2QLVB

Crystal structure of the heterotrimer core of the s. cerevisiae ampk homolog snf1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
252
structure length
155
Chain Sequence
b'SLMVPVEIRWQQGGSKVYVTGSFTKWRKMIGLIPDSDNNGSFHVKLRLLPGTHRFRFIVDNELRVSDFLPTATDQMGNFVNYIEVRQTTDIPAVFTDPSVMERYYYTLDRPPQLPPQHVVLNHLVTSSIKHNTLCVASIVRYKQKYVTQILYTPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Carbon catabolite derepressing protein kinase
publication title Crystal structure of the heterotrimer core of Saccharomyces cerevisiae AMPK homologue SNF1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/protein binding
total genus 21
structure length 155
sequence length 252
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04739 AMPKBI 5'-AMP-activated protein kinase beta subunit, interaction domain
B PF16561 AMPK1_CBM Glycogen recognition site of AMP-activated protein kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.290 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2qlvB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2qlvB01
4XNXL 5F7DA 1A7OH 1DQMH 2DWEA 3MRIB 4YC2B 5D71L 2J8UF 3FFDB 1WAAE 4N9OB 2ZUVA 3V6OC 2AK4D 3GB7B 5F96L 4QYOA 1UXSB 4XXCA 4B7IA 3LN5A 1FNFA 5M7QA 1AR2A 3BH9A 3IJHA 4QXTB 4KTYA 2CKBB 3IDIA 1RUKL 3PQYB 3QRGH 4WGWB 5AAWA 4PRNB 2AEWA 1D5XA 3CFJA 2IBZY 3QIBD 2WUCL 3PJSB 3FB6B 4YGVB 4XPFH 2XN9A 3C60A 1NCNA 3V0VA 3FQNA 3HCVA 4M4RA 3OJDB 3QFJD 2YPLA 4HF5L 2MQ0A 1MFBL 2EICA 3DTXA 4XPAL 3S97C 1QSED 5CILH 1LVEA 1GL4B 4JPKL 3NIDE 4AIZB 4WO4C 5DJ6A 3MRKA 3MUGA 3PWLA 4R0LB 3TBVA 3V52H 4BM7A 1M71A 2WWKT 3GI9L 1BZ7A 4O00A 4YHKL 1KJ3L 4RGNB 4Z7VB 5IQ9B 2IGFH 4TSCH 4XAWH 3RY6C 2DDQL 4OZ4A 4K2UH 3MJ9H 1JK8B 5ICYB 4NCC1 4YWGL 4EDXA 3BESR 3RWIB 2F54B 4J8RB 2HH0H 1AJ7H 1T04B 2N7BA 3NFNB 4M7JL 3IJSB 3U0WH 2FYYB 3LEYH 5E2TH 2OXHA 1B0RA 5HPMB 3RWJB 3QQ3B 2J8UA 5EU5A 3QIUD 1KULA 4ZNEE 1LP9B 2LQRA 4DVBB 1ZS8A 3GZKA 1YEJL 3V6OA 1CD9B 2MFNA 1WZMA 2P8LA 3IDUA 4LBEB 1OTTD 2V2XB 1EFXB 1I1FB 5BS0E 2O5YL 4U3HA 2V2WB 5HVFB 2R69L 4NNPL 5I74B 3EO1A 1MQKH 1DQJB 1ZVSA 5ADOL 5CZVL 4R26H 3CCHB 1YY9C 2VXQL 1A7RH 4JRXD 1C16B 3WEXA 3BW9A 3CFBB 4G8GB 3HG1B 1R5IB 2H32A 2VLLB 4JFZH 3CH8A 4XTRD 5EUKB 4LLMB 2B2XH 1A3RH 4OCYH 3MRMB 1I3UA 3GSUB 5DHXB 4BQ9A 1O7SA 5H8DA 2BSED 2BDNL 5FYJL 4G3YL 4PRAA 3MROB 5IFJB 3NH7L 4JB9H 4U0RC 2D7NA 3RGHA 5EPMA 2EEBA 3O3AB 4IS6B 2NY0C 3GI8H 3F7YA 4Z7WE 1XF3B 3NFSH 1GGCL 4RNRB 1FZMA 4QWWD 5ERWA 5FOJA 5HHVH 5I66A 5LG1A 4MAYD 1MJUL 4E0RB 2CRYA 5EUOA 4NHUB 3T2NH 4MXVE 3VXNA 5HDQL 3LKSB 4JM2F 1G9EA 4NQCB 1I9IH 3FKUS 5JIKA 2X1WL 3HE6D 3O6FD 3P0VL 2A6JA 1VFOA 4HLJA 5F9AC 3T0EA 3BPCB 3WFDL 1ZHBA 3FOMA 4ZG1A 1S7VA 3QXUA 3DXAE 3B83A 3QBTB 4OCXL 2R2BA 43C9B 1ONQA 1OAKH 4XNQB 1C5CH 2J8OA 3FB8A 5C0IA 12E8L 2X05A 3CU1A 4GW1A 1RK1B 3DETD 3THML 1H3PL 1NKOA 5DD6B 3RAJL 5HD8D 3RVTC 4DKEL 3WL9B 2W38A 3VXSE 2BCKA 4ONOA 1BVZA 3CVHL 4K7PL 4NO0D 4RDQF 5FECA 2FBOJ 5I1CL 1ZLWK 5J1TC 2D7OA 3RIFK 4QRPB 1Q72L 1FFNA 5CP3A 3I75A 4I3RH 3BPNC 3L3JA 1KT2B 4YHLL 3KPNB 4JPVH 3L5HA 1K8IB 2HLAA 4X7SH 1NKRA 2R29H 4LLUA 4AEFA 1TLKA 4P23C 4BZ1H 4MJ6B 1QOKA 1CQKA 2Z92A 2WANA 3MLRH 1GOHA 3VI4F 3QUMA 1DANU 1WIOA 4DZBA 5E08H 2VISA 5C9JB 3WJJA 4PJEB 5C0BD 2G5BA 4K94H 1TJGH 4JFFB 2ESVD 1EMTL 4NQXB 4NM4L 4PJDF 1KPRB 1FG2A 5KSBF 1SM3L 4FQ1H 4Q9RL 2WUBH 3BH8A 4PJXF 3OKOB 4ZPVB 5JW3L 3F6IA 1NC4A 5IF0B 5C08B 2PR4L 4WV1A 3PDOA 1CQYA 3L3HB 2NR6D 4Y5XA 2BFVH 2VL4A 1U95A 1A7QH 1S7TA 1H15B 1T4KA 1NCCL 1KENL 3GSRB 4YK4C 1IQDA 3UO1L 1CE6B 3GMRA 2APWA 5IB4B 3QXAA 2DQDH 5ANMB 3MLUL 1P4LA 1K4CB 3QI9C 3KXFE 3DUUA 1HXYA 1QNZL 1NEZA 4MNQD 2NXYB 3AY4C 4JY6B 2HFTA 3QDJD 2R56L 1KYOJ 4JPWH 5HYSB 1CLYL 4KI5C 3MXWL 3U0TB 3RL2A 1FYHB 2NX5B 3B8SA 4NQDA 1Q9LA 4N1CA 1CN4A 2QR1B 2DYPD 3L3GB 1AFVH 4Z0BL 1MLBA 3RVUC 5E6ID 4LLQB 1M7DA 2ED9A 2WBJD 1NMAL 3K0WA 1AKJA 5E1HB 3KR3L 5ACLA 1WFTA 4XNXH 4XBGB 1BZ9B 1HHGA 1A6UL 2AVGA 2PYEE 1YEKL 5D7IA 2X5PA 2D3VA 2OTWA 1D5ZB 4G9DA 5E4IA 1BF8A 5F96H 3GMNA 2ERJB 3BP4A 5IB3A 3VXTA 1UC6A 5HYSG 4JKMA 1G7QA 5EB9A 5F1IA 3FB5B 4M02A 8CGTA 1WBXB 1AE6L 1UVQA 3MYZA 4RMSA 2XT1B 2YPVL 5KSBA 5TDPB 3H7BA 4G9FB 1BGXL 3SGJC 3L95B 1D5MA 3E2HC 4PJXA 4NFCA 5GRVL 4F80A 4Y4KC 5IB2B 3BP6A 1XF5A 4NQSB 5MERA 1FNLA 2WUCH 3QNYA 3P4NB 4X6CE 1QR4A 3EYVB 5FO7A 4LRIA 2NW3A 3D6GA 1SJEA 1RIHL 2Y23A 3O11B 3OXSA 4HF5H 1MFBH 3C6LB 3FMGL 3TFKC 1BLNA 3GMQB 2X40A 4XPAH 2C7UA 2ICES 3SPVA 1CT8A 3QEQA 4JPKH 5B8CA 1SEBB 2Z8VC 2HAZA 2ADJA 3MODL 4XP1L 5C2BL 3SDDB 2XXMB 3QFDB 3GI9H 1BWMA 2YUWA 3GNMH 5DJAB 4YHKH 3OKMA 1KJ3H 1ZGLM 4TVPD 5C07B 1FL3A 3ZKNC 2DDQH 4L5FL 4YWGH 4JKWA 3FQXB 1I3VA 1K2DA 3F7VB 3TF7C 4E42A 3O81A 1DN2A 4PV8A 3KPSD 4M7JH 2ITCB 3MRLB 3MFFB 1SY6A 4HFUL 4ZPTA 2R0KL 5GRXG 2Z4QA 3HR5A 5EU6A 2MSPA 2Y5TB 2VLKD 5D2NB 1HDMA 1CTOA 1NC2B 1W72A 3VD5A 1KC5L 4A2MA 2IAMD 1P4BL 1YEJH 3ARGD 32C2A 4XCNA 1MCQA 4L4TD 4WUUD 1U3JA 2DLIA 3PQYE 1FVEA 2X4OA 4F7MA 1XR8A 5EFIB 5GS1A 5I1EL 1UKSA 1J1XL 1F2XK 2O5YH 5JHLL 1TQBC 1I8IB 3RWHA 2HT4D 2R69H 4NNPH 1FH5L 3FQRB 5ADOH 4HWBA 5CZVH 3SDXB 1LNUA 1S9WB 5F72S 4M6AA 5CIPH 4MA3A 5E6YA 4Y4KA 2VXQH 4OFYD 4MX7B 5ALCL 1P84K 1OL0A 5DJDB 5EIQA 3VG0L 2JB6A 2AGJL 2BDNH 3PABA 1B6DA 5FYJH 1CCZA 4G3YH 4GBXB 3PGDB 1D3CA 3NH7H 4M9PA 4UQ3A 4L4VB 3SE4C 4N5ED 1V3LA 4QTHA 5DTFB 1I75A 2A9NL 4NBYB 4RGNE 4Z7VE 5IK3A 1GGCH 5IB5A 4G8IA 3TO4B 5LKNA 4IOFD 3L3OA 3ELAT 4LPTA 1MJUH 1QBML 3D2UB 1DZBA 2AKRA 1X5AA 2Y36L 4I0PC 5HDQH 2F54E 2Y7QB 5D7JD 1NUGA 5F9WB 4TSAH 5CFHA 3FO2A 4WTXA 4NWTL 4RQQB 3WFDH 3D39A 4DZ8A 2A6KA 2W0FB 5D9SA 1ZT1A 2EE3A 4OCXH 5DRWA 1LP9E 2ICCA 3RTQB 1I7ZB 2Q8AL 5HHPB 12E8H 1AP2A 2I9TA 3D0LA 2EYTA 3THMH 4MAUL 1H3PH 5IW6A 4G80A 3RAJH 2QADB 2VDML 4DKEH 3LKOA 4N0FA 4OD3L 5ESAB 1CXEA 2DM3A 5E1AA 3B2UC 4ELKB 3CVHH 4K7PH 2DLEA 3RL1B 2OCFD 2EXYD 3MV9E 5I1CH 1NDMB 1Q72H 3EOTL 4YHLH 4GFTB 1OT1A 3HMXA 3NIGF 1XGRA 4GAFB 4G8GE 3HG1E 3LH2L 1JFQL 2GEEA 1A5FL 3KPQB 5INDA 5MEPB 4CVWA 4Y4HC 1KTRL 5D1QB 4YHYC 1G7PA 3DUHA 3ARFD 1RQ5A 5GGVY 4GKZA 1PZ5A 1E4XI 4PRIA 1EMTH 3GUTB 3UMTA 1A2YB 5I8KL 2DD8L 1IGYA 5ESQB 4ENED 5BS0D 3SE4A 5IKCB 5TE6L 3I9GL 4LCUB 4Q9RH 3TBYB 4NZUL 1TCMA 2HTKD 5JW3H 1A9BB 2PR4H 4P5TD 2HVJB 1L7TL 3PE9A 3PHQA 3Q2CA 5F7LB 4NQCE 1IGJA 5DD1L 1UWGH 1KEML 3AB0C 4RAHA 3C5ZA 5IMMB 5BW7C 3MCKA 1PVHA 3AAZB 3DLQR 4HEME 3W0WB 3KPTA 5EG6C 1NCCH 3PGCB 1KENH 1AH1A 3WN5C 3UO1H 3MBXL 3O8XB 4RGMB 3FQTA 2NY1C 2WMPA 3MLUH 3X14A 1T22B 3V5DA 2ZSVB 6FABL 2ZOKA 2AJSL 5M95B 4GW4B 1QNZH 3TZVB 4TN9A 2DI9A 2YC1B 2R56H 4EI5D 2O26U 4KK5C 1CLYH 1LD9B 3MXWH 4CMHB 5C6WH 3UPCA 2C5DC 4QRPE 3RDTD 4BFIB 1RZ8B 2EDWA 4Z0BH 5K9KA 4NHCL 2Q76A 4GUPB 1HHHB 4H8WH 5I30L 4P9HL 1NMAH 3TBTA 3OXRB 2HT3C 4WW2F 2Q87A 3KR3H 1II4E 4PJHF 4ZUUB 3CXHK 3JXAA 4QRSA 5DJ8A 2BMKB 3TVMD 4PD4K 3P9MA 1A6UH 1JWMA 4YHIB 1YEKH 3RNKA 1N2RA 1L9MA 1PEWA 2VLJE 3R0MA 4PJEE 5DUBA 1HSAA 1XGTA 2FH6A 3FZUC 4FXKB 4JFFE 4F37K 2K9UA 4OFDA 3VXSD 2AW2A 1AE6H 2YPVH 1X5XA 4J3WA 3EKCA 2JK5A 1BGXH 1I8MB 5C08E 4PBXA 5FM8A 1HQ4B 2FGZA 3WNLA 1NLBL 1FVCB 4HIHA 3EYQC 3WLBA 2HVKA 3NGBB 1T1XA 1RZ7L 1RIHH 1FLRL 4NRXA 1T5WB 4QNPE 1XGUA 4LLVB 3FMGH 1F3DJ 1ZHLB 5CMAA 2NY4B 5ANME 3QCVL 4P0DA 3OKNA 2UYLA 4WHTA 4R7NB 4XP5L 3MODH 1MI5A 4XP1H 5C2BH 4OCNC 1A6TA 4LAQL 5EZLB 3VFVA 4NRZB 1E4KA 4C83A 4XHJD 5DYOA 2JJTA 2DS4A 2NX5E 3MXVL 1HHJA 2NXZB 1RZGB 1EHLL 3RUGB 4JDZB 3BIBX 1MIML 4L5FH 2F15A 5EIIA 4JO2L 5JIPA 3VI3E 3MJ9A 4OIBA 5JLZA 1DDHB 4QHUB 3ECBA 4R2GB 3TV3L 2D9CA 4EVNB 4C4KT 1HNFA 4PJHA 4MA1B 2A2QT 4HFUH 1H9VA 2R0KH 1U91B 2DQTL 2X1QA 3QUKB 2L7JA 5JXAL 5JO5A 1KC5H 4YR6B 1I1YB 3QCTL 4GRLB 4LKCA 1P4BH 4XBPB 3KXFD 3OG4B 1LGVA 3VFPA 2I60L 2J5LB 3EJYD 4KUZH 1AY1L 1BVLB 1QFHA 3HZKA 5DZLA 5I1EH 5C8JB 1JRHI 1LO5B 1J1XH 5LGJB 4NYLB 3IT8D 4IIQC 5JHLH 4BZYA 4LSDA 4HW6A 4YX2L 4W6WB 1FH5H 2GJ6A 4Y8DC 4UDTB 3ULVC 2DRUA 5CD5C 3AS1A 5ALCH 1TFHA 5L2KB 2BX5A 3FO1B 5C6PB 1WC7B 2PYED 3MNVB 4G8EA 4BH7B 5EH1A 3VXOA 3VG0H 3SO3B 2FIKB 1PD6A 3BGFB 4U6YB 3ZE0E 2AGJH 4OM1L 4JQXC 5F7UA 3GRWL 1AGFB 1OSZB 5INCB 4K3JL 5E8OA 1CICC 5CD3B 2ARJQ 1A6ZA 2A9NH 4PR5B 4A6YB 1SYVB 2QTEA 4IRJC 2PTTA 5BO1L 5C07E 2CMRH 5KS9A 5IVXA 1BOGA 1FL5A 4WW1A 2ENSA 3GJEB 2Y36H 2RCSL 3JV4A 2OJZL 3L3DA 4AIXA 4PJGB 1IL1B 3P2TA 1ZWIB 3JV5A 1H5BC 4JFPA 4PY7B 3D0VA 4XMLL 1Z0MA 2OM5A 1ZT4A 3CUPB 5D2NE 1CE1L 4EN3D 1UYWL 5IV2B 2Q8AH 4MAUH 3WFHA 5EU7C 1AR1C 2VDMH 4OD3H 1EO5A 1X5GA 3ETBF 1PDKA 3RGVB 1AO7A 3R06A 4MA8H 4NN5B 1B4RA 4TUKL 2ATKA 1G1YA 2EDDA 5L0QC 4PJAA 3HRPA 2VE6A 2FX9L 3P3YA 4HXAL 1LE5A 5F6IB 1NLDL 4LARL 1PJ9A 3SDXE 1NANH 3IU3A 4PRPB 2X42A 2V9TA 1F42A 1MVUB 4OLXL 4X8JB 1S7RA 3LH2H 1EUUA 4WI3A 1JFQH 3W9DB 1A5FH 4XB8A 1F6AA 1DBAL 5CLWA 3IS1X 4EIGB 4MDJA 3KYNB 5CGYD 3BMWA 1NMCB 1TVBA 4ZFZB 1HXMA 4Z7OE 4L4VE 4JPIA 4D8PA 2CUMA 3D25B 4LPYA 3Q1SL 3QUZD 3RVVC 3KLHC 1UB6B 2DD8H 3MZTA 1EJ6A 2HFFB 3PQYD 4JQXA 4XMPL 5I8KH 4X5XA 2ZUWA 1WTGT 4GOSA 4ZFOB 1G6RB 3L3IA 5TE6H 3I9GH 3HHRB 1CICA 4PJ8B 4NZUH 3QWOB 5IM7A 1L7TH 5IHBA 1A7PL 5DD1H 3ZDXF 5IHLB 4BH8B 2EIDA 3LMJL 1INQA 5T1LB 3VFNB 3H2WA 2H3NB 3H9ZA 1FN4B 3MQIA 3QG6B 3MBXH 4I2XA 1PSKH 3CC5B 3WS3B 3BJLA 4UUJA 1ZHKA 3KYKL 3UPRA 4U1GC 3V7AG 2BNRB 2F8VA 1F4YL 6FABH 2AJSH 4Y16A 1ZT7B 3ZKXB 1Q8MA 1XR9B 2P24A 3QH3A 1H3UA 4RGND 5IR1A 3EGSB 1JTPA 4GS7C 1YEFL 4CVZB 1R3LA 4LHJB 4N1EA 3G6JB 4OCWL 2F54D 3QQ4A 4NHCH 3HLAA 4GXVL 5I30H 5F9JB 3VFGL 4P9HH 1UJ3B 4LFHG 3I2CL 5HHXL 4QRRA 3B43A 5B4MD 4QGTA 5DA4A 2B20A 4PBWD 5DMYA 3CMGA 4TQEL 5DHYB 3K4AA 3STBA 1K3IA 2WZPD 4YFLF 1UB5A 3GBML 1EFXD 4M8VA 1QFPA 1VESA 5ID1B 3QQNA 5D5MB 2NY2B 4WHDA 1MHHA 1HILB 1BBJB 2FEEL 2UVEA 4EEEA 4WTZG 3MV9D 3STLB 1CGUA 3O41A 2BVQA 4WJ5B 5HYJB 1UWXH 1CBVL 4Z9KB 2LABA 1Q9WA 3HE7A 5DQ9A 4QOKA 3HNVL 2NMSA 1YN6B 3HG1D 4G8GD 2W9LA 1RZ7H 1VFAA 1FLRH 5C0AB 3W0WE 4Z76A 5C0NC 5C0DB 3NVQA 4W81A 3BQUA 4HFWA 5CBAB 4KJQD 3RY4A 2CDFA 3QUXD 2YWZA 3B2VL 4K7PX 2V2TA 2H2PD 5DT1L 5GXBB 2DL2A 3QCVH 4YBLC 4R6UA 1DEEB 4HK0B 3BIKA 3T65A 1I8LC 1JGVL 4XP5H 3U46A 4ZQKB 1WZKA 4LAQH 4LHUA 2J1KA 3MXVH 1T5XB 2XA3A 1JI1A 3N9GH 4CRPA 1EHLH 1ORSB 4B7LA 3DRTA 1D9KC 1BFSA 4MD5A 3QXDB 4NQCD 1RJYB 5ITFB 4JREB 4UQ2A 3D3VA 4Z0XB 2A9ML 4XNYL 3TV3H 1QSFB 4RBPK 4B50A 3EYFA 1K3ZA 4F7CB 1WWAX 2DQTH 1C5BL 2Z8SA 4HHAB 1BQHB 1KYOK 5JXAH 4OZIB 5KSUA 3QCTH 2H8PA 2XZAL 2UY6A 1KIRB 3P4OB 2I60H 5BXFA 4MJ5B 3NA4A 3S98A 1AQDB 1AY1H 1QEWB 1MJ7L 4QF1A 5GS3A 2WQRA 2G2RB 1JWUA 4ZAKC 1S5HA 4TTDD 4KJYB 1S78C 3MLZL 4QRPD 1DN0A 4YX2H 1XF4B 4UDUA 1LDPL 1CWVA 3CH1A 4JFQB 3EJJX 4N1HB 1AD9B 1BQHG 5CIPA 3ES6B 5F3BA 4MLIA 2RJMA 2VLJD 3MRDB 3GBNL 2AV7B 4PJIB 3QRFM 2R4RL 1NBVL 4XPHL 1NFIA 1TZIB 4JFFD 4CN4A 2J7LA 5ADPL 4OM1H 3RPKA 4X7EC 3FRUA 3GRWH 3S3SA 1I8KA 3U30C 1NGZB 5GIRA 3T1FB 4M1CC 4K3JH 4X4XA 1Y0LA 5HYFA 5ISZB 2FECI 2OOXB 3LSOA 5IW1B 5C08D 1YNKL 2QKIA 3EYSL 3RUGE 3FB7A 3P0YL 5BO1H 3QNZB 4LDEB 3AM8C 3QB7C 1JPFA 3K8LA 3KPOA 5TE7L 4U6XB 3VD7A 2B7DT 2RCSH 3HUJE 2OJZH 4S1RL 4TVPH 3VJ6B 2R9HC 4XMLH 2GSGB 2F8XC 3O4LA 1CE1H 4DFHA 3LN9A 1UYWH 4GW5A 4ODHL 5GZND 4PGEA 2CXGA 2IF7A 3MLXL 1O5DT 5D1XC 2NXYD 4F15C 4HXBL 4PYGA 4KK8C 4NUJB 3WHE0 3U83A 4BFGA 1OP3H 2R8SL 4GG6B 2NX5D 3B6SB 3GIZL 1T1WA 4UIMA 1C1EL 3CVHA 4OKDA 5E6ZA 2GTWB 2OMNA 2FX9H 3WSQL 4HXAH 4RX4A 4ZAKA 2GY5A 4H8WC 1NLDH 4LARH 2ARJA 2NZ9C 2P48B 5FKPB 3IETB 2ICEA 4OLXH 5DO2C 5L2KE 1S7UB 2IBBA 3OHXA 2G5RA 2XFXA 4OKVB 1DBAH 4QT5B 1XGQA 1EH9A 5TQ2L 4QKXB 2ICWJ 4KROB 3Q1SH 3QA3A 4RIRB 4XMPH 3MV11 5T1KB 3JTSB 4ZXBB 4XGZA 5D1ZD 1NAML 3S88L 2EDNA 1EAPA 4S2SB 3Q6FA 4PTTA 3UPAA 3OL2A 4FQXA 1QPPA 1QG3A 5F7WC 4BYHA 1A7PH 2H45A 4PJGE 1BIHA 4P2QB 3O4OB 3C6LD 3LMJH 5DR5L 5F8QC 3H9HB 5E5RB 5ETUA 4QHLA 3T4YB 2XKUA 4N0YL 1K85A 5AG9A 1HEZB 4PJBF 1YN7A 1PLGL 4V1DA 1X5IA 1B0GA 3KYKH 4KHXL 5KVEL 4HX1A 4XWOC 1F4YH 4AM0A 4D0CA 3SDCD 2OQJA 5E8PA 4U2ZA 3SDDD 1P4IL 4OLYL 3DMMA 3EIFA 3PWUB 1AGDB 4YIQB 1UCTA 3KPPB 2EC8A 5C07D 4W4OC 1YEFH 2VLMD 3RBSA 3WKML 4L3CA 1CI5A 4Q6IB 1MHPL 1T66D 5KJRH 3TE5B 4LDOB 4OCWH 4ODTL 1I3GL 1AI1L 1OTUC 2DQFB 3BPOB 4GXVH 4JRYB 4PRPE 1PKQB 5F9OL 2CD0A 3VFGH 2BVOA 4FQLL 1UH4A 1MFCL 3I2CH 5J3HC 5HHXH 3SKOA 3V6ZA 1NC2D 4DTGL 1T1ZB 3R8BB 4L8BA 3DVGB 4TQEH 3EYUL 2P49B 4LNVA 2AQ1A 4UV7L 2B0SH 1MF2L 2BY3A 3BGAA 4HBQA 1Z3GL 3SGDH 2YOCA 3BHBA 1YPZA 2P8PB 1PQZB 2DM7A 3G5VB 2IANB 3GBMH 4MWFB 3VWKC 4I0PB 3V7AE 4OFIA 3LRHA 1JZ2A 2WIIB 3MCG1 1C8PA 1UM4L 3IYLW 4YPGA 4HIJA 4FTVA 2HYMA 1CBVH 2PCPB 1ERNA 1ZGLP 3HNVH 1S9XB 4HZLB 4HJGA 3GMPB 2BY2A 4HKJA 3OWEA 4ZOAA 3PWNB 1OP9A 4GBXD 1EO8L 4O2CA 4JFYB 4PJBA 4X6EA 3B2VH 5DT1H 5EZOL 2BSSA 2BNRE 2OTUA 4NFDA 1JGVH 1X5ZA 4Y4FA 5CJOL 1BIIA 4LVHC 5D2LF 5C70A 5SWZB 4X99A 2DWDB 1OY3B 4YEEA 4KJWD 4L29A 5DJCB 3RZCA 3QO0B 3VCLA 4MVBD 1I1AB 3G6JE 5AD0A 1PEZA 2VXUL 1UZ8A 3QSKB 4YHYB 4GO6B 4UU9B 2A9MH 3HNSL 5CZKA 3BZDA 4XNYH 4ZTOL 3WDIA 2Z31B 4JG0L 1C5BH 1T0NB 5H2BA 1G7IB 2YZ8A 1LO3L 5GRVK 1U8NA 2QADD 3FQUA 1GHFL 4PY8I 2XZAH 4F2MA 4L3EB 2Z93B 3KS0J 2AK4A 1U8HA 2EKSB 1F58L 1XCQB 3FQWA 1KJ2B 5A40E 1A1OA 1MJ7H 1FZKB 1SJVA 2O61B 4Z7UB 5FCUL 5IEKA 1OTTC 4UAOB 3MLZH 2ZNXA 4WI9A 2XOTA 3HZYB 4D0DA 1P53A 5HYJE 4CVUA 1WTLA 1WT5C 2FNBA 4Z7QF 2CK0H 5F93C 4MQ7A 3SY0A 5F89B 1LDPH 3MGOB 4LIQE 4WDIA 1IT9L 1NGYA 5C0AE 4IRSB 2R1YB 3HB3D 2UZIH 3QIBA 4HDIB 3K80A 5D1QD 4EI6A 3ARXA 3GBNH 3VRJB 2HKHL 3PDGA 2R4RH 1U2CA 2X6MA 2C3GA 5DHVA 5IBLD 3QFJA 3MLTA 2ZKHL 3MRCB 2BOBA 5IBUB 4P2OB 2HP4A 1FZOA 1F3JA 2B5IB 3PDDA 1UXWA 4YZFF 4CU8A 5D2LA 2D2OA 1N59B 1QYGL 2NTFA 4XVUD 3QCUH 3VGGA 1YNKH 3EYSH 3QJHB 3MNZA 3P0YH 3NIFF 1AIFA 3NN8B 1CTNA 1S8DB 4QWWC 1R5WA 1KOAA 3RWGB 5TE7H 5IMKA 3V95A 4YFLI 1JMZA 2XICA 1ZVYA 5KTEL 4S1RH 2F74B 3W0WD 4EQ3A 1QSFE 5DD5L 3HE6C 3O6FC 1AGBA 2MCPL 3O8XD 5DUML 1WCQA 5IBUG 4OZIE 5IHZB 1KJMA 4ODHH 3OX8A 3ARTA 3MLXH 5HHOB 1C12A 3OGOE 4UOJA 3TZVD 3VGBA 4HXBH 3PL6C 1LO0L 3DETC 3QIUA 4HH8A 2R8SH 4XI5D 4XP6L 1KG0B 4MD0A 1DJSA 3GIZH 3ZL4H 3SBWA 2Q6WB 3ULSB 1C1EH 1CL7I 3WSQH 5CP7B 4KPHL 1RJLA 2G9HA 1MELA 4PJCA 5LXGL 5GGRA 1U8MA 3BKML 1WT5A 1U8PB 3W5MA 4RZCA 5JW4R 3OF6A 4UT9L 2FIRT 5FYKE 3SHSA 4WHYG 5CSZA 3TNMB 5ICZB 2X4QB 4PJIE 4D0BA 4LEOA 4JRXA 4C59B 2L4OA 1GZPA 4U1MB 1ZXQA 2NY6B 4G6KL 1OPGL 1U58A 4ESKA 2A6IB 5TQ2H 1NJ9B 1FNEB 3SKUD 3WYRA 3GMOA 5ISZE 3G5XA 3MNWB 4XCCL 5ITBL 1TTGA 1NAMH 1RHFA 4TRPL 3F7PC 3S88H 1V8HA 3HKFA 2GK0A 4PG9B 5KN5A 5EBMA 2YD2A 3SGKC 2YD3A 4LSSL 1NCUA 3G6DL 3VD4A 1XF1A 2IH1B 3T3MF 3O3DB 4XPGL 3BZ4A 4L8SC 4U31A 5KSAB 4HC1L 4N8PA 4X4YA 4MAYA 5DR5H 4CMMB 2NR6C 3OAYH 3A6CL 4FQ2L 4N0RA 2VAJA 4YGAB 4N0YH 3W9EB 5A2JH 4YFEA 2KPNA 1PLGH 3O6FA 4GRMA 1NH6A 4TULL 5KVEH 1ZA6A 3O3EB 1WBYB 4PGJA 1CFQA 1JHTA 4APQC 4OLYH 3FTGA 2VMFA 4L9DA 2VAAB 4ZODA 1F4WL 3U7YL 1MFEL 4GG6E 3BZEA 2ADGB 2R1XA 4KUCF 4JFDB 4C56B 2F9BT 4TUOA 3WKMH 1E27B 5I6XB 3WCYA 1MHPH 4F3FB 4ODTH 4JZNA 1I3GH 1AI1H 1IVLA 1FAKT 4R2GD 5F9OH 4Z77A 1J0ZA 4XCEB 5E6IC 2XWBB 4P46A 1YEHL 1MFCH 3BO8B 3SKJH 4BSVA 2F19L 2R23B 4DTGH 3EYUH 3OBAA 2CJUL 3H3PL 4I8DA 4G42B 3AXLA 4UV7H 3DSFL 4GAYA 4LLYB 1EEZB 3U1SL 5DSCA 1Z3GH 5AUMA 1T89A 3VRIA 1IC5L 4X6BB 4U1KB 3DROB 3EHBD 5K9OA 5DRNA 3OV6A 3GKZA 1A3LL 5C0BA 1JGEB 2OX5A 5KVGL 2VB5A 1M7IB 3KYOB 1S7SB 1UM4H 4QRTA 4LCCC 4RMTA 4OI8A 4OZFB 4Z78B 2R2HA 4OZGB 2NNAA 5I8EB 4ZUSA 5L2KD 4P2QE 5C2UB 1UENA 2ZG1A 4UV4L 4L8SA 3H0TA 1DSFL 1IAOB 5I8CB 3TIEB 3B9KA 1EO8H 4LCYA 1ACZA 1D5BA 4F7TB 4XNMB 3PHSA 2H9GA 5EZOH 3OKEA 3UYOD 4XCYB 1CLOL 1MIEL 1LO2L 1MLCB 5CJOH 3FT4B 3P11L 3TJHC 1PG7W 4DFIA 5DZNA 4OZFG 4L9LA 5GRZA 1MOEA 3W5NA 3F12B 4MNQA 3CFKA 1DQDL 1JUFB 4JRYE 2VXUH 4MB3A 1PKQE 2P43B 5DJ2B 3U4AA 1WFNA 2HWZL 4JFXA 3QDGB 3HNSH 4JY5L 3FOLB 3DVNA 3SE8L 2DYPA 3RWDA 1NFDB 4ZTOH 1U3HA 4XXDA 3MRBA 5HGAA 4JG0H 4R96B 2WBJA 4U6HB 4X9GA 1LO3H 3X12B 3MA7B 2EC9T 3HC0B 1GHFH 1OVZA 3MRJA 2LAGB 2IFFL 1SHMA 2IAMC 3LRGA 2R1WB 3RGVD 4BQBA 2IANE 4ZUTB 1F58H 5DJ0B 1KTDA 2NY7L 4LPCA 5EC1B 4OFVA 2GT9B 2VO5A 5SX4H 5FCUH 2DQUL 1RY7B 5T3XE 1S7WA 1GC1L 2IPKB 2BJML 1JNHB 4PRPD 5I17B 3MV8D 5DZOA 1J05A 1E6OL 2HT4C 2VQUA 1ED3A 1CK0L 4L4JA 3ZT5A 4WO4D 1IT9H 5HYQA 3WFEL 4I3SL 5T1MA 1WCBA 1OGAB 4GSDL 3TA3B 3ZYIA 4AT6B 4HLZG 2A6DA 1DFBL 4CNIB 1W0VB 3QHFL 1CFNB 3REVB 2HKHH 5K93A 2E5EA 3DX8B 3WXWL 5ACZA 2ZKHH 3R4DA 4R4FL 5EU4A 3B9VA 4ZUWB 2CPCA 2YEZB 3T4AB 5CSGA 3GRWA 5IIEA 4NKOB 5SWZE 2VABA 4N5EC 4E5XB 3IRPX 4R90L 5F71A 4PJ8D 1QYGH 2GW5A 2VQTA 5DI8A 1JZ6A 3MJ8A 1EHAA 4J2XA 3ARDA 3U6RA 3T3PF 5I1DA 3STZB 3NA9L 4IOFC 3QIWC 3VMPA 4NN7B 1RURH 5KTEH 4JANA 3ZT7A 4FQIL 3ARWA 1TCRA 5DD5H 3REWA 1HI6B 4PGBA 1O0VA 4G43A 5DEFA 2MCPH 5DUMH 4LFHD 4M7ZC 2Z0BA 2BNRD 3KPSA 3ZTJG 1RVFL 2V5MA 4L3EE 5LCVL 2JCCB 1R5VB 1LO0H 3VWJB 3AC0A 2PW2A 1YY9D 3NCYS 2IAMA 4XP6H 5IWLC 3IGAB 4Z7UE 4YHPA 2JJVA 5E2WL 3ARGA 1GYAA 1HQRA 2A77L 3JWDC 5E0QA 1S9VB 4WUUA 4KPHH 4PIRF 5FCSH 4YDJB 3KDMA 2EXYC 4TUJB 3FCTA 5LXGH 3O2WL 1EERB 2OR8A 3VD9A 1JWSB 3DX7A 3JV6B 3CSPA 3BKMH 3FONB 3Q48A 1OW0A 1A6AB 2WINB 1FRGL 3IKCB 4HT1L 4UT9H 5A2KH 4M61B 4WFFE 2NY0D 1CDJA 4OFYA 5FGCB 3W82A 1QKZL 3I6KA 4G6KH 1OPGH 3GIVB 2X41A 2A73B 4Z5RB 1WAAA 2F5AL 3ARFC 4IJ3C 3UYRL 5IUSA 3V4PH 4P99A 4YHNB 2A1WL 2C3WA 3HA0A 4KAQL 4XCCH 3E8UL 4JZJB 5ITBH 4TRPH 4ENEC 1RHHA 2A83B 1FNSH 3TPUB 5C0JA 5HYJD 3U2SB 3E6FB 1LILA 5LGHL 1PY9A 1DUYB 4LSSH 3TBSA 3WUWA 2HTKC 3G6DH 1CS6A 4KKBD 4P5TC 5C0AD 4XPGH 4XNZC 4HC1H 3RVTD 5MI0B 1KLFA 2A74B 4I5BA 5F7DB 4PRHA 3BP5A 2C3VB 3A6CH 4FQ2H 5D7JA 3EFFA 3WE6A 1KIPA 4DGIH 2BVPA 1NGQL 2HTLC 1ETZA 3AROA 4LVOC 5HHOE 2QSQA 4TULH 3ARZA 5AEAA 5EZJA 4KTDL 1LMKA 3C08L 3BH9B 3IJHB 3RX5A 4LKXB 3IDIB 4HQQL 4JLRA 1F4WH 3U7YH 1MFEH 5C0FA 5BMFL 1IFHL 5FGBC 4MMXC 4WFGE 4EI5C 1T3FB 4AK1A 2MMXA 1NBZA 3A6BL 3RDTC 2DAVA 3VFOB 2FX8L 3NCMA 4PJFF 2XN9B 3C60B 1QFWI 4NM8H 3V0VB 3FQNB 1YEHH 5D6CA 4JGUA 2F19H 2YPLB 1F4XL 2VWEE 3LS4L 1UCBL 5GS2D 3TVMC 2CJUH 3H3PH 3AMLA 5EBWA 3U1SH 3LD8B 4OCSL 5DJ6B 3MRKB 3MUGB 4KQ4L 1IC5H 3PWLB 4MB4A 4G6ML 3QDAA 3TBVB 3OJMB 5JOFA 1A3LH 3ARFA 5KVGH 1M71B 3ABZA 2SEBA 1BZ7B 5FGSA 3TH3T 4PYHA 3NZHL 3KHOA 4JGJA 2YD4A 5DMIL 5BS0A 2CDEA 4X9FA 3MV7B 4EDXB 4ISVA 3QI9D 2AJ3A 4HSQA 3ZYOA 1QLRA 5F3HA 1JE6A 3KWWA 3L3KA 5FYKD 3AFLA 5CCKL 2H6PA 4UV4H 1IRAY 1DSFH 4X9BA 3W11D 5TF0A 5CKAA 2J8UB 5GHWL 5D5MF 5EU5B 1P6AB 1NCTA 4XH2A 4POZD 4LGRB 4U1LA 5T5FL 5DQJA 1TVHA 3EUUA 3RVUD 5ISZD 1CLOH 1QUNA 3IS0X 1MIEH 4YAQB 3L5XH 3ZKSD 1LO2H 5IJVA 5CKGA 3ALPA 3P11H 2P8LB 4WU7A 1LK3L 4C56E 4JFDE 5DC0A 1KB9J 4XPTL 4BUGA 2Y06L 1JF1A 2FJGA 2NY3B 1RMFL 1YJDH 4KDTC 5IVZA 1DQDH 5FGBA 1QPXA 3EO1B 1ZVSB 3PHOA 3MYJA 4UBDD 1J0KA 4YHOL 4P5MA 5HGBB 2HWZH 2UY7A 4PJFA 4B5EA 4JY5H 4WU5B 3SE8H 3WEXB 1NUFA 3BW9B 2WSKA 4QY8B 3DHMA 4EXPX 5J13B 1U8OB 2V9RA 2MQ3A 4JE4B 1NSNL 1EGJL 2P8MA 3EBAA 4QHNA 1AGEB 1BM3L 2WNGA 3TVMA 3MRHA 2QHLA 4UOW1 1L7IL 5EPMB 2IFFH 5SWQA 5E4EC 2C4FT 3VU2A 3BDBA 4JZOA 1JGLL 4DUXA 1N3NB 4HK3J 2NY7H 3EJYC 5CGMA 2XPGA 5CZXD 3S3PA 2JJWA 1KJVA 2DQUH 4UOW0 1FZMB 5I66B 4A2LA 1GC1H 2BJMH 1RZKL 5FDWA 1E6OH 1B90A 5KAQF 1CK0H 1DVFA 2EIEA 3WFEH 2QREB 4I3SH 2A6JB 4GSDH 2D0HA 3T0EB 1Z9MA 1DFBH 2J88L 1NGPL 2B8OT 1S7VB 3QHFH 3O2VH 2GY7B 2R2BB 2R2EA 5T3ZL 4KROD 5C0IB 3FB8B 3WXWH 1N0XL 1A9EA 3ZKND 2P47B 4R4FH 3FO9A 3QZWA 5T1KD 2I5YL 4ZXBD 5EO9B 2BCKB 3A67L 4BFBD 4ODVL 5GGQL 4R90H 1KPVA 4ZUVA 5SWSB 4L1DA 5FECB 4NPYA 4A6YL 5IQ7L 2VYRE 5AZEL 3PV7A 4HG4J 3NA9H 5GSVA 1FFNB 3BEVA 3I75B 5C86A 3L3JB 3QDGE 1V7NL 3G04A 4FQIH 3ZE2E 2HLAB 1NFDE 4LLUB 5JUEL 4NT6B 2VQ1B 1S9KC 4M1GL 4Z95L 1F02I 2Z92B 4JJ5B 1IEBA 3QUMB 4Z7NE 1KUMA 5HDBF 3W81A 1JZ7A 2VISB 3RJDA 5T1DL 2G5BB 3RIAF 1RVFH 1E28B 4OD2B 1N6UA 5LCVH 5F8RC 1UACL 1T7XA 1FG2B 4XNUL 3OG6B 5K9QI 5E2WH 3KXFA 4RFNB 5K59F 2A77H 2FZ3A 3E3QE 4JRYD 1NC4B 3U82B 2WWKO 3O2WH 4YDIL 4WV1B 3U9UB 4JM2B 4WUKL 2COQA 1OGAE 2X4NA 4Y5XB 3T1WA 1FRGH 4HT1H 4I4WA 1U95B 3RWFA 5KZCD 4NSKA 3G6AA 5B3JE 1VPOL 2HJLA 4YC2C 3GMRB 4NNXA 1QKZH 3QXAB 1EPFA 3GFUA 2PYEA 5EULV 1P4LB 1G7MA 2IAND 4IMKC 2F5AH 3UYRH 4I0PD 1XZ0A 3CVIL 3DUUB 1NEZB 2ZCHL 2A1WH 4G6AD 4KAQH 3E8UH 1CIDA 4XC1L 4JVPA 4QEGA 3CNKA 1WWCA 5T3XD 4ZFOL 1NAMA 5HGHB 5IB1A 3RL2B 4L1HA 1CFBA 4NQDB 2BVYA 1QR1A 1Q9LB 5LGHH 3V4UL 1MLBB 3FT3B 1B4JL 1M7DB 1RUML 2DBLL 3BD5A 5FUZL 1AKJB 2BNQA 3EJZD 5JXEC 1KIUA 1FLTX 2B1HL 4X6CA 5HTSA 1HHGB 3B2UD 4ZOEA 1NEZG 3IRZA 2V5SA 3NCEB 1NGQH 2EEAA 2FDBP 1G7LA 4G9DB 3H9SA 3GMNB 3BP4B 5IB3B 3IDXL 3VXTB 4PJ9B 2ARWA 1LEIA 1G7QB 2JCCE 4KTDH 4EN3A 3C08H 5SWZD 4CUCA 4N0UA 1UVQB 4R0LC 5I16A 2DMBA 4HQQH 4PJDB 3TYFA 5KSBB 5AWNL 3H7BB 1MCOL 5BMFH 1IFHH 1ND0A 2D9QB 1WEJH 5F1SA 4Y5VA 3MUHL 4RGNC 1D5MB 1A4JA 4PJXB 5FA3B 3SDAC 3DIFB 4Y4HD 3BP6B 1XF5B 3A6BH 4LU5L 2FX8H 4F8TA 1KACB 1SJEB 1WUNT 3MBEA 2Z31D 3IDJA 3OXSB 1F4XH 3LS4H 1XFPA 3GM8A 1MHEA 1UQSA 3MRFA 2Q20A 1BLNB 4QCIB 1PFCA 1EFQA 1UCBH 5FGCE 2OI9B 5B4MC 3MRIA 3UBXA 2C7UB 4L3ED 3SPVB 4OCSH 3QEQB 4CBPA 5B8CB 3UC0L 4KQ4H 4G6MH 4LMQE 1MCIA 2NTSP 5GSRA 4IMKA 4QLRA 1W0WB 4JVWA 4QXTA 5IMOA 1OLLA 1DE4A 3QUZA 3NZHH 3PQYA 4KTEL 5I1LB 1FL3B 5I74C 3JTTA 5DMIH 4R3SA 3OPZL 2V5YA 5EOTA 3OR6A 2GQHA 5LGKA 4HWZA 3WIHL 4IRSD 3UJTH 2WBWB 1GGIL 4P49A 4PV8B 3PJSA 3FB6A 4LLDA 4WFFD 3DJ9A 4LIQL 1BBDL 3PL6B 3D48R 4ZPTB 2C4FU 2Z4QB 3HR5B 4P4RB 4ZOBA 5JQHC 5GHWH 4DCQA 1W72B 3NCBB 3CIQA 4KJQC 5T5FH 4P2OD 3BAEL 2H2PC 32C2B 2DQIL 5HGDB 5C3TA 4G8FA 1KIQB 4XCNB 3DHJA 4M8QA 3CFIC 2X4SA 1LK3H 2EDFA 2G60H 2HT3D 2X4OB 4F7MB 1XR8B 5E9DA 2LE9A 4XPTH 3WXVL 3I02A 5GS1B 2UWEF 5BVJA 2KDGA 1RMFH 4H0IA 3AU1A 2KL6A 3RWHB 1UJTA 5IFHL 3D69A 3SGDI 2ENYA 4YHOH 1LNUB 4MA3B 1SQ2N 2CDGA 1JK8A 3EFDL 2YPLE 1G84A 4K8RD 5HHNA 4PFEA 2FEEI 1VERA 1EGJH 1T04A 2ZG2A 2QRCB 5HHOD 3PABB 1DBML 1TVDA 1I1RA 5TE4H 2YN3A 3RWJA 3QQ3A 4UQ3B 3MOAL 1L7IH 4QTHB 3EYQD 1JGLH 2WLZA 2GJZA 3SOBL 4WFGD 5I1AB 4Z6AT 5IB5B 4G8IB 2ILLA 4LBEA 1ODAA 2AABL 2V2XA 4TTDC 1KV3A 5C0GB 1RZKH 1UADC 3MV7E 2AKRB 5J9PA 4XAKE 2JJUA 3MV9A 4K3EL 1DQJA 1IC7L 2BC4B 5DJXA 4MD4A 4NKDB 3FO2B 3D39B 2J88H 4NZRL 5D72L 2J8UE 3PG2A 3CFBA 3HG1A 2IALA 4JHWL 5FYKL 5DRWB 9CGTA 2X44D 2FJFB 1N0XH 4ORZC 3D0LB 2EYTB 3GSUA 2ZSWB 2VNCA 3ZTNH 5IW6B 4G80B 3T2PA 4G6FB 3LKOB 3O0RL 3HN3A 3I3DA 2I5YH 3QUXA 3A67H 4U33A 4ODVH 5GGQH 3KJ4B 2VL5A 1PZUB 2XV6B 1CD1A 3DOSA 3BUTA 4MXQD 4J4PC 3C5SA 4R97B 2UWEA 5CJXA 2UUDK 4A6YH 5IQ7H 5AZEH 4NOFA 1JNLL 3L7EA 4Y19B 4R4BB 4LSRL 2GAZA 3VA6A 5KSAD 5L2JB 5HI4C 4U1HB 4U1IB 1V7NH 2EDTA 1XGRB 2DM4A 4F7EA 5JUEH 4DEPB 3LKSA 4M1GH 2XXCB 4GKNA 1F00I 4NGHL 3MLSL 3BPCA 1G7PB 5ELIA 5T1DH 2ORBL 4M3JA 5GZNC 43C9A 4NO5A 4PRIB 4OFKA 5EWIL 4RAVA 1IGYB 2NXYC 4C56D 2XACC 1U3ZA 2IMNA 4HUXA 1CD0A 1V3KA 3V8OA 3G9VA 4NQUA 4OB5L 3C6SA 4OCMC 3MOQA 2IADB 3QUYC 3PHQB 2IBGA 4YDIH 1I1CA 1ZLWH 1IGJB 4PJ5A 5IG7B 4WUKH 4DUWA 4V2BA 3C5ZB 1BJ1J 3T0EE 2W59A 3BXNA 3O6KL 1KT2A 5DMGD 5FUOL 4BZ2L 5IGXL 2X89D 4NCC2 1K8IA 1VPOH 1URLA 3IFOB 5FYKU 2JLLA 4FQJL 4MJ6A 4IRJD 1RUAL 2QSTA 5EOQL 2ERJC 3FQTB 1BQSA 5I75B 3X14B 2YXMA 3V5DB 1WWBX 2ZOKB 2VLJA 3VG9B 1BZQK 4ZO9A 2AAVA 4XC1H 1TNNA 1RK0B 4NQXA 5SWSE 2AJVL 3RI5F 5B38B 2FO1A 2P45B 3V4UH 1R24A 3BEWA 1HK6A 4U1NB 5K9KB 1B4JH 3RY5A 3CXDL 1RUMH 2DBLH 5FUZH 3TBTB 3ROOA 5A43C 1RUPL 2B1HH 4QRSB 5DJ8B 3L3HA 5TPWL 2BP3A 5J1SC 3C6LC 5DS8B 2XTJB 5TJWK 1TZHA 1JGDA 5KG9A 1H15A 1XGTB 4U0QB 3IDXH 5B38G 1CE6A 1A3QA 5CEZE 4P2RA 5ANMA 1GIGL 1K4CA 1KTLA 1I7TA 5DC4B 1OP5K 3QXVA 3SDDC 5AWNH 3FHQA 3MRQA 1YJDC 1N7MH 1MCOH 1B3JA 4JY6A 2JK5B 4M7KL 1MAJA 1MJJA 1S5IL 4OQTH 5HYSA 4HH9A 3U0TA 1KB5B 3QDGD 1FL6B 5BVPH 4HGWB 5FUCE 4LU5H 3WLBB 4QTIL 2HVKB 1T1XB 3ZMRA 4JN2B 4LLQA 4NRXB 5DD0L 4IRZL 1DR9A 1JI2A 1XGUB 3TM6A 5I18L 3O2DA 3WNOA 4R9HA 5D2NC 3ARUA 5CMAB 4PS4L 1NCWL 1JP5A 2PO6A 3MRRA 5L9DL 3P40A 4WHTB 1D5ZA 3UC0H 2DQHH 1MI5B 4G7VL 3VFVB 3FB5A 3ARSA 1V7ML 3VFRB 4NQDE 4X98B 1HHJB 5J1AA 4ONGL 2E7BA 4J23A 4KTEH 3CAFA 5CJQL 3OPZH 5EIIB 3L95A 2K7QA 5D1ZA 5JLZB 3WIHH 3TA3D 4HS6B 4D9LL 1GGIH 3ECBB 4WW2B 3P4NA 4PJHB 4LIQH 1BBDH 1LO4L 3VI4E 1A47A 4NC2B 3ZSTA 3GMLA 3V6BR 1JVKA 5ILTH 3C6LA 4GBXC 3OGCB 2QQKL 4LKCB 3BAEH 3MJ7A 3R0NA 2DQIH 3ARVA 4PJDE 5KSBE 3HZKB 4NQEA 4OZGF 5E94B 5GGTL 3T0WA 4K7FA 3SDYL 3PUCA 1H8NA 1Q0XH 3LEVL 5EO1B 3O6LL 4PJXE 3SDCA 3UBXI 1AHWA 1KCUL 3TO4C 3D85B 4UTBL 4CADA 2LVEA 5IFHH 4P57A 4MVBC 1OAXL 4OSUL 4U7SA 2GJ6B 3I6LE 4X0KA 5GZOC 5F9WC 1C5DA 2I26N 1JMXA 3EFDH 5JA8B 2EDLA 4RA0C 5I0ZA 4O51A 4D9RE 4ZO7A 2ITCA 5I15L 1DBMH 1KXQE 1EX0A 3RTQC 2Q3ZA 5TDOA 3QEQE 5GS2H 3ZHDA 3MOAH 2KZ1B 1G0DA 2QADC 4MNHA 4U6VL 3TIDA 5E8OB 3RFZC 2F53A 1A6ZB 3SOBH 1MFAL 4XPFL 5F70A 5C0ND 4LF3B 3SE9L 5L88L 3GKWL 1QD0A 4FABL 2AABH 1CDYA 4HMEA 1BOGB 1FL5B 4X7FC 1R3JB 5HHMB 5GJTL 3D5OF 5EC2A 4K3EH 5CILL 3FQRA 2Q3AA 1IC7H 4L8DA 2AXFA 1P7HL 3F6LA 4JFPB 4XZUA 1WV7T 3QNXA 3NACL 1WFUA 5FF6A 1ZT4B 3TESA 4MX7A 5D72H 3HB3C 4KC3B 5LQBL 4JHWH 5D1QC 5FYKH 5DJDA 4KJPC 1D9KD 3WFHB 1TITA 3O0RH 3PGDA 4GBXA 3I6GB 3R06B 1T6WA 2ATKB 5AYQA 1FIGL 1N5AB 5FXCH 3BKCH 2Y5EA 1LE5B 3AS0A 4XVUC 1JNLH 3FRPA 3MRGA 3VFWA 3IU3B 1TPXC 2Q7YA 1MJ8L 1VSCA 3IXTB 2WP3O 2RIKA 2ZG3A 3DURA 3UJJL 1SMAA 3VXUA 4LVNB 3IVKA 3V0WL 1CXFA 2K3TA 4NGHH 3K1DA 2KH2B 3MLSH 3EYOA 1KB9K 4K8RL 2QLVB 3O8XC 4RGMC 4MQSB 1HXMB 1WK0A 2ORBH 4JPIB 3S96B 1T2QL 3A0OA 5EWIH 4NDMB 5HHPA 3TZVC 5HJ3B 1MQKL 1S7QB 1PY4A 2XNAA 4X5XB 4XI5C 4CMHC 1HE7A 2AQ2A 4OB5H 2V5TA 4JFZL 1BAFL 2KQMA 4P4KA 3GSQA 2LTQB 1BJ8A 3C60D 3FJTA 2VKXA 3HI5L 1ZGLA 1CDUA 4MGXA 5J56B 1VACA 3DRQB 3ULUF 4BKLB 5FUOH 3O6KH 4JB9L 3D39E 5FFLA 1INQB 4J6RL 4BZ2H 2VZVA 1ZVHA 3EDEA 4RMWA 4WWKB 1VADA 2XZZA 4ORGB 4HUVA 4FQJH 3UP1A 4I2XB 5TH2B 2O5ZL 4C4KO 1RUAH 1ZHKB 5EOQH 4YO0A 5D1QA 2Z91A 4OLZL 4OQ1A 1P2CB 4Y16B 3T4NB 3TN0B 3QH3B 2XWJB 3GUTA 4JG1L 5IR1B 2QEJA 2AJVH 4PP2B 2CO7B 5ESQA 5EU3A 1R3LB 3MV7D 4LCUA 1D5IL 4Y19E 2MNUA 4P5KB 4XAKD 3QQ4B 3HLAB 3J7HA 4RA3A 1KXTB 3BJ91 3CXDH 3PP3K 2QL1A 1ZLVK 3NGBC 4WVRA 3G08A 1RUPH 4QRRB 5TPWH 3CXHJ 4PD4J 3WO4B 3LHPL 1U41A 4N5UA 2DKUA 3W0WA 2AERT 2NY4C 3QHTC 4HUUB 2DI7A 5FB8B 1QVOA 2FLBT 4PRIE 4DAGL 1NGXA 1NBYA 1YZZA 4HG4K 1RIVL 1GIGH 2DJUA 4OAWB 1T22A 2ZSVA 3P77B 2NY3D 1FVDA 5F6HI 3UTZB 1T21B 2DTSA 3TZVA 1IEAB 3ULVL 4M7KH 2NXZC 1S5IH 5F9DC 4DGYL 3O41B 1LD9A 1LE9A 3VDBA 3ZHLA 3HE7B 4QTIH 1VFAB 4R2GC 4O58L 3LQZB 5DD0H 4IRZH 4MA1C 2NZIA 2W1NA 3OXRA 2GHWB 3BQUB 4PV9B 3QISA 3FN9A 4HFWB 3WFZA 1X7QA 1EUTA 5L9DH 3U0PA 4KGJA 4YHIA 4GH7B 4GRLC 4ETQA 4JQIL 4F9LA 2QQQA 5IMLB 1EO7A 3IDMB 4CVXA 3U46B 1BD2E 2J5LC 4G7VH 5CINL 3M07A 4FXKA 3OAZH 5CLTA 4OLUL 2XI9A 4P3CL 2PYFA 4B0MM 3S37L 3EZJB 1IKNC 4YHZL 2YRPA 1A7QL 4H25A 4ONGH 4MD5B 5CJQH 3UX9B 2A0LD 5T3XH 1TJIL 4DN3L 4XVJL 4UQ2B 3D3VB 2DQDL 3NIGE 3T0ED 4D9LH 1J5OL 3PWPE 3N06B 1K8DA 1CGXA 3EYFB 2XTJE 4J7RA 4MSWA 1NDGA 1BFOB 3SO3C 5B3NA 3BGFC 4DW2L 5C09A 1UZ6F 4LLVA 1P7KA 4JQVA 2IWGA 2E9IA 2QQKH 1EHNA 3TCXA 1JYWA 1A1MA 1OTUD 4UMGA 1WQVT 4WI5A 4KZDL 5F6HJ 3BN3B 3SE3C 5SWSD 4QF1B 5GGTH 4R7NA 3SDYH 1JWUB 1S5HB 3FFCB 3O3BA 1UT9A 5FV2A 3LEVH 3O6LH 5EZLA 1KCUH 1JNJA 4UTBH 1OARH 2RQ8A 5DF0A 4LSQL 1OAXH 4OSUH 4TNWF 4UDUB 1RZGA 3IFPA 3CH1B 2VJXA 4P2YA 2NQCA 1FE8L 1DDHA 3HUJA 1OHQA 2FGWL 3VWKD 4WFEE 5I1KL 4E41B 3VXMB 5I15H 4I13B 1Q38A 5J12B 2DLFL 4CKVX 4HV8A 1RSFA 1I3RA 3JBG7 5CEZD 4Q2ZB 3FRUB 1GVIA 1MI5E 1I8KB 4U6VH 1MCWW 5GIRB 1VCAA 4X4XB 1Y0LB 3RGVC 4XBPA 5DA0B 4NN5C 2XQYK 1MFAH 3LSOB 3TCLA 4IOIA 1EVTC 5C0CA 1NC4D 3RKDC 3SE9H 2QKIB 3WIFB 5L88H 3FB7B 3GKWH 4JR9L 1KNOB 4FABH 5I73B 5C8JA 1LO5A 3BOVA 3DGCR 5F6IC 4JO1L 1I85A 1JPFB 4JM2D 2OJEA 4Y2DB 4FMFA 5GJTH 2X70B 1ORQB 2Z9TA 1J87A 4PJHE 4M48H 4UDTA 1WFOA 2CIKB 3NACH 1ZV5A 2WIMA 4HIIA 4M6OL 3KLAA 1LEKA 3O4LB 3SO5A 5LQBH 2B1AL 4GW5B 1WC7A 2OMBA 4PGEB 4UNUA 1NMCC 1IAKB 3GNML 1QLEL 4R7DB 4CW1A 4WNQA 3SDAB 4UINH 1IJ9A 5EUOF 2R4SL 4UB0L 1T0MA 4NQDD 2CO6B 1FIGH 5CD3A 4PJ8C 4X7DC 4PR5A 4A6YA 1SYVA 4M62L 2IMMA 2GJ6E 5M94B 2ARJB 1AKJD 1MJ8H 2ICEB 1T7VA 1AXTH 3UYPA 3UJJH 4HK3N 3OHXB 3UAJC 3EOBA 1WZ1L 3V0WH 2ZOLA 1XGQB 4K8RH 2XWTB 4PJ9D 4RMQA 4GAJH 4DKFL 1T2QH 2R0LL 3V0AC 1WITA 3QA3B 4WHYH 2IPTL 3ROLB 3RNQB 4FQCL 4LCWB 3ZKXC 2H26A 4QHKI 1HYRC 1OAQL 4LLWA 1XH3A 1EAPB 2ZUUA 3RHWK 3Q6FB 4PTTB 1QACA 1RJCA 4WWID 1CFVL 3BDYL 1BAFH 2I07B 4FQXB 3I6LD 5DVOA 4Q97A 5HHME 3GGWA 3HI5H 1S9YB 2LAAA 1WZLA 1G0YR 1UJ3C 3V6FA 5FOBA 4XP9L 2P5WA 4PRPA 4D9RD 3MV8A 2P5EA 4J6RH 5ETUB 1MVUA 4QHLB 2XY2A 1Z9SA 4WO4A 2APVA 1YN7B 3QEQD 2O5ZH 3TLRA 5JOPE 3O45A 2X4PB 5EIVA 1B0GB 1A64A 3QP3A 3KYNA 4OLZH 4AM0B 5E8PB 4KMLB 5F7MC 3DMMB 3OMZA 2NY2C 1OGTA 3ME0A 4JG1H 5JHDD 3RY6A 3SQBA 4TSAL 2GIYA 2FR4B 2Y25A 3CDGA 3K81A 4ZFOA 1D5IH 1NGWB 2MWCA 3NPSB 4O2FA 2YA1A 1UG9A 4PLJC 2BVOB 4KKBC 5ESVA 3PL6D 1WBZA 3SKOB 3V6ZB 4P3DA 2XY1A 3LHPH 4L8BB 2Y07L 3FAXA 5D6DC 2LV4A 2XKNA 3HRZB 3QG6A 4DAGH 1YPZB 25C8L 1RIVH 1YY8A 4HGKC 2FO4B 3TO2A 4FFWD 3L5IA 1RFDL 3ULVH 1XR9A 1U2HA 1IKFL 1JL8A 4DGYH 4YPGB 3DV6A 3E0GA 3LB6D 5D7IF 5JQ6L 1UM5L 1JJUA 1TETH 3CX5J 4MQTB 4JREC 3G6JA 3HS0A 5I2IA 4YQXL 3GBLA 4O58H 4HJGB 5F9JA 3X3GL 4HKJB 1BQUA 4U4BA 2APBA 3CZFA 1FV1A 3HPJA 2X7LB 4I2XE 4O2CB 4PJBB 3O6ML 43CAA 4X6EB 3P9LA 2BSSB 2EDKA 2OTUB 2BSTA 5EORL 3H3BC 4JQIH 1GRWA 3T8XB 4Y4FB 1EA9C 3RWCB 5CINH 35C8L 2EO1A 4OLUH 4P3CH 3LY6A 4X99B 1D6VL 1AGCB 1UWGL 2X09A 5CUSL 3S37H 4JHBA 3P4LA 4L29B 3RZCB 3VCLB 4YHZH 1YQVL 1HILA 3M17A 5AD0B 3STLA 4M6NL 3WLWC 3TP4A 1TJIH 1UZ8B 1HH9A 3HNTH 4DN3H 1WJ3A 4XVJH 4NKIL 5HYJA 4OZFH 5MHSE 1J5OH 3WIHA 3D39D 5EBLA 1QRNA 2CH8A 4QRRE 4APQD 2CRZA 3S5LA 4DW2H 1ZSDA 1MSPA 2HN7A 3WKNA 2Y6SD 4QO1A 2V7NA 1U8NB 3W11C 4G6FD 3FQUB 5CBAA 4POZC 2VR4A 2EE9A 5D6DA 1YMHA 4F2MB 4KZDH 2IPUK 4KI5F 1M05A 4JEGB 2AK4B 1QFWM 3QUYB 3CFEB 3FQWB 5DXWA 4N68A 4W6XB 1A1OB 4H8WL 4ZQKA 1HKLL 4PBVC 5IEKB 5BOZG 2EYSB 4D0DB 4Y19D 5KANI 1A6PA 1JYVA 4LSQH 5D96B 4D3CL 4MQ7B 3PIQA 4NO2A 4P23A 3ZDXE 5IEHB 2C1PA 4WDIB 4UBDC 1NGYB 1RJYA 1N0LA 5ITFA 1FE8H 1MRCL 1F6LL 4Y1AA 4KXZI 2FGWH 3ARBC 4EXKA 4EI6B 5I1KH 1QLFA 4K23L 3SGEI 2YD1A 4RBPH 4URTB 2DLFH 5DHVB 1MPAL 1MAML 4PRID 3MLTB 1BVKA 1BQHA 4NN6B 4OZIA 2BOBB 4YNYB 4HLZH 1FZOB 4KRPB 1F3JB 3P4OA 5D2LB 3NFPB 4MJ5A 4KI1A 4LMQI 1WWWX 4XCFL 4GLRI 4JR9H 1QHOA 1JNNL 2K1MA 3QDMB 5CZXC 2DI8A 5FO9A 4JO1H 4X6DF 4NKQB 1R5WB 2YUVA 2FD6L 5IMKB 3C5ZD 3D3VE 2I9LB 4G6JL 1XF4A 5LAXA 2LU7A 4OM0L 1AD9A 3TJHD 4Q58C 4M6OH 4XWGL 1AGBB 1T1YA 3QI9A 2B1AH 3CDYA 2AS5M 2AV1A 4AQOA 3OX8B 5I8OL 1C12B 3AY4A 1QLEH 4PJIA 2DMCA 4PTUB 3V4VL 4KROC 1BD2D 2F58L 5I1JL 3QIUB 1RAMA 4BSWA 1PGRB 2EDEA 2R4SH 4UB0H 4ZXBC 3FFCE 4H26A 5ISZA 1Q9KA 4OUUB 1HCFX 2EDQA 1RJLB 2JIXA 4GRWF 4M62H 3SCMB 1G9MC 3QNZA 3KG5A 4HBCL 3PWPD 3O4OC 1XGPB 4G5ZL 3P9WB 4KK9C 2AXGA 4RZCB 5HHQB 3GSXA 4X6FA 3WDJA 3VJ6A 4E41E 1Y6MR 3VXME 1WZ1H 4KUZL 3F58L 4LEOB 2E27L 1GZPB 1BFTA 5FYJE 3OKYA 4ELMF 5C0RL 4DKFH 5IVOA 2R0LH 3VXQA 4MJIA 2IPTH 1GGUA 4FQCH 1GZQA 3SGJA 1GGTA 5CEZL 1VEOA 3B5HA 3C5JB 3ZYZA 4H1LH 1OAQH 4HMDA 1OQXA 2DMKA 2GK0B 4JDVA 4L8CA 3EO9L 4GG6A 1CFVH 4Q6IC 3BDYH 4X6DA 3BPOC 3SQOL 4AY0A 2OL3L 3DV4A 2NLJB 3QJFB 3BZ4B 4MAYB 4YXLL 4XP9H 4U3CA 4WFED 3O4LE 1S7UA 1U8KA 5F7YC 5BQ7A 4OKVA 4K71B 4GRMB 4WFHE 3RIAK 3KPRB 1T2JA 4XVTL 1MI5D 1ZA3A 4GT7A 3C9NB 3QIWD 4OGYH 2CMRL 2CRIA 1BFVH 3FTGB 3VFUB 1QBLL 4F37F 3BZEB 5TDNA 1X5FA 1NMBL 4HKBB 1GSMA 4G6AC 4RIRA 1N6QL 4TUOB 3TYGL 4PG2C 3S35X 4JZNB 1MHCA 3UTQA 4HAFA 4Z77B 4P46B 2BY1A 4BSVB 4AMKL 1MVFA 3EJZC 3UZVB 2QSVA 2GCYA 2Y07H 4MA8L 5JR1L 3BPLB 4HIEB 4GAYB 5DSCB 4ELMA 1V3MA 4O9HL 5I71B 5AUMB 1RD6A 25C8H 3DWTA 4LCWE 4AG4L 3VD3A 1AD0B 1U93A 1H3GA 1C7TA 1OQOA 1RFDH 3PWUA 3D85D 1AGDA 1Q94A 3KPPA 1I1AC 5DRZB 1IKFH 5EZIL 4QRTB 4LL9A 2GJ6D 2ADIB 1T6VN 1SJXA 3UTTA 1FO0L 3DO7A 5JQ6H 1UM5H 1OM3L 2NNAB 4Q6IA 4GXUN 2DB8A 1A8JH 4YQXH 5GRJL 1NL0L 3X3GH 4CJ1A 3H0TB 2XG4A 5B21A 2Z31C 1ZHNA 3B9KB 2A38A 3NABL 3CX2A 2VDNL 4LCYB 5MENB 3O6MH 1D5BB 1JRHL 2H9GB 1T1ZA 5EORH 3X13A 2BRRL 1FYTA 2LFGA 4MCZA 35C8H 1JHLL 1RPQA 1TPXB 2CLRA 1D6VH 3MV01 2P8PA 1PQZA 4L9LB 5CUSH 3G5VA 2IANA 4UAOC 1YQVH 4I0PA 3RZWA 5A2IH 1X5LA 2X4RA 3CFKB 1Z6JT 5HHMD 5C3LD 1KSRA 2HTLD 1HINH 4M6NH 4JFXB 5H94A 4PB9L 4PGDA 1PSKL 4NKIH 2F5BL 1YMMA 3DVNB 2PCPA 2DYPB 1KLUB 4IRSC 3GEWB 3RWDB 1U3HB 3DI3B 3WJLC 1S9XA 2ID5A 4XXDB 3MRBB 1IAMA 2W65A 3GHEL 5HGAB 2JKXA 2YD5A 2WBJB 5JOPD 4M7LT 1RZIA 1J7VR 1OCWL 1ZAGA 3MRJB 5IROC 4QXWA 1YPZE 3B3IA 2CLVA 4P2OC 2HFGL 2B5IC 1KTDB 4FP8L 1SMOA 2HKFL 4BQ8A 5GGTA 2OS7A 5FGRA 1P9MC 5FAAA 1HKLH 4J3OC 1R3IH 4X5LA 5TF1L 4NNYA 4NWUL 2DWDA 3DXAD 4OJFL 3QO0A 4D3CH 3HAEB 1J05B 2FATL 5DK2A 5HYQB 3IDYB 5T1MB 3OAZK 1BREA 4FXLA 4Y4HA 1MRCH 4Y8AA 2R39A 1SYSA 2A6DB 2IBZX 2P7TA 2B4CL 4K8RC 2OLDA 3BN9D 5IBTL 4PJBE 4K23H 3MACL 1IM9A 2HLFD 2Z31A 5DMKA 1MPAH 1MAMH 2WV3A 5ACZB 2E8YA 2WP3T 5ECJE 5IIEB 5H37G 2VUYA 2VABB 2WK2A 3DNKA 4L3EA 3HAEG 2VDOL 4JKKA 4XCFH 1XF2B 3MJ8B 4JHZA 3S36L 3ARDB 1WF5A 3U6RB 2QQLL 5I1DB 1JNNH 1PKOA 2O61A 4Z7UA 3BT2L 3IAQA 5BW7A 2FD6H 3HZYA 3O9WB 5K9QG 4G6JH 3MZGB 1TCRB 1VENA 3KVQA 4OM0H 4WWKD 5GGVH 1FORL 3WN5A 3VGAB 4EUPH 3REWB 1E4XH 3MGOA 4PGBB 1A21A 4G43B 2OR7A 1D7FA 2VWEC 1K4DB 4XWGH 3MLWL 2VC2L 4IRSA 5GQBA 2LU3A 3WJLA 3VGDA 4NBXB 5GISL 2NY6C 3KPSB 5I8OH 3V4VH 3KNBA 2XQYG 4Y16D 3N9GL 5GPRA 5KS9F 5IVXF 2MQCA 2F58H 3TN0D 5I1JH 1DLHA 2PW2B 4JJHA 1GGYA 1F4HA 5DK0A 4P2OA 3ARGB 5DJYB 1S7XA 1MCSA 4U05A 3UROR 4MXQC 3VH8B 5C7XL 3QO1B 4Y5YB 1P9MA 3FCTB 4UI2A 3QJHA 4Q74A 3DX7B 2Q86A 4QHMA 4PGCA 5KSAC 4HBCH 4QRRD 1M1SA 1F3DH 4HD9A 4G5ZH 1YEEL 5CWSA 3TPKA 2F74A 3F58H 4RAUA 1D6EB 3P73A 2E27H 3I6KB 3S37X 4G9FE 2FX7L 4PJAF 4PUBL 1IM3A 4WCYL 5C0RH 3MSPA 1FJ1B 3GO1L 3VH8G 5HHOA 2D0GA 4AJ0A 2ZCKL 5D2LE 1OF2A 5CEZH 3H8NA 4PLKD 4NUGL 5F7KC 1B2WL 1R3HA 1RHHB 1HOCA 3QDME 1PAMA 3QWRA 5C0JB 4CN6A 4KHTL 3ULVF 1I4FA 3EO9H 2YHGA 5I6XC 4HUNB 3HE7D 3TBSB 3ULSA 5JOEA 1MH5A 3SQOH 5CP7A 2OL3H 4M7LL 2D4DA 1BMGA 3BQUD 4YXLH 4Q7DA 4I5BB 3LQAL 4PRHB 3EFFB 1U8PA 5DMGC 4QXGL 3WE6B 1NUDA 4GXUM 5JDJA 1MFNA 1KIPB 2E6JA 3MO1B 4CDHA 3L6FA 3U36B 3U4BL 5H35B 2WWMD 4XVTH 1MRDL 5EZJB 1YNTB 3JUYA 2HG5A 2C1OB 2A6IA 1VB9A 1NJ9A 1QBLH 2BHZA 3VFSA 3WNKA 1NMBH 1FNEA 4ZS7L 4TVPL 5CHNB 1N6QH 5C0EA 1AC6A 3TYGH 5IOPA 1OB1A 5J8OA 3QEUA 5E95B 4Z7QE 4LQ1A 2XG5A 4JN1L 4OZHF 1NBZB 1FSKB 4PG9A 3NOIA 3DYPA 5FA4B 4RFOL 3NBNA 3P0GB 5D6CB 1JV5A 2QHRL 5SV3A 4AMKH 1IC1A 3O3DA 3DUSA 5F7EL 2KUTA 5JR1H 2HMID 4CMMA 4N0CC 4J3XA 2QJDA 3N50A 1CD8A 3KYMA 5EBWB 3OSKA 4LOUD 4O9HH 3IKKA 4AG4H 2R2CA 4IIQA 1FNAA 3FFCD 4YZFE 3RI5K 3VFMB 2GITA 3Q3GA 5FIEA 4IMLB 5BV7B 2SEBB 3LKNA 2W60A 3X17A 3NIFE 5EZIH 1CG9B 1YNLL 1HSBA 3S4SB 1E4WL 2GUOB 3X11A 2CDEB 1FO0H 1E27A 2I25N 5E00A 1OM3H 2XKSA 4MHHI 4ISVB 1KB5L 3HI1A 3OB0K 4F3FA 3TT1L 2AJ3B 1PYWB 5GRJH 3KWWB 3U7WL 1RULL 1NL0H 4E41D 2H6PB 3VXMD 2XWBA 3BYTA 1H8OA 2PNDA 3NABH 5FYJD 1B9ZA 2VDNH 3KPRE 3VDAA 1F11B 4RMRA 3ZHKA 1JRHH 4U1LB 2KQNA 4BK4A 5DQJB 1TVHB 4HWUA 5JORA 1I9RL 4Y88A 4PLNC 4G42A 3LKRB 2BRRH 1EEZA 1U3YA 5IJVB 4IRJA 3S4SG 1HHIA 1JHLH 5TGBB 1VGKA 3ZKMD 5JXED 1OLZA 3EDJA 5A3IC 4H5SB 5IJKC 3BKJL 2FJGB 1F4AA 5EOCL 3KYOA 1M7IA 5IVZB 5JW4N 3C8KA 3E3QC 4Y2DD 5E56A 3PHOB 3MYJB 2AEIT 4OZHA 3V5HA 1H5BA 2RR3A 4PB9H 2APFA 4R4NC 4PJFB 2CLZB 2F5BH 3HPLB 2D31A 3TA3C 3MRNA 3HZMB 3O4LD 3GHEH 1UKQA 3VW3L 2P8MB 1SY6H 4QHNB 4WFHD 3OJ2C 2FECL 5CEXA 5I8CA 1KCRL 3SDAD 1OCWH 5HVGB 3MRHB 4M03A 5SWQB 3BMVA 4JZOB 4K3DL 3JWDL 5KJRL 2HFGH 5IHUL 4FP8H 2HKFH 1MLCA 3FT4A 1KJVB 1T83C 1YUHA 3MUZ1 5TF1H 1LEGB 4E9LA 4NWUH 3SEPA 3JWNC 4OJFH 1VKXA 4Y2OA 5FDWB 2FWOA 3T3ME 4NN7C 2FATH 3MTRA 1DVFB 4HWBH 2B0SL 2NPLX 4ODWB 5DJ2A 4I0CC 5JNYB 4HPOH 2B4CH 2ED7A 3FOLA 2OOYB 4WGVB 4HEPG 3GSOA 5IBTH 2ZUQB 5MENE 4X5WB 2R2EB 3MACH 2IPUG 4RMUA 3LEXA 1KLGB 2JELL 3K3QA 4LCWD 5E7FA 3FO9B 3VWJC 1XAUA 2FSEA 1FAIL 3CX5K 3CSBA 3LN4A 5L8LB 3GMMA 1KPVB 4ZUVB 2CK2A 4ZFGL 1RJZA 2VDOH 3S36H 3CFDA 4YJZL 5HVHB 2QQLH 2EDHA 2GT9A 3BT2H 4O5LL 2IPKA 3G04B 4RRPA 2X1XR 1FORH 1TMCB 3BD4A 3MLWH 2VC2H 3TA3A 1BX2A 5GISH 3IDGB 4HJ0D 3MGTB 3REVA 1EEUA 3DMMD 5GGUB 5J6HA 3UTPE 2AK1L 2W9EL 1IGIL 4JZJC 5ENWA 2YEZA 3NZ8A 3OZ9L 5J0BA 4RWHA 4BUHA 2I24N 3QXTA 5C7XH 2FZ3B 2HT2D 5KVMC 1T83A 2X4TB 4DQOL 3RVWD 2X4NB 2HFEB 3G5YB 4M5ZL 5MI0C 4I4WB 4BQCA 3RWFB 1YEEH 4NSKB 3C09B 4J1UB 5CSBA 2HJLB 4LPVA 3MRPA 3TDHB 4M4PA 4X7CC 2VXVL 4NNXB 2FX7H 4PUBH 4WCYH 4XXCC 5HBBA 1M7XA 2YKLL 5DEZA 3GO1H 1C08A 2HJKA 3GSNL 4B41A 3OKLB 3GJFK 2CK0L 4PJ7F 2DBJA 2ZCKH 5DVNA 1R5VA 4NUGH 4J3VA 1B2WH 4H1LA 1NAMB 5KAQG 5IP4A 4KHTH 4KY1L 2UZIL 5HDOA 3VRLF 3J8F7 5HI3D 1S9VA 3L7FA 1MCRA 5BJTA 4AH2A 4LSTL 3C60C 3CU7A 1UH3A 2BNQB 4M7LH 2RFXA 2EH7L 1JWSA 3KPLA 5CS7A 1KPUA 4NKMB 3UEZA 3GHBL 3UTSB 2XZCL 1FQ9C 3LQAH 4OF5A 4W6YB 4QXGH 4S1QL 5J11B 2BHYA 4J4PD 5FHBL 4EZMA 1I8LA 3KPSE 2ATPA 3H9SB 5D70L 3U4BH 3L9RB 1MCPL 3HC3L 3QCUL 3LD8C 3ISWA 1LEIB 5BZDA 1MRDH 2EE6A 3MX0A 5T5NF 3KHQA 5JPMA 5HI4D 3GIVA 1XCTA 3X3FL 4N0UB 5FYLE 4DUVA 2A73A 5I16B 4Z5RA 3K1KC 3BZFB 3RZCD 5E5MA 4ZS7H 1IGFH 3LQMA 1D9KA 1V05A 3EDFA 1ND0B 4RFEA 4ZDHA 3RVXD 3ARBB 2A83A 1L6ZA 4JN1H 3R1GL 4I18B 3WHE1 3U2SA 3E6FA 4PRBA 5SX5H 1DUYA 5JW4M 4ZSOB 1JYNA 4KFZC 4HKZB 4RFOH 5E2UL 2QHRH 3MBEB 1CGSL 4Q9CA 4IDJL 5DRXA 1UQSB 4YE4L 3MRFB 5F7EH 1CXLA 4WTWA 2C3VA 3UBXB 1IGCL 3ZL4L 1MEXL 5DK3A 1HWGB 4H20L 3QUYD 3PNWA 4GMTH 2FHFA 2EIZA 2E6PA 4ONHA 2PF6A 4PJ7A 5GSRB 2YS4A 5EOCJ 5IMOB 4LKXA 5I76A 1DE4B 2NY3C 2BSRA 3QUZB 1IAIM 1A4KA 4UIKL 3T3PE 1T80A 3DPBA 1YNLH 1E4WH 1IGTB 3JTTB 4R3SB 1JZ8A 1JN6A 5EOTB 3OR6B 4HWZB 1JHKH 1KB5H 1T3FA 1WVZA 3TT1H 4DN4L 3UBXG 3U7WH 3VFOA 1RULH 4LLDB 4PRHE 4HAGA 2PN5A 3EO0A 1YPZF 4KQ3L 5J13C 3DGGB 1KXVC 1GJIA 4LGSB 4DCQB 4G9FD 5BRZB 1MCEA 1I9RH 1N26A 4KRPD 4G8FB 5E2VL 4M8QB 4UNTA 5CGTA 2CUHA 2X4SB 2M1KA 3LS5L 5E9DB 4DKDC 3I02B 3AM8A 2D7MA 3QDMD 4X4ME 1IGML 3BKJH 5BVJB 1MCJA 3AU1B 1BJMA 5EOCH 3ZDYF 2QR0A 1G7JB 3BGMA 5HYEA 3GSVA 3D69B 4ERSL 1FFOA 1ITCA 1KGCE 2A0LC 2MHAB 2CSPA 4XPBL 3OJVC 2CDGB 3MV7A 5CAYB 5HHNB 2IJ0C 4NO3A 5JA9A 2P1YA 3T0EC 3S7GA 3FAWA 5D1XA 3BRDA 3VW3H 1HIML 4C54A 1ROWA 1KCRH 4JFEB 2DL9A 4K3DH 3JV0A 2CIIA 3JWDH 4DGVL 4PB0L 2GJZB 5IHUH 4YAQA 3ILPA 1YYLL 1J0JA 1Y6NR 4OIAA 4M93B 3SKJL 4F7PA 3SCMD 3SKNA 1QSVA 4K3HA 3V5KA 5J9PB 2J12B 1W2KT 3MV9B 4KKLD 4KDWA 3OF6D 4N8VA 4LAJH 5DJXB 4MD4B 5HGBA 4KV5F 1G6VK 3VE0A 4WU5A 4YUEL 2F8OA 1EEYA 4M9OA 4NZDA 4QY8A 4EDWL 2IALB 3WMSA 1U8OA 2CKBL 3WJJC 2JELH 1CL7L 1M6OB 1AGEA 3ESVF 5CBEA 2AEPL 2FJHA 5FKAB 3QUXB 2BRQA 1FAIH 2VL5B 1CD1B 5JPNA 4LPWA 4ZFGH 3C5SB 1KBGL 3SJVB 4RFNC 2UWEB 1DLFH 2YUZA 4OIIL 3RWEA 1N3NA 2EDOA 2NW2B 1RU9L 3QULB 1H3XA 3BX7C 4TNWK 3L7EB 3K7UA 2GAZB 1X44A 1JBJA 4WV1C 3LZFL 4O5LH 5FUCC 4PJFE 4JM2C 4X8XA 4LSUL 2CQVA 4L4VD 3BE1L 5F7NC 4F7EB 4Y5XC 3MFGB 2VDQL 4U3XA 1H0DA 4YDLB 4EUPA 4GKNB 3EOYG 3KPRD 3UCRA 2BXYA 3B9DA 5ICXA 1F3RB 4XT1C 1HHKB 4OGXH 1QZ1A 2PXYB 3TO4D 5ID0A 4ZTPL 1XIWB 4NO5B 5HY9B 3D2UD 2J2ZA 5GZOD 4RAVB 4W4OA 2AK1H 2W9EH 1IGIH 3U4EA 1SVZA 1CFTB 4HUXB 3OZ9H 5EO9A 5GRUL 1ZLUH 2GKIA 3C6SB 1U8IA 2ADFL 5SWSA 5HVWA 3I85A 3RTQD 2X10A 4P46D 4PJ5B 4DQOH 2ZNWA 1JGUL 2BNUA 3PWJA 3ZE1F 1T20A 4M5ZH 3BXNB 4JDTL 5CEYA 4WIQA 1QQDA 2PUQT 5D5ME 4I48A 4NT6A 3DARA 3CSYA 2VQ1A 2VXVH 4JJ5A 4LEXL 1X4ZA 5DFVD 4ZNCD 5FYJU 3VWKA 4PJ9C 2YKLH 1P7QB 1CDBA 1UEYA 2VLJB 4IM8A 3GSNH 4PJCF 1E28A 2XZQL 5DD3H 4OD2A 2YRZA 4FG6D 2DQGL 1R24B 3VXRB 4KY1H 3BEWB 2VR9A 2GSIB 2CXKA 4QXUH 4ZFFB 2XQBL 1IEHA 4KJPD 4U1JA 4MCYB 3H42L 4LSTH 4X7TB 4LRIC 2OL3A 3DX6A 3ROOB 3VFTA 2EH7H 1U8LA 2M8XA 3QDHA 3GHBH 3QYCA 2XZCH 3B9KD 4JM2A 3U9UA 1I9JL 5MEND 4S1QH 1QSEA 1TZHB 1JGDB 2OI9C 2PW1A 4WI6A 5FHBH 5KG9B 1FDLL 2W0PA 3KS0H 5D70H 1MCPH 3HC3H 3N1PC 4H88L 1WIPA 3ZDZF 5B8CC 2FL5A 4P2RB 3KLSA 2H1PL 2IFGA 3X3FH 4KUCD 3QPQC 1KTLB 1I7TB 4LNRB 1RURL 3MRQB 4PPTA 4GQ9H 5F7HA 2AJXL 1MJJB 3IDNA 1E6JL 2P4AB 3PV6B 4HH9B 2YZ1A 3DYOA 5HGHA 3R1GH 4JHAL 4PY8J 5GGSA 4FQQB 4UTAL 1U3HD 3FT3A 5E2UH 1CGSH 4IDJH 1PW3A 3BKYL 3IFLL 3MLYH 2YD8A 3CMOL 4LRNL 4YE4H 3Q5TA 4HMCA 4JKPL 3DX9A 1RZJC 1Y18A 2EO9A 1IGCH 2PO6B 3MRRB 5HDLA 5D71H 1MEXH 3S36X 1I7UA 3C8HA 4H20H 1YC7A 2QQNL 3UTPD 4J3TA 1MWAB 1BF2A 4PJ9A 3TWCL 2X4UB 1LK2A 3OKDB 3QWQB 1K9TA 5GS1C 4OF3A 4PJDA 4FFWC 4UIKH 5J1AB 1RUKH 2ITDB 4NQVA 5JTWA 2AQ3A 1DUZA 5D1ZB 5FA3A 5JZ7D 1FO0A 3DIFA 3T04D 4LVEA 3LB6C 2BNQE 1NUNB 4DN4H 3UTSE 2B4CC 3HZVA 4NJAL 3SN6N 4KQ3H 3V4PL 4B53A 3GMLB 2BZDA 5HDBE 3H9SE 5DLML 5KSVA 1JIBA 3K8MA 4QCIA 1DP0A 2Q1EA 1FNSL 1TQCB 1X5KA 3MJ7B 4N0UE 3WHXB 4YXKL 1J1OL 3ET9F 1VFMA 5E2VH 1AXIB 3EZ8A 2RAMA 4NQEB 2WAHA 4HUWB 3LS5H 4K7FB 3ARDD 1MCBA 3QG7L 5K59E 4QGYA 4OF7A 1IGMH 1Q1JL 3SDCB 1AHWB 3AREB 1W0WA 4CADB 3O9WD 4P57B 4K7PY 5JHDA 3BP7B 4ERSH 1RUQL 2NY4D 3T0XA 4WEUD 4X0KB 4DGIL 5I1LA 1C5DB 4ZSOE 3HE6A 4XPBH 1BP3B 4KGLA 5F88B 4FXGB 3FT2A 4O51B 3LV3A 1HIMH 3PL6A 2NXZD 4P4RA 5TDOB 4JY4A 1EAJA 2Y6SC 4MNHB 1LHZA 1T7YA 5DVLA 5FYLD 3TIDB 4DGVH 4PB0H 2C9AA 5DURB 1KN4L 1P5UA 2F53B 3KJ4C 4NO0A 3QEHB 5I19L 2AJZA 4MNGA 5HGDA 1KIQA 1YYLH 3IB4A 4R97C 4NM8L 3BWAA 4EIZC 1KFAL 5EO0A 2IH3A 5EC2B 4GRLD 3PP4L 4L8DB 2AXFB 2EEDA 4DEPC 4XZUB 2E6QA 3QNXB 5FF6B 3LKPA 4YUEH 5I1GL 3T0DA 1BECA 4EDWH 2QV2A 1VHPA 2CKBH 5BRZE 2ESVA 1CL7H 1J8HB 2AEPH 4JFOA 4KKAD 5E9DE 5DDHA 1TIUA 1KTKE 3SGKA 1KBGH 3R8QA 4OIIH 2M26A 3LDBB 3M1BA 1RU9H 4NOBA 3BUYA 5DEGB 1NCBL 1AXSB 2VIRB 5I1AA 3MRGB 5BZWA 3JSSA 2V5RA 3VFWB 2N56A 3V79C 3LZFH 2Q7YB 5C0GA 4LSUH 3BE1H 3VGFA 3C5ZC 3DURB 3LQAC 4PRHD 4I0KA 2VDQH 1CGTA 3VXUB 2MKLC 3IVKB 4FQPA 3L5XL 2BC4A 3P0VH 3LKQA 4NKDA 3EYOB 1ES0B 1FHGA 4JFEE 2X1OA 5EN2B 2X9YA 1U6AL 2VN4A 4APQA 4ZTPH 5I75C 1YJDL 1CU4L 3MMEA 3VG9C 4DKAA 2FJFA 3QDJA 2XNAB 2ZSWA 5J7CC 1EJOL 3FRPG 1SVCP 4QRQB 2VITB 5GRUH 4ODUA 1T0PB 2ADFH 5E6IA 4P4KB 3RRQA