 1HCFX 1U8MA 4KI5E 5KS9F 5GGQH 3TIDA 4HX1B 4XCCL 1JFQL 4WHTA 3NCYS 4AYFA 2FD6L 1F4YL 3MA7A 4JKMA 4EUPH 5HVHB 2NYYC 3U79A 2VLJD 5C0FB 3MV7A 5EUOE 4WIQA 3CVHA 3H9SB 3KPLB 2BK8A 3KXFE 5D7SL 4GG6E 1S7VB 1BVZA 4XPGL 5F21B 4RWYH 5E1HB 3DGGA 3MRJB 4G9FB 2G75B 5E99L 4KXZH 3IS1X 2P49B 4ONHB 5EU6E 4U1IA 4Y2DB 3L6FB 5F8RC 3MFFA 5LAXB 4PJGB 5C09A 2BOBA 2ICEA 4NRYA 2H6PA 2NR6D 5BXFA 3TO4B 1R3HA 2EEAA 2NX5D 5I19H 1LK3H 1ZT4B 1GIGL 5HPMB 5L7XL 4LVOB 4RFNC 4F7CA 1CLOL 1YEFL 2JE8A 5J11B 3L3IB 5AZ2H 4JZJA 2DQFA 3TNMA 3S34H 5DTFA 3TCXA 1GGIH 3K74B 3QCVH 1K8IA 4AH2B 2W38A 4UV7L 4G8GD 2HH0L 1XGYL 5I0ZA 1RFDH 4P4KB 4KRMB 1HXYB 1NCCL 3MRMB 3PV6B 4U1LA 1XZ0A 1FFNA 1MAML 1JHLL 1SM3H 1IC1A 1K4CA 4HKZB 1AI1H 3ETBF 1AR2A 1QSEB 4EDXA 1L0XA 4HUXB 2VXTL 3S35H 4EI5D 5CWSB 3TVMC 5IHBA 4NO3B 1IGYB 4PJBE 4YHKH 4M48L 3ZDXE 1O0VA 4JY6A 3KPMA 1JP5A 2YEZB 1RQ5A 3BQUA 5JXAH 1KIQA 2XN9B 5IROC 2IGFH 3P2TA 3SKOB 3EO1A 5EZJB 3WNNA 5D93B 3QRFM 4WY7H 3V4UL 4YHIB 2H3NB 1PKOA 3RFZC 3IETA 5C2BH 2LAGB 2OLDA 1CFTA 7FABH 3QIBD 2XZCH 2BNUA 4YK4B 3C6LC 5EH1A 4FFYH 1P84J 1VDGA 4A6YH 1OAZL 2F9BT 4X4YB 4GAYA 4M6NL 1NMAL 3VFTB 3OAZK 2DDQL 3QI9A 1DZBA 3QXTA 5DMKA 1QR4A 3QZWB 4ODVH 4WI6A 1QFWI 2P47B 1CU4L 2P45B 1G7PB 4Y19D 3LQZB 3EYVB 3RJDA 5I1CH 3CLEH 1HINH 3CSGA 3IXTB 1E6JH 1OGTB 2DMCA 4X5LA 1BQUA 5ERWB 4GBXD 4RGMC 1CD0A 4ZTOH 3EDEA 3IJHA 1KG0B 3QJFA 2X05A 3QDMD 4Z7UE 1OTSD 3BIBX 1VFAB 3QUYA 1GHFL 3X14B 5IG7B 4A2LA 2YWYA 1F4WH 2UYLB 3BGFC 3CX5K 1MCBA 4PJ5D 4APQD 5FYKE 3VI3E 3S97C 5CILH 3UZQA 1TFHA 1KPVA 2F5BL 4OQ1A 1AC0A 4F9PC 2ENYA 4GMTL 4MNQB 2EH8L 3H3PH 4YHML 4HJJL 3RP1A 1GL4B 5B4MD 5T1LA 3TBSA 5E8PB 4NN7B 2Z31B 4PJAE 4S10A 3V0WH 3STLA 1JPST 4LK4A 1P4LB 3KPTA 1U8MB 2AJSH 4JJ5A 3TIDB 4CJ0A 2O61A 4KDVA 3Q6GH 3ZYIA 4N9GA 4WHTB 5KJRL 2EKSA 3TH4T 2ADFH 4OFYA 1OLLA 3B9KA 5HGHA 2NY3C 2WQ8A 5I76A 4O58L 1IKNA 3QQ3A 1A6PA 3MA7B 2C26A 3K80A 3WXWL 3DYMA 3GRWH 5DFWH 3NABL 4YBQD 3RVTD 3VRIA 3MV7B 2XQYG 1JGVL 1MCFA 3FOMA 4QY8B 3KXFD 3CVHB 3U9PL 2XTJB 4TN9A 1H3VA 1CFQA 4YZFE 1RZKH 3PXHA 2J88L 4U1JA 5J0BA 1FGNH 4O9HL 1TPXC 3NTCL 1OL0A 2IMMA 4PRPA 2AK4E 4UAOC 3DGGB 3RL2A 1DVFC 3TH2T 2GHWB 5SV4A 3WNMA 2YRLA 1RSFA 2VZ1A 4U1IB 5F1KC 1C7SA 1YEEH 3RBSA 3MFFB 3S3PA 5IJVA 5C09B 1FNSH 2BOBB 2BNQE 2LQRA 2ICEB 3R8BB 4NRYB 2H6PB 2HFTA 5DURD 5BXFB 2ZUSA 4GG8A 1R3HB 1LNUA 3EDFA 1KIPA 4HXBH 4OT1H 1WWAX 4X6FA 15C8L 4F7CB 3UYRL 4JM2F 4JZJB 5IMMA 1J87A 3NBNA 4YAQA 2DQFB 1MHHA 3TNMB 1FZOA 4WUUA 1F00I 4NN6B 5DTFB 1QRNA 3KJ6L 1IGJA 1YPZF 1AQKL 5A16A 1QSZA 1GPOL 5K9QI 1K8IB 1NLBL 4ZOBA 1PX4A 1P7QA 3RWCA 3H9ZA 5C6PB 4CN1A 2AI0H 1DUYA 4AG4H 2HKFL 1G9MC 2NYYD 1H3TA 2ZG3A 1I1RA 1OM3H 4U1LB 1XZ0B 1FFNB 5EU7C 5JDJA 4HGMA 5K9QG 3O0RL 1TENA 2O5XH 4J1UB 5T1MA 4EDXB 7CGTA 2DIJA 1TQBC 4XC3L 3MXWL 3QJHA 4I1NB 3MLZL 2K7QA 5FUOH 3N50A 3SOBH 1F3RB 4XP6L 1JPGA 4JY6B 3KPMB 3BQUB 3GB7A 1KELH 1KIQB 2X70A 3G04A 4M02A 1IVLA 1F45A 4UT7L 3EO1B 3QUKA 1OWWA 1BREA 4YDIH 3ULVH 1A7RL 2ARWA 2VB5A 3P30L 3MC0A 3OPZL 2NY0B 3IETB 2EXWC 3DLQR 1B2WL 3V9FA 2XXMB 1IILE 4R4BA 3SKNA 1A6UH 2BNUB 2C9AA 3OR7B 5TFSH 2R2HA 2NXZC 5SX4H 2F54E 3THML 3V6ZA 3VDCA 2GJ6A 1S8DA 4KK6C 4GAYB 1PLGH 2HP4A 1T1ZB 4HHAA 2DQUH 2DM7A 4YHOH 3NFSL 3QI9B 2F53A 5DMKB 1YC8A 2O5YH 3QSKB 3GHBL 2P42B 1MFNA 4P0DA 1XGRA 2Q8AH 4M93C 3RNQA 3O9WA 3KNBA 2VMFA 3U7WH 3TYGL 5C6TH 3SDXE 3IJHB 3QJFB 1UC6A 2JJSC 3O8XC 3QUYB 5FHAL 3EOTL 5K9JL 4EOWL 3RA7H 4Z7QF 3TVMD 5JA8B 4Q9RH 2OL3A 5D5ME 1X9QA 3IDGA 4G6JH 4LLYA 1KPVB 4ZO7A 2WUCL 3DBXA 3MUHL 4MX7A 5CFHA 3HMXH 1E6OL 4ENEC 1F2QA 3D9AL 5T1LB 3TBSB 4LQ1A 3TBVA 1CDYA 3STLB 1QFUH 2NY4B 4FP8L 4OLYH 4MSWA 4OCYH 4JJ5B 5F9WC 2O61B 3ARRA 3P3YA 1K8DA 4NM4H 4J6RH 3B5TA 5E5MA 4N9GB 3HE6A 4M62H 2XY1A 3C6LD 1AIFA 2EKSB 2A73A 3B9KB 2DLGA 1PFCA 5HGHB 2QLVB 5I76B 3RHWF 3QQ3B 3ZYZA 5DUMH 4XNYL 4FFZL 4Q7DA 1L7TL 1P84K 3HRPA 3VRIB 2FEEI 4X80L 5IGXH 3BPNC 3FOMB 1X44A 4NWUH 1GXEA 2YPLA 4Q6IA 1CFQB 2AK4D 2QQQA 4U1JB 3BUTA 3TT3H 3MX0A 4PRPB 3RUGF 5J13C 3RL2B 4G6KL 5C0AE 4WW2F 5DD3L 2D7QA 3J7HA 5IW1A 1MCHA 4NZDA 2VQTA 5IJVB 3GGWA 1D5XB 1DQJA 5IESH 2CMRH 3IS0X 3ZZ1A 1BQHA 4GG8B 1JI1A 1TJGL 1LNUB 5C7XH 2FB4H 3QO0A 1QD0A 4NUGH 3W9EB 1KIPB 1AGCA 2PXYA 4X6FB 5FO9A 4JRXD 1RZ7H 4XPAL 5IMMB 2YXMA 5DWUH 3C60A 4YAQB 2WWKT 1MHHB 1FZOB 2E3VA 2E9IA 1QRNB 1IGJB 4QXUL 1RZJL 4FABH 4YHPB 2NY3D 3WL9A 1P7QB 1IEBA 4NN5C 4KVNL 1DUYB 4DVRH 3O6ML 3LIZH 4R97C 4OZIF 3V4VL 4BZ1L 4R4FH 4C83A 4BFBD 3LH2H 1RK0A 4U0RB 4Y8AA 1KJ2H 4R4NC 2BNRE 4Z7VE 2APVA 4LIQL 3E8UL 5T1MB 4OZHA 1U58B 3QJHB 4EJ1C 2J5LC 1J8KA 4O2CA 1JPGB 3B83A 4L4VD 4WFFE 1T2JA 1YY9C 1DVFD 3GB7B 4Z0BH 3GJFH 2X70B 1RJLA 3G04B 3D0VA 3CMOL 5JW4R 3QUKB 3O2WL 1CFVH 3VXME 2W0LA 1BP3B 3QDJD 3VWKA 3M07A 1BX2A 4ONGH 5FK9A 4WI4A 4R4BB 3SKNB 4X9GA 5L2KD 4EQ2A 4JHWH 3LHPH 5ALCH 2A2QT 3RDTC 2R2HB 3D1MC 5L8LB 2JTDA 3V6ZB 1C16B 2GJ6B 1NCWL 3GMRA 5EN2A 2ZUYA 5DUPL 2W07A 3TA3A 4HHAB 1FNFA 2UWEF 3OJDB 2F53B 1ZGLA 2C4FU 4L8SB 4TVPH 3D39A 3F65A 4HPOL 4MQSB 3HI5H 3GSVA 1EGJL 5KANI 1XGRB 3RNQB 2OYPA 4BQBA 3O9WB 2B5IC 3GBNL 3S88H 1KN2L 4U05A 3KNBB 1MRCL 3PXJA 3GEWB 1A47A 2ERJB 3FJTA 4K3EH 5SWZE 1U8KA 5KANG 1J05A 2A74A 4M1CC 3ESVF 3UJJL 4MA1B 2OL3B 1IL1A 1QLFA 4KMLB 4LLYB 5BO1H 2CUIA 3WKML 4M5YL 3DBXB 4HF5H 1T7ZA 1QZ1A 3MLXH 5D6DA 3TBVB 4KJQC 3V8CA 4QOKA 4MSWB 2EXWD 1N0XL 1PZUB 3SE9L 1K8DB 5E5MB 3HE6B 1AIFB 2A73B 2NXZD 5AWNL 2AJ3A 2BVQA 4LCWE 1VHPA 3DWTA 2W91A 4QRQA 1TQCB 3EAKA 3GKZA 4KK6D 3VFGH 4XBPA 3MZGB 3O2DH 5BVPL 3LKSA 4WFGE 2G2RA 3TO2A 2YPLB 4I0CC 4Q6IB 4U49A 1X6LA 1WBYA 4K7PL 4AZ8A 1HXMA 3GDBA 4PJ8C 4KHTH 5K59F 3IXAA 1BF2A 1YECH 5DJ0A 5EOCL 2VDRL 3O8XD 2YMXL 1PVHA 1OGAD 1MIEH 5HHMB 1EJOL 3UTZA 5IW1B 4JO2L 4NPYA 3GGWB 1C1EH 1DQJB 4S11A 1WAAF 1BQHB 4QRUA 4TULL 4K7PY 1JTPA 1MFCH 2Q20A 3DV4A 4V2BA 3QO0B 4ENED 3D85A 2VWEC 1XMWA 1AGCB 3QQNA 2PXYB 4XB8A 3BD4A 5D7JA 5FO9B 5I75C 4PJEF 3CGTA 4OCXL 4KAQL 3ZO0A 3IFNH 4DN3H 2KDGA 4FQ2H 3SGJA 3C60B 4QRPA 4BSJA 3HUJE 1WLHA 3SO3B 4M6MH 4OB5L 4F58H 3PGDA 4IS6A 1IEBB 3V7AE 5D71H 4D9LL 4C83B 4CU6A 3QIUC 1RK0B 1KN4L 1NCBH 4YWGL 1F6LL 4UBDC 4BZ2L 4BELD 2J8OA 2EDYA 4UIKH 5BS0E 5ANME 1AD0A 3QUXA 4EZMA 1RZFL 1ZT7A 3HNSH 1W72A 1DBMH 4OZHB 5DMIL 4WFFD 1WWBX 3INUL 1L0QA 5HHVL 4LFHD 4ESKA 2XZQH 5JUEH 4WTXA 1X5XA 3MV9E 1L9NA 5MEQA 2EE2A 5LXGL 1J11A 3D0VB 5C0BA 1WIPA 1MRFL 1VB9A 1NCDL 4OLXH 5CCKH 3VWKB 1BX2B 5GRUH 3SKJL 3V6BR 1JN6A 2GY7B 2UZIH 1P7HL 2BERA 2VKXA 2D3VA 4X99A 2ICWB 1VFUA 4DZ8A 4GXVL 4OM1H 2WAHA 4LVNC 3GMRB 5EN2B 4BQCA 1HWHB 1M05A 1T4KA 3C09B 3SGDH 2R4SH 2CJUL 3TA3B 3ARGA 1SHMA 4KROB 1DDHA 1ZGLB 1WBXA 2Y5TA 3D39B 4Y8DC 1CZ8H 4N8CH 5C0CB 4JPVH 1HNFA 5HDOA 2CKNA 3GSVB 4CRPA 3FKUS 1CTOA 3RUGE 5SWZD 3UPCA 4LIQE 2XZAH 1YZZA 3U36A 1BJ1H 4R4ND 1U8KB 3MYJA 4HBCL 3L5IA 2A74B 2IG2L 1RMFL 4ZPVA 1KBGL 5JW4M 1IL1B 1YY9D 4RGOH 3BEVA 1BFOA 5MERB 1KJMA 3DYPA 3JV4A 3L3JA 1QEWA 3KYMA 3NPSB 3WFEH 3SJVE 5JO5B 5JOEA 1FRGH 4QOKB 3UJIH 3KR3H 4YXKH 3WUWB 2V7NA 4P57A 1DFBH 4XPBL 3RDTD 1PY4A 4UDTA 3U30B 5JHLL 2AJ3B 2BVQB 5F9AC 4QRQB 3BMWA 4NQDA 2PYFA 4I13B 4XMPL 2HFGH 4ZFGL 4XBPB 5K33A 3ARFC 1J86A 3LKSB 3QEQB 3DPBA 1FH5H 3D25A 2QREB 3BSZL 3EDJA 3U1SH 2G2RB 3QUMH 4KUZL 3TO2B 4JDTH 1QBAA 3GO1L 5DD5L 1WBYB 4H0IA 2OL3H 5EOTA 3IXAB 4JB9H 2BHYA 2CKBL 4U3CA 5DJ0B 2VQUA 3BX7C 2AABH 4G80A 5TF0A 5GJSL 3OXSA 3UTZB 2P43B 4M7ZC 2IPUG 4NPYB 4M1CD 3HG1E 5TPWH 3DI2B 5CLWA 2ZG2A 4QRUB 5E08H 2VXSH 4OZGA 1V5JA 4JE4B 3DV4B 4S2SA 1GOGA 1LO5A 3D85B 1MCCA 5CEZH 5DEFA 3WO4C 5D7JB 4KJQD 5TF1L 1CGUA 1FZJA 4QRPB 4UINH 5LWYH 1X5KA 2MCPH 3MCLL 1TTUA 2HVJA 1A7QH 2RIKA 3PGDB 4IS6B 3OZ9H 3CUPA 1ZHKA 5KSUA 3SHSA 4KQ4H 1CXKA 1KEMH 1MHPH 5JR1H 3ZTNH 5DGRA 4HH9A 1GZPA 1AD0B 3QUXB 4Q6YA 1ZT7B 3IAQA 1W72B 4S1DC 4OLVH 2J8UA 2VYRE 4LLVA 1XCQA 4PJ8D 3GSNL 4JN2A 3UTOA 1HHHA 4BQ9A 1WJ3A 4CVUA 5MEQB 1N4XL 1DBJH 1O7VA 3KYOA 4AEIL 2FWOA 1R5WA 3NA4A 1JPFA 2VAJA 5C0BB 2BRRL 3HNVH 4XX1E 5FYLL 4DK6A 3LS4H 4XCEA 3TT1L 4L29A 2H1PH 1CLYH 4X99B 2BY2A 3SGEI 5KVFL 4DZ8B 2F58H 3LKRA 5IVXE 5KSVA 5T3XH 5F7DA 3T3ME 1M05B 1T4KB 2FO4A 1QNZL 5I18L 3EKCA 5E6IA 3ARGB 4UOJA 3RKDC 3WDJA 3EJZC 3LB6C 1DDHB 4OFKA 1WBXB 1DLFH 5L0QC 1CFNB 3TDHB 1CBVH 1YMMA 3UJTL 5I8KH 5IBTL 4ZFOA 5I1IL 4NJAL 3QIUD 1BIHA 1GOFA 4UBDD 4X8JA 2DLFH 3U36B 4JM4L 3Q5TA 4FQQA 3T2PA 1N64L 4YR6A 3VD4A 5DK2A 5DT1L 5C08E 4ZPVB 4NGHL 1WAAE 4Z7OE 3NZHL 3NIFF 2EYSA 4XNUH 4ZNEA 2RFXA 3BEVB 1BFOB 1KJMB 4YDKH 3JV4B 1N26A 1NJ9A 3L3JB 1QEWB 2EICA 5FFLA 3KYMB 4CDHA 2J7LA 4OCRL 5HYJA 2VABA 5M95B 4GS7C 2R39A 4V1DA 3C2AL 1F02I 3C5SA 5H35A 1RULH 2E6QA 4HWNA 6FABL 3T4YA 4UZGA 2V7NB 4P57B 3IU4L 1BZ7A 4UDTB 2WBKA 1XR9A 3EYOA 3RWEA 2IBBA 3BVNA 3FB5A 4NQDB 2J4WH 2PYFB 1PKQE 5IQ7H 2YR3A 2RQ8A 4HJ0C 2MQ0A 5TGBA 1OHQA 3PP4H 5EZIL 5I6XC 2HKHH 3D25B 2QSQA 3CFCL 3RIFF 5KZCB 1MEXH 4R8WL 1SMAA 1T66C 4NQCA 2HRLA 4IRSC 5EOTB 4Y5YC 3L5XH 3DTXA 2NW3A 3TZVA 2VDNH 4OSUL 4G80B 5CP3H 1F4XL 3OXSB 3GSXA 4XT1C 1BD2E 3P4NA 4JPKL 3UC0H 5BRZE 1MREH 1Z9SA 3R0NA 1ZHNA 4Y4KC 2DQHL 4OZGB 3OQ3B 4WHCA 4S2SB 4HQQL 1LO5B 2OK0L 1CT8A 4HIJA 5DEFB 3RX7A 4LHUG 5ADOH 5FGRA 1LQSR 1CL7H 1PY9A 5HDBF 3SQOH 1YY8A 1CIUA 3DHMA 1FZJB 2AJUH 1ES0A 1RURL 2IEPA 1TCRA 5E8OA 4PJIE 2G60L 2R0LL 4K2UH 2HVJB 3F58H 4KRNA 5CMAA 4U6VH 1C8PA 2WBJA 5IEHB 3ARYA 3CUPB 4LCIH 1ZHKB 2JB6A 5KSUB 3ARFD 4LRIA 3SCMA 3HPJA 1OY3B 1YNLL 4HH9B 5DD1L 1GZPB 1KJVA 4QRTA 4HK3J 2J8UB 1KC5L 4LLVB 1XCQB 1N6QL 3B3IA 4LDOB 4PRIE 4OGZA 3LKNA 4JPIB 4JN2B 4P9HH 4CADA 1HHHB 3VWJA 3KYOB 2QHLA 2FWOB 1R5WB 2FZ3A 1JPFB 2X44D 4LLAA 1JK8A 3L3HA 1ZT1A 3BPLC 1H8SA 3UZVB 5FUZH 1OD9A 4NDMA 4XCEB 1JZ2A 4L29B 4TNVF 4JCMA 1CF8H 4YHLL 3O6FA 3GI9H 5AG9A 2NY6C 3LKRB 4HXAH 3WLBA 3U4EA 4YE4L 3FO1A 5KSVB 1LP9E 3S96A 2ZKHL 4GQ9H 2E7LA 4R2GB 5HTSA 4RAHA 5BV7H 2FO4B 4GW4A 4QXTA 5D2LB 3MJ9A 2DI7A 1QQDA 3MMEB 5E6IB 1VGEL 4N0YL 3LRGA 5DK3A 3F6IA 1XF5A 2EO9A 3EOBB 4TQEH 2CK0H 3MRPA 1YMMB 3ZT6A 4FQXC 4QTIH 1IMHC 3BZDA 3DIFA 3M17A 4PJCF 2XICA 3RWHB 4X8JB 4HSQA 4KPHH 5C08D 4GKOA 5ISZE 3RU8H 4FQQB 1MLBA 4S1DD 5E56A 3AU1A 5DK2B 2VDMH 3TWCL 1XGTA 4JKKA 2R29H 1DBKH 1N6VA 4XNXH 2RFXB 3R4DA 1QP1A 4JCLA 1NMCC 5FYLE 1NJ9B 1NAKL 2PTTA 3FO9A 4JPWL 5I9QC 1CGTA 3O11A 5HYJB 1J5OH 2VABB 4ZODA 4LFHG 2G5BA 1GYAA 4V1DB 1KFAH 3C5SB 5H35B 3EIFA 3SN6N 3T4YB 3JSSA 1BZ7B 1XR9B 4J4PC 5D1QA 1SY6H 4NKIH 2YUVA 3RWEB 4KHXL 3BVNB 4CMHC 3FB5B 3S5LG 2PF6A 3G6JF 5TGBB 2V7HA 3FRPG 3RKDD 3EJZD 3LB6D 1OW0A 3R06A 1BBDH 3C5ZA 4CGTA 4WGVB 1UQSA 4HZLA 1U41A 5EOQL 1DR9A 4PJ7A 1HI6A 3S4SG 5GSVA 1JZ5A 4NQCB 5EO9A 4XP1L 4GKNA 3IDUA 4LSRH 3DTXB 2NW3B 4LLDA 3HFML 3TZVB 2N1KA 1BD2D 3UX9B 5BRZD 1VADA 4HBQA 3F7VA 3GSXB 5CP7A 4PJFA 4JR9L 3P4NB 2XQBH 3RAJL 5GGSY 3TCLA 4QNPF 4OBSA 1ZHNB 4WO4A 1UZ6F 2A6DA 3UAJC 4YX2H 4NKMB 5LGJA 1AO7D 2LV4A 4PJHF 5FM5M 1CT8B 1D5IH 4HIJB 5KVMC 4FXKB 4ETQA 1GGYA 3WJLC 5CHNA 4DKEH 4RISH 2E8ZA 1YY8B 1OT2A 5E9DE 1ES0B 1TCRB 5E8OB 1G1CA 1XIWA 5I16A 3RVXC 2VH5L 3M8OL 5E4IA 2B4CH 5CMAB 4D94A 1G6RH 5KW9L 3IDXH 1J0KA 2WBJB 3FQXA 2N56A 2JB6B 4HJ0D 3SCMB 1AE6H 4HUWA 3SDCA 4GQPH 1G7QA 1YJDL 1WSST 4JFFE 3UTSE 1E4WH 2LTQB 1AC6A 3AUVA 3MACL 1KJVB 4PRID 4QRTB 2CGRH 1T66D 1SYVA 4O00A 3CCHA 4IRSD 3B3IB 3LKNB 1IQDA 4CADB 4UTAL 3VWJB 1YEDB 5DJ6A 5HVHC 2FZ3B 3PWPE 4JGJA 1MCPL 1JK8B 3L3HB 1ZT1B 3GK8H 3PHOA 2PR4L 1FZMA 3JWNC 4Y4KD 4LPYA 5GRVL 1MI5D 1PDKA 2Y06H 1QFWH 2PCPA 3D3VD 3O6FB 4Z7WA 2PNDA 4UT9L 4ZG1A 5IFAL 1B9ZA 3VXSD 2I26N 3I2CH 5F9JB 1UWGH 1FORL 3U4EB 3FO1B 4Y2DC 3S96B 1U8LA 1KB9J 5JW3H 4HK0A 3EYUL 4GW4B 4JZNA 4C56D 4QXTB 1QQDB 1IKFH 4XI5C 5C86A 3ZT5A 2V9RA 1SJXA 3TO4C 3OF6D 5IMLB 1IGML 1XF5B 1UG9A 4XP5H 4OQTH 5FA4A 4S1RL 2DQJL 3GMNA 1A5FH 2XA8H 1CD8A 4Q9CA 4WHDA 3DIFB 3LZFL 2EEBA 3MODH 3M17B 1OAKL 5J11C 5ISZD 3ARSA 2OZ4L 5C6WH 4OGAC 1Q9OA 4GSDL 1NGQL 1MLBB 3AU1B 4M3JA 4PTTA 5ECJE 2P8PA 1OAQL 4LSSH 1XGTB 2FBOJ 3FMGL 5FYLD 4P4KC 4DGVL 1IEHA 2I5YL 5B39G 1S9YA 1U92A 3RBGA 3MNZA 2PTTB 3FO9B 3O11B 2X1PA 5FCUL 1NUGA 1B6UA 4WFHE 2G5BB 3ARXA 5EULV 4HCRA 5C3TA 1EO8H 1BQLL 2IAND 2NY6D 4JFHE 4K3GA 2W59A 4WENB 2B2XL 4G9FE 4DKAA 5HHNB 2VLKA 5D93C 3MUY1 1AJ7H 2V7HB 5CS7A 1S5IL 4PJGE 3R06B 3SO5A 3C5ZB 5ABDE 3P4MA 4HZLB 4JRYA 1C5BH 1HI6B 4PJ7B 4YK4C 5GSVB 3T0XA 3BHBA 5GGVH 4FQXD 4LVHB 5EOCJ 4ELMF 3LDBB 5EO9B 5JIPA 4GKNB 4LF3A 4L3EE 1U8QA 4LLDB 2BDNL 2YA2A 1NC2D 4LAQH 1VESA 5D7LD 1VADB 3F7VB 5CP7B 4PJFB 4V2CB 1W8OA 1PG7H 2OP4H 1UWXK 2DQEH 3FTGA 4U33A 2DD8L 1DE4A 4LSVL 4FTVD 3TCLB 3WD5L 3QUZA 4NO0D 4MAYA 2A6DB 4EQ3A 5JXEC 1ZLSL 5LGJB 3CAFA 2AK1L 1OTUC 1QFHA 1QPXA 2AJXH 3ARBA 1LO2L 3WFHA 4AQ1B 1MCOL 4ETQB 4POZC 1ZWIA 2ATKA 4WRLA 5CHNB 5DD0H 3JWOC 4FS0A 4OCLC 5IP4A 5BZDA 4ZTPH 1XIWB 3MBXH 4K9EL 4W4OC 5I16B 4U1NA 4J4PD 1YJDC 5F7NC 2R9HC 4NC1C 4Z95H 3VGFA 1KTDA 3FQXB 2BJMH 1MNUH 2XN9E 2Z31C 4JFZL 4NN7C 3DRQA 2ZOLA 4JVWA 5F88A 4DAGH 3SDCB 4HUWB 1G7QB 2YS4A 3UBXA 4HFUL 1LILA 4PG9A 5DRNA 1G9NH 2DQIH 2VDQH 1BM3L 4XAKE 3X3FH 2YK1L 1K6QH 4ONFL 1SYVB 3BO8A 4I2XA 3CCHB 3CZFA 1L0YA 1FGVL 1IQDB 2G5RA 3L3KA 1U8PA 5I30H 5J9PA 3PWPD 5HVWA 1DUZA 5DJ6B 1CI5A 3NCFB 3CNKA 4E9LA 5BQ7A 2NY1B 3PHOB 4K8RL 5KG9A 2XTJC 2AXGA 1FZMB 3HNTH 3UAJD 3ULUL 4YXHH 2PCPB 4Z7WB 4NJ9L 1T80A 2ED9A 2CK2A 4KVCH 5LBSL 2OMNA 4BH7A 4MHHG 1U8LB 4HK0B 4JZNB 3E3QE 3MRBA 4L5FL 3VXUA 1OAYL 1Q0YL 1IGFL 3RVXD 4G42A 4RMTA 3PQYA 5FA4B 4AQOA 3GMNB 3QWRD 4XPTL 3QH3A 1T22A 5I1DA 1KEGL 1KJ3L 3IRZA 1DQML 1WC7A 1CTNA 5CSGA 3X13A 5D1XA 4HEME 3WS3A 4PY8J 3L3OA 1Q9OB 4BZYA 2ZCKL 2IBZY 4E41E 4NN6C 4DW2H 5I1EL 3CLFL 3OAYK 4PTTB 2P8PB 1KIRA 4PJDA 4Q9QH 3DXAA 2CUMA 4NRZA 2CDEA 1EPFA 1S3KL 1S9YB 3S36L 1BOGA 1U92B 4WFHD 3MNZB 5TE4L 3BGMA 1Y0LA 1HN1A 1UXWA 3K7UA 5CINH 2OI9B 3DRTB 3GI8L 1WT5A 2VIRA 3H9SD 3MV7E 5C0IA 2XTJE 2EC8A 1NGZA 3TH3T 3OAUL 4K3HA 4G9FD 3BQUC 1Q9KA 1Z3GH 5FKPA 2A6KA 1J0JA 4Y2DD 1U6AH 3L1OL 4LLUA 2VLKB 3MOAL 5EIQA 4WEBL 3WE6A 3QXVA 3MGTA 5FV1L 4GRWH 43C9A 4XI5D 4JQIL 2NY0C 1ZANL 3AC0A 5D1ZB 3TO4D 1KB9K 3P4MB 3WIHA 4JRYB 3BDYH 1B4RA 3BHBB 2X7LA 3IKKA 3C08H 4DOHB 3MJ7A 4LF3B 5DS8A 1RJYA 1U8QB 5EU6B 3GBLA 3RI5K 1Z5LB 1LO3L 4OGAD 2BNQA 3QI9C 3BKYL 4NHCL 3OKNA 4XVSL 3FTGB 3V2AR 1DE4B 4IOFC 3QUZB 1FAKT 4MAYB 4H1LH 4B7IA 3NFPA 1NLDL 4P4KD 35C8H 2NTFA 4HJGA 3ARBB 3G6DL 4I77H 1MWAL 4KDWA 3WFHB 1F42A 3QUYC 3E6HA 1ZWIB 2ATKB 1QSED 1LE5B 1F6AA 5BZDB 3QEUA 3K3QA 1FVCA 3DUSA 3JWDH 4PJ9A 3CDYA 4D0CA 3LQAL 4ODSH 1KTDB 3WXVL 4FQIH 2NY4C 2ZOLB 3DRQB 5F88B 4HC1H 4CVWA 3HAEA 5I1HH 3UBXB 1DQQA 4PG9B 4MD0A 4M8VA 5DRNB 3HS0A 4NQSA 3UO1L 2BSSB 1G7JA 3BO8B 4I2XB 3B9KC 2B20A 4OF8A 3FB8A 4CVZA 4TNWK 3IAPA 1NDMA 2X4UA 3CZFB 3O6KL 3UCRA 1IKNC 3PGFL 4D0BA 3L3KB 1U8PB 2E7MA 5J9PB 3NCEB 1DJSA 1DUZB 1N0LA 3ULUC 5JPMA 4UTBL 4H25A 4JY5H 4R90L 5F96L 5KS9A 1CICA 4ZDHA 5FHBL 5JQHC 4Z8FH 3N9GL 3VGAB 5BQ7B 5KG9B 2V2XA 2AXGB 4QHKJ 5JXED 1HH9A 5DQDH 3KPPA 5CKGA 2F54A 3MNVA 3U0PA 3NAAH 4Y89A 1OTUD 1FNGB 1RUQL 5I8OL 4AL8L 1KENL 5T3ZL 3QRGL 4BH7B 4POZD 1KPUA 2L4OA 5I73B 1MFAL 3IRPX 4XHQA 1JF6A 3MRBB 2R69L 2FH6A 2ZJSH 3VXUB 5C0JA 4G42B 1YYML 3PQYB 2R9HD 1XGUA 4MNQD 4ELME 3QH3B 2DQCH 2QADB 5I1DB 2Z31D 2D7MA 4P48A 3HC3L 1TJIH 1AXTH 5GZNC 1D5ZA 1WC7B 1C5CL 3I9GL 3VFMA 2D31A 5D1XB 3X13B 2MCG1 3R0MA 2DJSA 3DECA 3WS3B 3LPGA 5GXBB 4YO0A 1XT5A 1KIRB 4PJDB 3DXAB 4NRZB 2CDEB 1MFBL 3W2DL 4PS4H 4U0RC 2BFVH 1AD9B 3MV7D 2GEEA 1BOGB 1Q94A 2WMPA 5IV2A 3ULUE 3BGMB 1Y0LB 1UXWB 3LD8B 5EUKA 2VIRB 2A0LC 2XTJD 5C0IB 1PEWA 1RZGA 4LVEA 4H5SA 2J6EH 3MTRA 1E4XI 4NQEA 3OKMA 2A9ML 3HZVA 1A0QH 1A7PH 3LRSA 5FYJE 1NGZB 5HHPA 2IFFL 1Q9KB 1I1AA 4PRPE 5IB1B 5DR5H 1A7NH 5FKPB 2A6KB 1FL3A 2O26U 4LLUB 1VSCA 5C09D 4JEGB 4UQ3A 3MGTB 1TZHA 3E2HB 43C9B 3Q5OA 1SEBA 3P0YL 2PYEA 1NUFA 2ZPKL 5A2FA 1UM6H 4G7VL 3HI6L 5I15L 5E5UB 5I1LA 2X7LB 3VW3L 1K5NA 3MJ7B 3OX8A 5C0AA 4F3FB 5DS8B 1RJYB 1IGCH 3QO1A 5EBMA 3DX7A 3EBAA 3BUYA 5I1JL 1V3LA 4F37F 1NBQA 5IT2H 4XB7A 5HBBA 8CGTA 2BNQB 1NBYA 3OKNB 1PBYA 5EWIH 4L8SC 1FLRL 1MRDL 4WUUE 1RJZA 4OD2A 2YD5A 1CYGA 2OS7A 3NFPB 3O9WC 4OLZH 4XP9H 2NTFB 4HJGB 5E8DL 5L8JB 4YFDB 2ERJC 2YD8A 3JUZA 4M4RA 4QHKI 4TVPD 3E6HB 2OSLA 2M26A 4J3TA 3LQAC 1F6AB 4MA1C 3QEUB 4DGYL 5HYSA 1FVCB 4JO3H 1FSKB 4EKXA 3BQUD 3DUSB 4PJ9B 4D0CB 3QHFH 5JNYA 2RHEA 4N0UA 4W6XB 1UM5L 3HAEB 4Z7VA 1EO5A 4F2MA 2NY0D 1DQQB 4MD0B 4FQCL 3HS0B 4EDWL 2X4SA 1H3GA 2X1XR 3HE6C 3DVFA 4NQSB 1HHGA 1G7JB 3RRQA 5EA0H 3DX6A 4HWBH 4LQFH 3FB8B 2K3TA 4CVZB 1NDMB 2X4UB 1TQCC 1LK2A 4ZS6C 3NFNA 3TJHC 2GJ6E 4YHNA 3NCCB 5JPMB 4X4MA 1NCNA 3QI9D 4H25B 5F1OB 5KS9B 1CICB 4ZDHB 3FFCA 1OSPH 2AEWA 3CFEA 3MA9L 4WI7A 5HHXH 1IM9A 2V2XB 1QUNA 4JG1L 1URLA 4IOFD 4Q6IC 5DI8A 1HH9B 3KPPB 2BVPA 2F54B 3MNVB 3T0AA 3U0PB 1C7TA 4M6AA 3TJEH 2GK2A 5F7LB 4P5MA 4XAWH 3QUYD 4L3AA 1KPUB 4XNZB 5DHVH 2LVCA 1LO4L 4PGCA 5J12C 3U46A 4F7MA 5F7FA 4M5ZH 2D03L 5TE7H 1VENA 5C0JB 3G9VA 2IPKA 4FMKA 3EW3B 4IIQA 1XGUB 2BCKA 2VXQH 4U7KA 5T1LD 2PXYC 3X12A 2NY4D 1D5ZB 1MF2H 5D72L 3I75A 1I9JL 3VFMB 1GGTA 1NC4B 2D31B 4OM0L 3C60C 4HGKC 5ACMA 2XFXA 1TITA 4YO0B 3SO3C 4OZFA 1L6XA 3B9KD 3LEVL 3QQ4A 2GCYA 5L6YH 1FAIL 2CQVA 3GIZL 1A6AA 3ULUD 4JM2A 3GMOA 1RUPL 4LPWA 3TYFA 4BA8A 2P8LA 1Q94B 1F5WA 4WEMB 5EUKB 1FDLH 2QQKL 1YPZA 4E0RA 5FYJD 1G7LA 1RZGB 4H5SB 5T3ZE 3KYKL 2YPLE 3OKMB 4NQEB 4PRPD 4U6HB 3HZVB 4LCWA 3LRSB 3FB7B 3MCG1 5HHPB 1I1AB 1GH7A 4L1HA 1W2KT 2FJFB 1FL3B 3O3UN 5HHME 1AGEA 1WQVT 4UQ3B 4NNXA 1TZHB 3VWKC 1SEBB 2DB8A 3NZ8A 2E7CA 2JJTA 2YC1A 5DVKA 2Z8VC 3FT2A 5FYKH 5I1LB 5EDXA 2MQCA 2EDTA 2CPCA 1K5NB 3OX8B 5C0AB 5GZND 3QO1B 5EBMB 3DX7B 3BUYB 3C09C 2COQA 3IDYC 4LHJB 5C3LD 4PPTA 3TA3C 3EFDH 3OMZA 1YA5A 4KROC 1NBYB 1QRND 1BHGA 5TQ0H 1M7DA 5FKAA 1RJZB 4OD2B 1P7QD 5E1AA 4LARL 5TDNA 3U4AA 4RWYL 4Z0XA 1DLHA 2A0LD 2OSLB 4EBQH 3Q6FA 4TPRL 5IB2A 1XF4A 1BIIA 4QKXB 1FE8L 5HYSB 5J06A 4OZHE 4TSCH 1JYVA 4MGXA 5LGKA 4OCWL 2CXGA 1EH9A 4ODXA 3QIWA 5I19L 2AERT 1HHJB 5JNYB 2X09A 2Y7QA 5AAWA 3NPSC 5D6DC 1N5AA 4N0UB 1NSNH 3X3GH 5BS0A 2BNRB 4Z7VB 1BLNA 1JZ6A 4F2MB 2CRIA 5AZ2L 2OXGA 1QR1A 2BSRA 2R4RH 4X6EA 2X4SB 5MEPA 3S34L 1HHGB 3U30C 1GGIL 3DI3B 3DX6B 3NA9H 3O2VH 1UB6A 1ZVSA 1LK2B 4UQ2A 3SGEH 3AMLA 3NFNB 4YHNB 1JFQH 1FN4A 1S7RA 3VXMB 3MLPA 2F53D 4KK8C 3FFCB 3MRGA 3CFEB 4QHNA 3RJQB 5MEOA 1IM9B 5IB4A 5L8KB 1F4YH 1RY7B 5T5FH 3S35L 5DI8B 2QRDB 2BOCA 3D39E 2BVPB 3O9WD 1X5JA 4YGVA 4RX4D 4YHKL 5ALBL 2XACC 2Q86A 4NBXB 2WZPD 3ULSA 1GGBH 2VUOA 4P5MB 5LJYH 2FDBP 5IHUH 2W65A 2DTSA 1H8OA 4PGCB 1FFPA 4XPGH 4WY7L 3U46B 5C0GA 3T0WA 4F7MB 1MCLA 1U8NA 4G7YL 2PTVA 1AXIB 2E6JA 5C2BL 4J23A 7FABL 2IPKB 3ARDA 3RUGA 4IIQB 2XZCL 2BCKB 5D9SA 5IK3B 4A6YL 5D7JC 2HLAA 4WW2A 3X12B 3I3BA 4JHAH 1S5HA 3WSQL 3I75B 3SGJC 3P9WB 3IFPA 2XFXB 4QOKE 4AEEA 1X4YA 3HE6D 1T04A 3MGAA 4TUKH 2B39A 3P0VH 1GIGH 1MVUA 4ODVL 1YUHA 2QSTA 4OZFB 4BSWA 2P4AB 3QQ4B 1YEFH 2GCYB 4Y16A 5E0QA 4ZS6D 1VPOH 2VZOA 3NIGE 5HHOE 5I1CL 5IVZA 1A6AB 3TJHD 2ZSWA 1E6JL 3WHXA 1UENA 4JM2B 3KS0J 4GUPA 2RCSH 3SJVA 3TYFB 1T0NA 2P8LB 1FVEB 3KLAA 5E6ZA 1RUKH 3B9DA 3QUXC 4TUJA 2YPLD 1YPZB 1E0OB 4E0RB 4UV7H 1G7LB 1F4WL 2HH0H 4LCWB 5KVDH 3RWIA 1PSKL 2UVFA 5HHMD 3H3PL 2VXTH 4MZ3A 4QF1A 3MOQA 3LQMA 1AGEB 4NNXB 4M48H 4M43L 2CDFA 3NZ8B 1FFRA 2YC1B 2AJSL 4NZJA 2XTLA 2IBZX 5K9KA 3FT2B 4J3UA 3Q6GL 3IDJA 2ADFL 2PXYD 3V4UH 2FATH 3RZWA 4GLRI 4JDZA 3C60D 3VI4F 1YEKH 3ARGC 3V0AC 1VFBA 1IBGH 1S7QA 2Y07H 1M7DB 3ALPA 5FKAB 5E1AB 2ZUVA 4DUXA 4JN1H 1JPTL 1FGNL 1NMAH 1WV7T 5TDNB 3QPQC 1CD1A 4XHJC 5GS2D 4Z0XB 5FV2A 4LP4A 4NM8L 3PWJA 1DLHB 3S36X 3Q6FB 4ZFOL 2Y1VA 2BY3A 1YEEL 5IB2B 1XF4B 4K55A 1BIIB 1FNSL 2FLRT 3DUHA 3DMMA 5HD8C 5LKNA 2KH2B 4YIQB 2X1OA 3ET9F 1H15A 1JYWA 1GHFH 4ODXB 1T20A 3QIWB 3L5WA 3ULVF 1RVFL 2Y7QB 4LSDA 1BJ8A 1N5AB 2OBGA 5F89A 1Q0XH 4X98A 5C0BE 5BS0B 3VWKD 1BLNB 2YD3A 1WTGT 1QR1B 2BSRB 3T65A 3TPKA 5IKCA 5FOBA 3E6FA 2F5BH 4X6EB 5MEPB 4YHMH 3CMGA 4HJJH 5GSRA 2WNGA 2MOVA 1UB6B 1ZVSB 3D48R 4UQ2B 4AG4L 2YKLL 2CRMA 3TA3D 3NOIA 1UCBH 4S1QH 3QEGH 2OTUB 1FN4B 4KROD 5KJRH 3VFVA 1IC5H 3TV3H 3MRGB 2EDBA 3F7QA 4QHNB 3EO9H 3D39D 1RZ8A 5MEOB 5C0CD 5IB4B 2O5XL 2E9JA 5E2WH 4M3KB 4O58H 1ONQA 2BOCB 3SOBL 3ZYJA 3WXWH 4YGVB 1K85A 2X4QA 1JGVH 5EBGA 1KELL 4NZTL 2JCCE 3UPAA 2W65B 3BISA 1FFPB 1CXLA 4O9HH 4YDIL 3NTCH 5C0GB 4QRSA 1U8NB 1OLZA 3OR6A 3ARDB 1NEZA 3RUGB 1A6UL 5D9SB 1T7VA 5TFSL 3BYYA 2HLAB 4WW2B 4J8RA 3H7BA 4QOKD 4NFCA 1S5HB 3AAZA 2EIEA 3RWGA 3B4NA 1WAAA 2DQUL 2VDOH 5IQ9A 3GUTA 1T04B 2HG5A 2X42A 1MVUB 2AJVL 2O5YL 1YUHB 3O4OB 3KPOA 4BSWB 15C8H 5I74B 2GK0A 2UV3A 4Y16B 3VRJA 4PJEA 5IVZB 3WHXB 2ZSWB 4HMEA 1OSZA 1S7TA 4OI9A 1SEQH 4GUPB 3SJVB 1T0NB 3KJ6H 3QEQD 4KK8D 3ZDZF 3ZYOA 1AQKH 3KLAB 3EYQC 1GPOH 4TUJB 2GYSA 1KXTB 4Q9RL 4G6JL 3ZMRA 3RWIB 3DNKA 4LSTH 4TSAH 1YEGL 1BECA 1DN0A 1EXUB 5F7KC 4HFWA 4O2EA 4QF1B 3MXWH 3MLZH 2W9DL 2VC2H 1QFUL 4IHOA 2V5YA 2CDFB 4OLYL 4OCYL 4KKLC 2DYPA 5K9KB 4NM4L 4IBLT 2AXFB 4OZFH 3D85D 3IDJB 1YEHH 4UT7H 1XGPA 3OJ2C 1XH3A 5D7JD 4N90E 1JMZA 1A7RH 4R2GC 2V2WA 3OPZH 4JDZB 3FHQA 4QRPD 5E6IC 3HG1B 4KDTA 1VFBB 1CXFA 1S7QB 3THMH 1WITA 4HUKB 1IGTA 5E2VL 2XWJA 4NWUL 3MJ9L 4BFIA 1YEJH 4HS6A 2MNUA 2V5RA 3QCTH 1JHTA 2WBWB 3G08A 4E5XA 1UACL 3NFSH 1HDMA 3GSQA 1A6ZA 2K7PA 3PWJB 3QUXD 5CBAA 5DQJA 1TNNA 3FCTB 1MLCA 1PD6A 3DMMB 5IESL 2CMRL 2J8UE 1JGUL 5MHSD 2APTA 3CXHJ 1Z0NA 1BWWA 1H15B 4DGIL 5KVEL 5C7XL 3CU7A 1UWXH 2KZWA 3HE7A 5FHAH 1T20B 5C0BD 4XWGL 3L5WB 4EOWH 1Q9WA 5F89B 5C0NC 4RBPK 1Y6MR 4X98B 2YUWA 1W8NA 5A3IC 3T65B 2CIKA 3S98A 5DWUL 5FOBB 5IKCB 3E6FB 2DMBA 2OTWA 2WIMA 3CZJA 3SGKA 5GS0C 1NFKA 3ZSTA 5GSRB 2OXHA 4AT6B 4FABL 3WO3B 2KBGA 2NY5L 1HKLL 1KB5A 2QQLL 4FP8H 3MRHA 4X6CF 4DVRL 1ZXQA 3BKMH 3ARGD 4ZPTA 3Q3GA 1NANI 3C9NA 3VFVB 3VDAA 1FQ9C 1LWRA 1KJ2L 1CVSC 5ID0A 1UGNA 2FEDC 4N8PA 2DIBA 1RZ8B 1A7OL 4Q0XH 1ONQB 3HB3C 5K93A 1YMME 2VSCA 4FFZH 2X4QB 3TZVC 1L7TH 3QPQD 1G0DA 4X80H 3QNXA 3RTQB 2IQAB 2R56H 3WBDA 4G6FB 5DVLA 1EHXA 2DLTA 5HYIA 5C0EB 1ULVA 4PR5A 3VA6A 5MENA 1MH5A 1CFVL 4QRSB 5HD8D 2QQNL 4ONGL 4X8XA 4G6KH 2R2CA 3FAXA 2O93L 3OR6B 1NEZB 4OCMC 3P77A 5DD3H 4JHWL 4ZNEE 5ALCL 5C8JA 4P2YA 2VLLA 4J8RB 1SYSA 5DEZA 5TQ2L 3H7BB 4F7TA 3AAZB 2MQ3A 3RWGB 3GSNA 2Q8BL 5HYJE 4KZEL 2VAAA 1B4JL 5GPRA 5DD6A 5IM7B 5IQ9B 4V1DE 3GUTB 2HG5B 5SWSA 3KPOB 1F3DJ 3LMJL 3HI5L 4X5WB 3H9HA 4NQDD 4XPAH 2D7TL 3BE1L 3VRJB 2FHBA 4JQXA 3UPRA 1OSZB 3O45A 3P4LA 4LRIC 3SCMC 5B38A 3MLVL 5D2NE 2FGWH 4K3EL 4IDJL 2ZNXA 3ZSSA 4IM8A 5KZCD 5C9KA 1R6VA 2XKNA 4LDEB 4KV5E 2E9WA 4NQCE 3VWJC 2Q3AA 1U8OA 1BGXH 3OAYH 1NEUA 5ITBL 2QSCL 1DN0B 1ZMYA 4HFWB 4O2EB 3MLXL 5GIRA 1ZA6A 2IAMC 5DFTA 4IHOB 3MLWL 1IC7L 1T0PB 2DYPB 3O6FC 4DQOH 5LVEA 5EIIA 1JNLH 3WN5A 4DTGL 1XH3B 2W9EH 4LASH 2E7LC 4MQTB 2ADIA 2IADA 4HS8H 2V2WB 2YA1A 5E00A 3VFGL 4CUCA 2XKUA 4R26H 4Z7NE 3O2DL 5HDQL 3ZTJG 1HK6A 4CAGA 1IGTB 4QT5A 2XWJB 3MLUL 4BFIB 4HS6B 3VFUA 1FL5B 4XPHL 1JHTB 3G08B 4E5XB 2Y5EA 5CSZA 1YECL 1GJIA 1BFTA 3GSQB 1A6ZB 5KN5A 3EYQD 1A3RH 1MIEL 5E9DA 5KOMC 3MRLA 2X89A 1EGJH 4X4ZA 3RVUC 5CBAB 5DQJB 1MLCB 3QXDA 5AUMA 1KN2H 1GGUA 2MKWA 5A2IH 1NDGA 1MRCH 1Q8MA 4FQLH 2GAZA 3HE7B 3DSNA 3UTTA 2ZSVA 2P7TA 1Q9WB 4JFFA 3UTSA 5AD0A 3IFNL 3UYPA 4FQ2L 2CIKB 2OTWB 1DANU 5T1DH 4IMKA 5HGGS 4U2YA 3C2SA 1W0WA 2E7BA 4M6ML 1KB5B 1BQHG 2J1KA 4R2GD 3WIIH 3MRHB 5I2IA 1N0XH 3AM8A 5E6ID 3SE9H 4GW5A 4OFDA 4LGRB 1NCBL 3Q3GB 5FDYA 1OW0C 2EE3A 3C9NB 4CKVX 2D4DA 3C5ZC 5ID0B 5AWNH 3S7GA 2YSSB 1UH2A 4UIKL 1YMMD 1PEZA 5FO7A 3HNSL 4W81A 4LVHC 1DBML 3LDBC 1QTYT 1J0ZA 2R0ZH 2OX5A 5BVPH 2XZQL 1N6UA 5JUEL 1BOYA 2V6HA 3QNXB 3BP5B 3H0TA 1RUAH 3RPKA 3PHQA 3O3BA 4U4BA 4PR5B 4P3WA 2AEIT 5MENB 1NAMH 1DSFH 1LO0L 4OLXL 2M2DA 2YHGA 4X7TA 5EOCH 2UZIL 4AEFA 2VDRH 3DVNB 2VLRE 3P77B 2AVGA 1EJOH 4YPGA 5ITFA 1RD6A 2LFGA 3G6AA 5C8JB 4OM1L 2VLLB 3Q2CA 5GGTH 1SYSB 4E42B 5HYJD 5C0ND 3K1DA 3CXHK 4F7TB 4V1DD 5A3ID 2UZXB 5ENWA 4QRRA 3GSNB 1AY1L 4DJMA 2VAAB 5DD6B 2A83A 3CC5A 6CGTA 1ED3A 1XIWC 1OOAA 5GS0D 1SJHA 3DHJA 2ICWI 5F93C 5SWSB 5GISH 1H5BA 2D9CA 4OCXH 4KAQH 4N8CL 3U7YL 1N2RA 3X17A 2EDFA 3H9HB 1EEUA 3WYRA 4I3SL 4XMKH 2X4TB 5DJXA 1KCRH 2HJKA 3O45B 5B38B 2JELL 3BJ91 3SDCC 1HH6A 1DEEA 4P5TA 3T0DA 2XZAL 5TDPA 1ZGLP 4OB5H 2FEDD 1LD9A 4Z76A 2MJWA 5DRWA 3H9YA 25C8H 4PJ7E 3HB3D 5C92A 3BD3A 1FFOA 2XKNB 1R3IH 2X4PA 4NO5A 3S35X 3TZVD 1KN4H 4X4XA 4JFXA 4RGOL 4OF7A 2GSIA 4S1SL 3QNZA 1RZFH 4L8CA 4N1HB 2NY1C 5GIRB 1ZA6B 3INUH 4PJFE 2WK2A 3UJIL 3KR3L 3WEXA 2EECA 4LPVA 1U3YA 3MSPA 5EORH 5L2JA 5EIIB 1A6WH 1DFBL 4PBVC 3WN5B 1T21A 1N5YH 1NCDH 4JO1H 4DEPC 3ZL4L 5H94A 2ADIB 2IADB 4N0RA 2CLVA 3SKJH 5E00B 3FFDA 3GFUA 3ELAT 4LPCA 3HC0A 3Q1SH 3TM6A 4GXVH 3NCMA 4KQ3L 3OB0K 1B0GA 1WIOA 3BWAA 3BESR 3U1SL 4QT5B 4YLQT 3KLHC 3IFOA 3U6RA 5BMFH 3VFUB 1RU9L 4QYOA 3ZE1F 3G9AB 2CJUH 3WUWG 3ZHKA 4XRCA 3SCMD 1HCVA 2Z8WC 4HIIA 5CSZB 4PGBA 5JIIA 4HWEL 2QR0A 1A64A 5KN5B 4EXPX 4G8IB 5CEXA 1M7IA 5E9DB 4ZO6A 1BAFH 3MRLB 3HMWL 1D6EA 2DBLL 3MPCA 3REVB 3F7PC 3QXDB 5AUMB 1P6AB 1R3JA 2HVKA 3VXOA 2P5WA 3JZ7A 1NDGB 3VWJD 3OKDA 2SEBA 4HIEA 4PJCA 2GAZB 1WK0A 4HBCH 5D4QA 3UTTB 4RA3A 5GGSA 5CEZL 3UP1A 2ZSVB 3D2UA 2P7TB 4JFFB 4LHQB 2OM5A 4KI5C 2OI9C 3UTSB 5AD0B 2IAMD 1T03H 4EI6A 5E2JA 1J18A 2DTML 2MPAH 5C71A 4MJ4A 2BSTA 4AENA 2JF1A 5LWYL 3O6FD 2MCPL 1CWVA 1W0WB 4Z7WE 3EJYC 1MHCA 4RFEA 3OZ9L 2HN7A 2KPNA 4RZCA 2IQ9L 5I2IB 4GW5B 4KQ4L 1T7YA 3HCVA 1TMCB 5D1ZC 5DHXB 1MHPL 3ZTNL 4ETYA 5FB8A 4JLRA 4MA8L 3MUGA 3BGAA 1A22B 5FO7B 4OLWH 3ABZA 4OLVL 3K2UL 3BP7A 4HUVA 5HI4C 4NO2A 3G6JA 1T5XA 3H0TB 1DBJL 4ZS7L 4HG4K 2ID5A 2QBWA 4KUZH 3PHQB 3O3BB 4NQTA 3K81A 2VE6A 4FOMA 4G5ZH 4LHUA 3RVUD 1WCBA 1N3NB 4TVSa 4B7LA 4XMLH 5CZVL 3QUZC 4X7TB 4MAYC 3LKOB 2CKBH 4C58B 1LGVA 2NW2A 4MA7H 5JIHA 3LS4L 2EE6A 2OTPA 1V3KA 5IB5A 2H1PL 1CLYL 2EDNA 5GJSH 4YPGB 5ITFB 3W5MA 3ARBC 3G6AB 5J3HC 3WKNA 5KTEH 2DRUA 5F9OH 2XT1B 4E41A 5ENWB 4QRRB 3FN3A 4DKDC 5F97E 3QXAA 1G84A 1V8HA 2A83B 2M1KA 3CC5B 1ED3B 1QRKA 4TOYH 1FG9C 1SJHB 4PJHA 1DLFL 4LMQI 2ITCA 4NZRL 3R8QA 1H5BB 4OV6F 1CBVL 1N2RB 1E4XH 5I8KL 2EE9A 1JGDB 3MJ8A 1DL7L 4L9DA 5DJXB 4FNLH 2HJKB 2CO6B 2VLKE 1HH6B 1DEEB 1X5LA 4P5TB 3C5ZD 5TDPB 4MQ7A 3DSFL 1LD9B 3WCYA 5HPOA 4Z76B 4M7LL 1ACYL 4R9HA 2YD9A 3ES6A 4I0PA 5DRWB 4JRYE 1FFOB 4NO5B 3ZE0E 4DK3A 4DFHA 4DOHE 4X4XB 4JFXB 2HJLA 3FL7A 3O8XA 3F7RA 2GSIB 3QNZB 1HILA 4YDKL 4L8CB 1H0DA 3VGAC 5KAQF 1X5AA 1MJUL 5ACZA 4UB0H 3WEXB 4I48A 3MRIA 2OZ4A 4LGSB 5A2LH 1RULL 4HIXL 1I1FA 2R0WL 1KCUL 4L3EB 1T21B 2BRRH 2GFBA 4JANB 2PN5A 4LNVA 4Y4FA 1QHOA 1SBBA 2DQTH 5H94B 1ZE3C 5I73C 5FYLH 2CLVB 1QFWM 2J4WL 3FFDB 3VU2A 1BZQK 3TT1H 1VERA 5IQ7L 3HC0B 3VGGA 1XIWD 2HJFA 3PP4L 5KVFH 2HKHL 5JPNA 3VFWA 1WEJL 1B0GB 3S8WA 3BWAB 2AGJL 3JUYA 4AY0A 1MEXL 3IFOB 3F12A 3U6RB 2QADC 3KHOA 1QNZH 3D5OF 4QYOB 4X7EC 1BWMA 2Q3ZA 1ZAGA 1I8LA 1ADQA 3L5XL 4KUCF 4XRCB 4HIIB 1AGDA 2VDNL 4PGBB 3SDCD 5I71B 5D1XC 2QR0B 2YD4A 1KGCE 1IQWH 5CEXB 1M7IB 1VACA 3G5ZA 3UJTH 1JZ7A 3E1F1 1D6EB 5IBTH 1CGVA 3W0WE 5EBWA 2AP2A 3UC0L 4F7EA 1MREL 1R3JB 2HVKB 3VXOB 4I2XE 2P5WB 3TFKC 4PP2A 3STBA 4NCC1 3OKDB 4PD4K 2SEBB 4HIEB 4PJCB 5TDOA 5FEBA 3CJJA 2IPTH 5AAMA 5GGSB 2NY1D 4NGHH 3D2UB 3LD8C 1WT5C 3A67L 3NZHH 4EI6B 1CL7L 1YYLL 2BSTB 4AENB 1P9MA 4QCIA 1XCTB 4Y88A 3FRPA 4X9IA 3O3EA 3VXQA 2B1HH 2E7HA 4OCRH 1MHCB 4RFEB 2HN7B 4RZCB 3E2HC 2GIYA 3HCVB 4JFPA 3IU4H 5E8EA 4JFDA 4JLRB 3MUGB 3VXUE 3KJ4B 3KLHD 3E0GA 3BP7B 2EDEA 3RIAK 3PQYE 3SE8L 3NACL 3VFSA 4HUVB 5FGCE 3AMKA 4NO2B 5EZIH 5D70L 1JBJA 3G6JB 1T5XB 4Q2ZA 4WTWA 3CFCH 3TEUA 2YPKA 1UYWL 1FCCA 4K7FA 4LHUB 1IAOA 1WCBB 3QFJA 3A6BH 1CDCA 1AHWA 2P5EA 4ELMA 5FUZL 2NW2B 3FQTB 5CIPH 5CEZE 5IB5B 1CF8L 1F4XH 4PJDE 3FRUA 3DXAE 3GI9L 5JLZA 2DQDH 2H32A 4HXAL 4JPKH 4YGAB 3RZCA 4KI5D 2R1YA 4GQ9L 1MCDA 5BV7L 2NLJA 4E41B 1QBLL 2ZP0T 4ZO8A 4OZ4A 3QXAB 1FSKC 1II4E 2AW2A 2C1OA 4PJHB 1EDQA 3ISWA 3VRLF 3OKOA 2ITCB 4TQEL 4JFOA 3EJYD 5DF0A 1INDH 2CK0L 4JY4A 4M61A 3MJ8B 3VMOA 2VLKD 4QTIL 1RV6X 1VEOA 1RURH 3VCLA 4L4TE 1UM4H 5D1ZD 4HT1L 4KPHL 4JRYD 2C3XA 3RU8L 2P44B 3ES6B 4I0PB 1FO0H 3FN0H 4BUHA 1HQRA 4EVNA 5HI4D 4XC1H 1IT9L 3RWJA 1YNLH 5EU6D 5B21A 1EHLL 3T0EA 2BXYA 5SWQA 4XNXL 2HJLB 5DD1H 2BX5A 1HILB 4RDQG 3RPIA 4P2OA 1CICC 1KC5H 1H0DB 2RAMA 2VN7A 1ZHBA 4GAJH 1J5OL 3BN3B 4WI2A 2AEQL 3QUZD 3WFBL 5ACZB 4MAYD 5EC1A 1R0AL 4I48B 3MRIB 1JTTA 5A40E 1I1FB 3ARBD 5J3HD 2GFBB 1SY6L 5FOJA 1I3GH 4Y4FB 1I7RA 4XNZC 3RWDA 3EJJX 2VO5A 1CDGA 1JWSA 1C5DA 4YHLH 4H8WL 2HJFB 4N0FA 5DEGA 1J1OL 5JPNB 1BBDL 3PDGA 5EZLA 4YE4H 1CVRA 2ZKHH 3C8DA 3F12B 2A77H 5E2UH 3VXNA 2QV2A 5JW4Q 1IAII 4I3RL 3ZDYF 1KGCD 4LSRL 4N0YH 1AGDB 5E7FA 3ZE2F 1TVHA 3KPSA 5KSAA 1NBVH 1K4CB 4PREA 4QGTA 3G5ZB 3EHBC 5EBWB 3JTTA 3O6LH 4OFVA 4YHYB 2IH1A 1RJCA 4F7EB 1O7SA 4PP2B 4YX2L 1T89C 4NP4H 5TJWK 2C3VA 5TDOB 1D5IL 4OFPA 2F8VA 1B3JA 1DQDH 5FA3A 4OIBA 3T0BA 1A6TA 1CGXA 5KS9E 1UH3A 4DKEL 2XKSA 3QG7H 1CFTB 2VISA 4QCIB 1TETH 1AR1C 1QG3A 3O3EB 3KPRA 1FHGA 4GJTB 4PTUA 3VXQB 4OKDA 2B4CL 1ZA3A 1G6RL 4BM7A 1A3LH 1U36A 3IDXL 5F1IA 5DJZA 4CU8A 1AE6L 3T09A 3VXUD 4JFPB 5GS1A 1E4WL 5E8EB 4JFDB 4G8EA 3PQYD 1KCSH 1MWAA 1UKQA 4KHXH 5JZ7C 5KVGH 1LE9A 4U2ZA 2QADD 2CGRL 3VFSB 1OARH 5E8NA 3VG0H 5J4MA 1A7BA 5D1XD 1KLGA 1FC1A 4Q2ZB 5EOQH 1BFVL 2YPKB 4QWWC 5FYKD 4LAJH 4K7FB 5ICXA 3WDIA 1B90A 3GK8L 1IAOB 3QFJB 1AHWB 2P5EB 3HFMH 5IMKA 2UZYB 4D3CH 4ELMB 3TFKD 5HHQA 3DXAD 4CDGC 2Y06L 1QFWL 3AGVA 1OAUH 3FRUB 4MJIE 2O5ZH 5JLZB 5DMGC 2H32B 3RZCB 3I2CL 1MPAH 2R1YB 1UWGL 1IGIL 5D2LF 5JW3L 2EXYC 4OZ4B 4LLWA 1NPUA 4J3SA 1WZLA 1TLKA 2C1OB 4RDQF 3WHE0 4UNTA 4NQEE 3OKOB 4JFOB 3ZKSD 4JY4B 2XA8L 4M61B 2W1NA 3PABA 2OCFD 5LG1A 3MODL 1INQA 5DRXA 3VCLB 1QLEL 3NH7H 1XGQA 5KW9H 2PYEE 3JWOH 2IJ0C 3BD5A 1YEIH 2NZ9C 4XCNA 1I8MA 4LCCA 4AIZA 4EVNB 4M7JH 4LSSL 4RIRA 3RWJB 1GRWA 1HKFA 4NOFA 1YJDH 3T0EB 5SWQB 3QQ9C 1V7NL 3GMMA 2BNQD 3MV11 2VXVL 4P2OB 1AKJA 5F7EH 3RPIB 3ORJA 4WU5A 3I3DA 1ZHBB 4U0QB 4GLRH 3RY4A 5EC1B 4UTAH 1NGXA 1F90H 2IFGA 3V4PH 4M6OL 4EEEA 1JGLH 1FIGL 1QKZL 1CE1L 3NN8A 1KTRL 1G0XA 3RWDB 2YA0A 1CQKA 2KL6A 3A6CH 1WGOA 4KTDL 4JG0H 3CSPA 1JWSB 4UDUA 1C5DB 4GRLA 4N0FB 5DEGB 4WUUB 4UT9H 1A1OA 2E9BA 3SKUD 3CVHH 1WZ1L 5A16B 5EZLB 1C5BL 3RWCB 2XNAA 3VXNB 3EYUH 4H1LG 3H3BC 1TZIA 4MAUH 3WLWC 2A38A 2FL5A 4G6ML 4N0UE 1IGMH 3MLSL 1TVHB 3KPSB 5KSAB 4LAQL 4PREB 4S1RH 2DQJH 2F74A 4OGXL 1MIML 1NKRA 3JTTB 5CJ8A 2DL2A 4WJ5A 3LZFH 2IH1B 5I17A 3HTLX 2WM0A 4OCSL 1S7XA 2E8YA 2CUHA 4JM2C 4MXQC 2C3VB 2AJXL 4YHZL 4X7FC 1CICD 2ZG1A 5GHWL 5E6YA 1W0VA 1QBBA 2APXA 4X4ME 5FA3B 1A6TB 2AXJA 3FFCE 3FMGH 4NCDA 3MUZ1 3T2QA 1VGKA 4OF5A 2F54D 2VISB 4ZTPL 2EDWA 1ZLWK 1GGCH 2HTLC 3KPRB 4PTUB 2LU4A 5L88L 4PBWD 3KS0H 4Z95L 1S8DB 1MNUL 5F1IB 4DCQA 4HEPG 5DJZB 2R8SL 3B2UC 4OIIH 4DAGL 4RCAA 5GS1B 1KUMA 2C7UA 1BQLH 4KRPC 4G8EB 1G9NL 5DQ9A 1MWAB 2DM2A 1U91A 2D0FA 4RBPH 1RIUH 2XRAH 2Y72A 5E8NB 4X7SH 4GFTB 4FQ1H 2IF7A 3NIDF 1IARB 1S5IH 3CFDA 1NC4D 1KLGB 4TYUA 5FM5O 2D7NA 3NGBB 3EHBD 4J12A 2B8OT 5ICXB 4NNPH 4KWUA 1P2CA 4IMLA 3IDGB 5IMKB 2BDNH 4MCZA 1DQLL 5HHQB 4KJYA 4YXHL 5FECA 1UWEL 2VXUL 4MX7B 2V9QA 3BT2H 3HHRB 4PYGA 1KXQE 1INEL 4KVCL 2Q1EA 3GHEH 4F8QA 4LSVH 1T3FA 3WD5H 2YUXA 5IFJA 4HKBA 4LLWB 5C1MB 4NQED 1YPZE 4O2FA 3LEXA 1VEPA 1AR1D 1LO2H 3JVGA 5HHOA 3QIWC 3ZDYE 3PABB 5GRJH 5HVGB 4GRWF 5IVNA 5EU5A 1INQB 2AKRA 1S7WA 5JW4N 3ZE2E 2ZCHH 5DRXB 4OUUA 2VQ1A 4K94L 1Y6KR 1XGQB 1WWWX 5C9JA 1PZ5A 1T7WA 5JZ7D 4DW2L 1L4IA 4BH8A 1QSFA 4GAFB 4XCNB 1I8MB 4LCCB 4JFZH 4AIZB 5C0AD 3HI1A 1F6FB 4RIRB 4MXVF 3F62A 1PYWA 3VFPA 4Q9QL 3QHZH 4MCYA 3GMMB 3HC4L 4QWWD 1AKJB 2YK1H 1Z9LA 4ONFH 4WU5B 2APBA 4P99A 1GC1L 4Y2OA 1U8IA 5CINL 3BKJH 2YD6A 1OAXH 2DQGL 4JKLA 3S37H 4CW1A 1NGXB 4FXLA 1AO7A 4I4WA 3OGCA 5DMGD 2X9WA 1RZJC 1K2DA 1BEYL 2AXHA 3RX5A 3NCYP 1P4IH 3ULUH 1PAMA 2EXYD 4UDUB 4M1DL 4GRLB 4NJ9H 2ENSA 1A1OB 1B88A 2EC9U 3ARDC 5LBSH 5FYJH 3WL9B 2XNAB 1XAUA 5DDHA 2VOTA 4WW2C 1EJ6A 1DEDA 5F7UA 5FYJU 3FO0L 5SV3A 1TZIB 2BNRD 1AGFA 4X6DF 2FL5B 1IGFH 5DLMH 2QEJA 1RZIA 2F74B 3WFDH 4XPTH 4Z7QE 3O4OC 2NZ9D 4WJ5B 1KJ3H 4O2CB 4KTEH 4IRSA 5I74C 5I17B 4Y16C 3T2OA 2YD7A 4YFEA 3JV6A 1GVIA 3QQ9D 1S7XB 4IRZH 1RJLB 2ZCKH 3VXMD 3FFCD 4M7ZB 5I1EH 3CLFH 3K4AA 1W0VB 4JREB 1IM9D 1X4ZA 4LRNL 3OWEA 5FK9B 3WHE1 4H88L 1ORQA 1VGKB 1MQKH 1NANH 5GJTH 3D3VA 4EUPA 3JWDL 1NUDA 5TE4H 3VXSA 5KSBF 2ESVA 4XCFH 3GI8H 4ODSL 4DCQB 4FQIL 4F9LA 1MY7A 3U0WH 1EZVY 3NVQA 4HC1L 3CIQA 3OAUH 2C7UB 1OCWH 2G9HA 5DQ9B 1U91B 3DJ9A 1ZEAL 3MOAH 4WEBH 1UA6H 1R5VA 4MNGA 1Q72L 2JCCA 3FQRA 3CFDB 1ZANH 3MROA 3WLWD 3KHQA 3UBXI 4Z5RA 1P1ZA 5E94A 5FO8A 1QYGH 1EERB 4N8VA 4C55A 1J05B 4JY5L 3H8NA 4B0MM 1P2CB 4IMLB 2OJZL 4FG6C 4MCZB 1QLFB 3UBXG 2HLFC 1LO3H 4KJYB 2EDRA 4XVUC 5FECB 4JM2D 4MXQD 4WUKH 3RWFA 4NHCH 4XVSH 5IOPA 5T1KA 1J8HE 1T3FB 5IFJB 4HKBB 3DMMC 3UTPE 4O2FB 2I24N 3LEXB 4LCWD 5JW5A