1K83I

Crystal structure of yeast rna polymerase ii complexed with the inhibitor alpha amanitin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
122
structure length
122
Chain Sequence
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Structural Basis of Transcription: Alpha-Amanitin-RNA Polymerase II Cocrystal at 2.8 A Resolution.
pubmed doi rcsb
molecule tags Transcription/toxin
total genus 12
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2001-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1k83I02
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1k83I01
2P3YA 1I50I 4MH4A 2F4OA 2J6AA 3EERA 4A3KI 4A3II 3S1QI 1QYPA 1TWAI 1VLAA 1PFTA 3U50C 4A3BI 2R93I 4A3JI 2YU9I 3D6WA 3S16I 1WW9A 3S15I 4BY7I 1Y1WI 4A93I 3S14I 3S1NI 2JR6A 4X6AI 1K83I 3Q87A 1L1OC 2R92I 1LQLA 2DE7A 2VUMI 3S1MI 4BBSI 3VB9A 4QTUA 1TFIA 2E2HI 4XX2A 3HOUI 4BBRI 5IP9I 1I3QI 2JS4A 3GTKI 4A3DI 2NVXI 1USPB 2F4MA 5IP7I 4Y7NI 3H3VJ 2JA5I 4A3EI 3RZDI 1NUIA 3VMGA 3HOYI 2K5RA 3PO2I 3PO3S 2DE6A 5C44I 1Y1VI 4NBFA 5C4JI 2JA7I 1X3WA 3VMHA 1TWHI 3RZOI 3S17I 2NVTI 4NB8A 3GTPI 4Y52I 4NBGA 1Y1VS 3PO3I 3I07A 4A3GI 1I6HI 2DE5A 2NVYI 4BXXI 1WCMI 2NVQI 2KPIA 3HOWI 1RO4A 1TWCI 2E2JI 2AKLA 4A3LI 3GTJI 1SFOI 4BY1I 4NBCA 2JNYA 1TWFI 4NBHA 4NBEA 3GTMI 3K7AI 1TWGI 3GCFA 3HOVI 1RLYA 4NOZA 1USPA 3I4NI 3HOXI 3S1RI 3GTOI 3LUSA 1N2FA 4NB9A 2R7ZI 5C3EI 3GTQI 4NBAA 5C4XI 3HOZI 3CQZI 4A3FI 2BJOA 3FKII 3GTMS 1YUAA 3S2DI 2PK7A 3M3YI 1ZB9A 4NBBA 2JA6I 3GTLI 2RBLA 3I4MI 3S2HI 1X3ZA 4NBDA 4QTTA 3GTGI 3VMIA 2E2II 1R9TI 2B63I 5CM2M 1ML8A 2HF1A 2JA8I 4A3MI 3ESWA 3GKQA 3M4OI 5FLMI 1ZB8A 4A3CI 1DL6A 3H0GI
chains in the Genus database with same CATH superfamily
1I50I 2F4OA 3NDIA 2J6AA 2QR1B 1KC81 2V8JA 3I55Z 4AYBA 1VQ41 2JIQA 3CPWZ 2R93I 4A3JI 3OW2Z 3D6WA 1YJW1 1WW9A 3NH5A 1K83I 3Q87A 1L1OC 1VQMZ 3S1MI 2GTHA 3VB9A 2VPZA 3I561 1VQLZ 3GTKI 4A3DI 3CCU1 2NVXI 2K3RA 2PMZA 3CPWY 3OW2Y 2F4MA 4DGLA 2NAPA 5IP7I 3CCL1 1ZH1A 2JA5I 4E31A 4A3EI 3RZDI 1VQPZ 2K5RA 3CME1 4NBFA 3TDHB 2JA7I 4MD8A 3VMHA 3QWUA 1TWHI 4NB8A 1FDIA 4NBGA 3F3FC 2DE5A 2OOXB 4BXXI 3CCE1 2NVQI 2QREB 3GTJI 1SFOI 1VQO1 2Y0SA 3P5JB 2QLVB 2JNYA 3G71Z 3CC2Z 5T64A 3GTMI 5FLXf 1NJI1 3HOVI 1Q821 3S1RI 1VQ5Z 3GTQI 4NBAA 1W2BZ 2V45A 2PK7A 3I551 1YUKA 5D1PA 1YHQZ 1ZB9A 1YJNZ 2RBLA 3I4MI 4MONA 5D1OA 3NH8A 4HGZA 3CD6Z 5CM2M 2OOYB 1N8R2 1Q811 2HU9A 1VQM1 3G4SZ 1ZB8A 1W2BY 1DL6A 2JUBA 4MH4A 4EWCA 2OTLZ 1WIIA 1K9M1 4CL1A 1K732 1YIJZ 4NH1C 3IFUA 2ZAEB 1PFTA 2GTIA 4A3BI 2YU9I 4E33A 3CCVZ 3HKZA 1VQP1 1Z02A 4MD7A 4A93I 3S1NI 2RT9A 4MRIA 1LQLA 2DE7A 3CC4Z 2OZKA 4RVFA 5FLXb 2WAQA 4QTUA 4XX2A 5IP9I 1I3QI 2O53A 1VQ9Z 3J81b 1YI2Z 5T6BA 1K8A2 3BG0B 4Y7NI 3H3VJ 3CMAZ 3TE5B 1JJ2Z 3J7A4 3EEDA 1Y1VI 3G711 3CC21 1X3WA 1KD12 1VQK1 2LFUA 3D9XA 2AYDA 3PO3I 1VQ6Z 1VQ51 3MZKB 2M6NA 5A2Qf 4HH4A 1JJ2Y 2KPIA 1RO4A 1Q7Y2 1YHQ1 2E2JI 2AKLA 2LEXA 1YJN1 2LIYA 4E2XA 1M901 3CD61 3J80f 3CCRZ 1RLYA 4NOZA 1USPA 3CCSZ 1KQSZ 3GTOI 3G4S1 2I3CA 2RHBA 2OTL1 2BJOA 3FKII 3S2DI 1YIJ1 2O4HA 2V8IA 5T67A 3S2HI 3CCV1 3VMIA 3CCQZ 3MZLB 1KRLA 1KQSY 2EGTA 3M4OI 3CC41 4HGYA 4A3CI 2P3YA 4E2YA 1M1K1 2JIOA 4A3KI 2Q4ZA 2JMOA 4A3II 3J81f 1TWAI 1VQ91 1YI21 5A2Qb 2W03A 3CMA1 3KIFA 3S16I 3JAMf 1Q16A 3IR7A 2VPWA 1Y1WI 1Q862 4DK1A 3S14I 4X6AI 2JR6A 1N8R1 2R92I 4E32A 3J80b 4BBSI 2VPYA 1TFIA 3HOUI 4BBRI 2IZ4A 1VQNZ 2JS4A 2WB1A 1S7MA 1VQL1 1VQ61 2QEXZ 3G6EZ 3CC7Z 1RQFA 1NUIA 2RIQA 3VMGA 3HOYI 3PO3S 2DE6A 1Z03A 2Q51A 3CCR1 3S17I 2NVTI 2V8KA 5D1OB 4NFRA 1Q812 4Y52I 3CCS1 2YADA 1YITZ 2IZ3A 1QVGZ 4RV9A 2QA4Z 1K8A1 1K9M2 4A3GI 4MXUA 4RS4A 3HOWI 4A3LI 1FDOA 4NBCA 3JAMb 1KD11 4NBHA 3CCQ1 4NBEA 3K7AI 2R6MA 3GCFA 3CCJZ 2PM9A 3CCMZ 1QVGY 1VQ8Z 2H85A 1RO2A 1Y8CA 3LUSA 2KI7B 1QF8A 2JIMA 3CXCZ 4NB9A 2R7ZI 5C3EI 1WZNA 3NFZA 4A3FI 4E30A 3GTMS 2VUGA 3NDJA 1YUAA 1KC82 1Q7Y1 3M3YI 2W04A 4NBBA 2JA6I 3GTLI 1Z01A 2G2KA 4NBDA 1R9TI 4TNUA 1ML8A 1QVFZ 2HF1A 2JA8I 1SIWA 4A3MI 3ESWA 3CXCY 3GKQA 3T4NB 2VF1A 1VQN1 3EERA 1YJ9Z 3S1QI 1QYPA 4MD9A 1VLAA 1WJ2A 2E7ZA 2VPXA 2QEX1 1VQ7Z 3U50C 3G6E1 3CC71 3NH4A 2JIRA 1QVFY 2OTJZ 1S72Z 3S15I 4BY7I 1X0TA 5LL6f 1M902 2VUMI 2QRDB 2E2HI 2M48A 1YIT1 3D2LA 5IT9f 3IX0A 2QA41 1NP6A 1USPB 3BG1B 1VQ4Z 2JIPA 1YJWZ 3MONA 4S1TA 3PO2I 5C44I 4E2ZA 1Q861 3KIHA 5C4JI 1VQKZ 2IV2X 1RNIA 3RZOI 3IF8A 4RVDA 3CCJ1 3FQMA 3CCM1 1NJI2 3GTPI 2E9HA 1VQ81 1Q822 3I56Z 1Y1VS 3CCUZ 1K731 1M1K2 3I07A 1I6HI 1JWHC 2NVYI 4RVGA 1WCMI 2QKDA 3CCLZ 1TWCI 2P28A 2QRCB 3CMEZ 4BY1I 1AA6A 1RO0A 2V3VA 1TWFI 2RPRA 3VTNA 1TWGI 4E2WA 3I4NI 3HOXI 1QXFA 1N2FA 1P9NA 5C4XI 1YJ91 3HOZI 3CQZI 5IT9b 3CCEZ 3F3PC 4RVHA 1VQ71 1VQOZ 3FQQA 1X3ZA 4QTTA 3GTGI 2OTJ1 4DQYB 1S721 2E2II 2B63I 5AN9F 2GU2A 5FLMI 3H0GI
chains in the Genus database with same CATH topology
1I50I 2F4OA 3NDIA 2J6AA 2QR1B 1KC81 2V8JA 3I55Z 4AYBA 1VQ41 3CPWZ 2R93I 4A3JI 3OW2Z 3D6WA 1YJW1 1WW9A 3NH5A 1K83I 3Q87A 1L1OC 1VQMZ 3S1MI 2GTHA 3VB9A 3I561 1VQLZ 3GTKI 4A3DI 3CCU1 2NVXI 2K3RA 2PMZA 3CPWY 3OW2Y 2F4MA 4DGLA 5IP7I 3CCL1 1ZH1A 2JA5I 4E31A 4A3EI 3RZDI 1VQPZ 2K5RA 3CME1 4NBFA 3TDHB 2JA7I 4MD8A 3VMHA 3QWUA 1TWHI 4NB8A 4NBGA 3F3FC 2DE5A 2OOXB 4BXXI 3CCE1 2NVQI 2QREB 3GTJI 1SFOI 1VQO1 2Y0SA 3P5JB 2QLVB 2JNYA 3G71Z 3CC2Z 5T64A 3GTMI 5FLXf 1NJI1 3HOVI 1Q821 3S1RI 1VQ5Z 3GTQI 4NBAA 1W2BZ 2PK7A 3I551 1YUKA 5D1PA 1YHQZ 1ZB9A 1YJNZ 2RBLA 3I4MI 4MONA 5D1OA 3NH8A 4HGZA 3CD6Z 5CM2M 2OOYB 1N8R2 1Q811 2HU9A 1VQM1 3G4SZ 1ZB8A 1W2BY 1DL6A 2JUBA 4MH4A 4EWCA 2OTLZ 1WIIA 1K9M1 4CL1A 1K732 1YIJZ 4NH1C 3IFUA 2ZAEB 1PFTA 2GTIA 4A3BI 2YU9I 4E33A 3CCVZ 3HKZA 1VQP1 1Z02A 4MD7A 4A93I 3S1NI 2RT9A 4MRIA 1LQLA 2DE7A 3CC4Z 2OZKA 4RVFA 5FLXb 2WAQA 4QTUA 4XX2A 5IP9I 1I3QI 2O53A 1VQ9Z 3J81b 1YI2Z 5T6BA 1K8A2 3BG0B 4Y7NI 3H3VJ 3CMAZ 3TE5B 1JJ2Z 3J7A4 3EEDA 1Y1VI 3G711 3CC21 1X3WA 1KD12 1VQK1 2LFUA 3D9XA 3PO3I 1VQ6Z 1VQ51 3MZKB 2M6NA 5A2Qf 4HH4A 1JJ2Y 2KPIA 1RO4A 1Q7Y2 1YHQ1 2E2JI 2AKLA 1YJN1 2LIYA 4E2XA 1M901 3CD61 3J80f 3CCRZ 1RLYA 4NOZA 1USPA 3CCSZ 1KQSZ 3GTOI 3G4S1 2I3CA 2RHBA 2OTL1 2BJOA 3FKII 3S2DI 1YIJ1 2O4HA 2V8IA 5T67A 3S2HI 3CCV1 3VMIA 3CCQZ 3MZLB 1KRLA 1KQSY 2EGTA 3M4OI 3CC41 4HGYA 4A3CI 2P3YA 4E2YA 1M1K1 4A3KI 2Q4ZA 2JMOA 4A3II 3J81f 1TWAI 1VQ91 1YI21 5A2Qb 2W03A 3CMA1 3KIFA 3S16I 3JAMf 1Y1WI 1Q862 4DK1A 3S14I 4X6AI 2JR6A 1N8R1 2R92I 4E32A 3J80b 4BBSI 1TFIA 3HOUI 4BBRI 2IZ4A 1VQNZ 2JS4A 2WB1A 1S7MA 1VQL1 1VQ61 2QEXZ 3G6EZ 3CC7Z 1RQFA 1NUIA 2RIQA 3VMGA 3HOYI 3PO3S 2DE6A 1Z03A 2Q51A 3CCR1 3S17I 2NVTI 2V8KA 5D1OB 4NFRA 1Q812 4Y52I 3CCS1 2YADA 1YITZ 2IZ3A 1QVGZ 4RV9A 2QA4Z 1K8A1 1K9M2 4A3GI 4MXUA 4RS4A 3HOWI 4A3LI 4NBCA 3JAMb 1KD11 4NBHA 3CCQ1 4NBEA 3K7AI 2R6MA 3GCFA 3CCJZ 2PM9A 3CCMZ 1QVGY 1VQ8Z 2H85A 1RO2A 3LUSA 2KI7B 1QF8A 3CXCZ 4NB9A 2R7ZI 5C3EI 3NFZA 4A3FI 4E30A 3GTMS 2VUGA 3NDJA 1YUAA 1KC82 1Q7Y1 3M3YI 2W04A 4NBBA 2JA6I 3GTLI 1Z01A 2G2KA 4NBDA 1R9TI 4TNUA 1ML8A 1QVFZ 2HF1A 2JA8I 4A3MI 3ESWA 3CXCY 3GKQA 3T4NB 2VF1A 1VQN1 3EERA 1YJ9Z 3S1QI 1QYPA 4MD9A 1VLAA 2QEX1 1VQ7Z 3U50C 3G6E1 3CC71 3NH4A 1QVFY 2OTJZ 1S72Z 3S15I 4BY7I 1X0TA 5LL6f 1M902 2VUMI 2QRDB 2E2HI 2M48A 1YIT1 5IT9f 3IX0A 2QA41 1NP6A 1USPB 3BG1B 1VQ4Z 1YJWZ 3MONA 4S1TA 3PO2I 5C44I 4E2ZA 1Q861 3KIHA 5C4JI 1VQKZ 1RNIA 3RZOI 3IF8A 4RVDA 3CCJ1 3FQMA 3CCM1 1NJI2 3GTPI 2E9HA 1VQ81 1Q822 3I56Z 1Y1VS 3CCUZ 1K731 1M1K2 3I07A 1I6HI 1JWHC 2NVYI 4RVGA 1WCMI 2QKDA 3CCLZ 1TWCI 2P28A 2QRCB 3CMEZ 4BY1I 1RO0A 1TWFI 2RPRA 3VTNA 1TWGI 4E2WA 3I4NI 3HOXI 1N2FA 1P9NA 5C4XI 1YJ91 3HOZI 3CQZI 5IT9b 3CCEZ 3F3PC 4RVHA 1VQ71 1VQOZ 3FQQA 1X3ZA 4QTTA 3GTGI 2OTJ1 4DQYB 1S721 2E2II 2B63I 5AN9F 2GU2A 5FLMI 3H0GI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P3Y A;  1I50 I;  4MH4 A;  2F4O A;  2J6A A;  3EER A;  4A3K I;  4A3I I;  3S1Q I;  1QYP A;  1TWA I;  1VLA A;  1PFT A;  3U50 C;  4A3B I;  2R93 I;  4A3J I;  2YU9 I;  3D6W A;  3S16 I;  1WW9 A;  3S15 I;  4BY7 I;  1Y1W I;  4A93 I;  3S14 I;  3S1N I;  2JR6 A;  4X6A I;  1K83 I;  3Q87 A;  1L1O C;  2R92 I;  1LQL A;  2DE7 A;  2VUM I;  3S1M I;  4BBS I;  3VB9 A;  4QTU A;  1TFI A;  2E2H I;  4XX2 A;  3HOU I;  4BBR I;  5IP9 I;  1I3Q I;  2JS4 A;  3GTK I;  4A3D I;  2NVX I;  1USP B;  2F4M A;  5IP7 I;  4Y7N I;  3H3V J;  2JA5 I;  4A3E I;  3RZD I;  1NUI A;  3VMG A;  3HOY I;  2K5R A;  3PO2 I;  3PO3 S;  2DE6 A;  5C44 I;  1Y1V I;  4NBF A;  5C4J I;  2JA7 I;  1X3W A;  3VMH A;  1TWH I;  3RZO I;  3S17 I;  2NVT I;  4NB8 A;  3GTP I;  4Y52 I;  4NBG A;  1Y1V S;  3PO3 I;  3I07 A;  4A3G I;  1I6H I;  2DE5 A;  2NVY I;  4BXX I;  1WCM I;  2NVQ I;  2KPI A;  3HOW I;  1RO4 A;  1TWC I;  2E2J I;  2AKL A;  4A3L I;  3GTJ I;  1SFO I;  4BY1 I;  4NBC A;  2JNY A;  1TWF I;  4NBH A;  4NBE A;  3GTM I;  3K7A I;  1TWG I;  3GCF A;  3HOV I;  1RLY A;  4NOZ A;  1USP A;  3I4N I;  3HOX I;  3S1R I;  3GTO I;  3LUS A;  1N2F A;  4NB9 A;  2R7Z I;  5C3E I;  3GTQ I;  4NBA A;  5C4X I;  3HOZ I;  3CQZ I;  4A3F I;  2BJO A;  3FKI I;  3GTM S;  1YUA A;  3S2D I;  2PK7 A;  3M3Y I;  1ZB9 A;  4NBB A;  2JA6 I;  3GTL I;  2RBL A;  3I4M I;  3S2H I;  1X3Z A;  4NBD A;  4QTT A;  3GTG I;  3VMI A;  2E2I I;  1R9T I;  2B63 I;  5CM2 M;  1ML8 A;  2HF1 A;  2JA8 I;  4A3M I;  3ESW A;  3GKQ A;  3M4O I;  5FLM I;  1ZB8 A;  4A3C I;  1DL6 A;  3H0G I; 
#chains in the Genus database with same CATH topology
 1I50 I;  2F4O A;  3NDI A;  2J6A A;  2QR1 B;  1KC8 1;  2V8J A;  3I55 Z;  4AYB A;  1VQ4 1;  2JIQ A;  3CPW Z;  2R93 I;  4A3J I;  3OW2 Z;  3D6W A;  1YJW 1;  1WW9 A;  3NH5 A;  1K83 I;  3Q87 A;  1L1O C;  1VQM Z;  3S1M I;  2GTH A;  3VB9 A;  2VPZ A;  3I56 1;  1VQL Z;  3GTK I;  4A3D I;  3CCU 1;  2NVX I;  2K3R A;  2PMZ A;  3CPW Y;  3OW2 Y;  2F4M A;  4DGL A;  2NAP A;  5IP7 I;  3CCL 1;  1ZH1 A;  2JA5 I;  4E31 A;  4A3E I;  3RZD I;  1VQP Z;  2K5R A;  3CME 1;  4NBF A;  3TDH B;  2JA7 I;  4MD8 A;  3VMH A;  3QWU A;  1TWH I;  4NB8 A;  1FDI A;  4NBG A;  3F3F C;  2DE5 A;  2OOX B;  4BXX I;  3CCE 1;  2NVQ I;  2QRE B;  3GTJ I;  1SFO I;  1VQO 1;  2Y0S A;  3P5J B;  2QLV B;  2JNY A;  3G71 Z;  3CC2 Z;  5T64 A;  3GTM I;  5FLX f;  1NJI 1;  3HOV I;  1Q82 1;  3S1R I;  1VQ5 Z;  3GTQ I;  4NBA A;  1W2B Z;  2V45 A;  2PK7 A;  3I55 1;  1YUK A;  5D1P A;  1YHQ Z;  1ZB9 A;  1YJN Z;  2RBL A;  3I4M I;  4MON A;  5D1O A;  3NH8 A;  4HGZ A;  3CD6 Z;  5CM2 M;  2OOY B;  1N8R 2;  1Q81 1;  2HU9 A;  1VQM 1;  3G4S Z;  1ZB8 A;  1W2B Y;  1DL6 A;  2JUB A;  4MH4 A;  4EWC A;  2OTL Z;  1WII A;  1K9M 1;  4CL1 A;  1K73 2;  1YIJ Z;  4NH1 C;  3IFU A;  2ZAE B;  1PFT A;  2GTI A;  4A3B I;  2YU9 I;  4E33 A;  3CCV Z;  3HKZ A;  1VQP 1;  1Z02 A;  4MD7 A;  4A93 I;  3S1N I;  2RT9 A;  4MRI A;  1LQL A;  2DE7 A;  3CC4 Z;  2OZK A;  4RVF A;  5FLX b;  2WAQ A;  4QTU A;  4XX2 A;  5IP9 I;  1I3Q I;  2O53 A;  1VQ9 Z;  3J81 b;  1YI2 Z;  5T6B A;  1K8A 2;  3BG0 B;  4Y7N I;  3H3V J;  3CMA Z;  3TE5 B;  1JJ2 Z;  3J7A 4;  3EED A;  1Y1V I;  3G71 1;  3CC2 1;  1X3W A;  1KD1 2;  1VQK 1;  2LFU A;  3D9X A;  2AYD A;  3PO3 I;  1VQ6 Z;  1VQ5 1;  3MZK B;  2M6N A;  5A2Q f;  4HH4 A;  1JJ2 Y;  2KPI A;  1RO4 A;  1Q7Y 2;  1YHQ 1;  2E2J I;  2AKL A;  2LEX A;  1YJN 1;  2LIY A;  4E2X A;  1M90 1;  3CD6 1;  3J80 f;  3CCR Z;  1RLY A;  4NOZ A;  1USP A;  3CCS Z;  1KQS Z;  3GTO I;  3G4S 1;  2I3C A;  2RHB A;  2OTL 1;  2BJO A;  3FKI I;  3S2D I;  1YIJ 1;  2O4H A;  2V8I A;  5T67 A;  3S2H I;  3CCV 1;  3VMI A;  3CCQ Z;  3MZL B;  1KRL A;  1KQS Y;  2EGT A;  3M4O I;  3CC4 1;  4HGY A;  4A3C I;  2P3Y A;  4E2Y A;  1M1K 1;  2JIO A;  4A3K I;  2Q4Z A;  2JMO A;  4A3I I;  3J81 f;  1TWA I;  1VQ9 1;  1YI2 1;  5A2Q b;  2W03 A;  3CMA 1;  3KIF A;  3S16 I;  3JAM f;  1Q16 A;  3IR7 A;  2VPW A;  1Y1W I;  1Q86 2;  4DK1 A;  3S14 I;  4X6A I;  2JR6 A;  1N8R 1;  2R92 I;  4E32 A;  3J80 b;  4BBS I;  2VPY A;  1TFI A;  3HOU I;  4BBR I;  2IZ4 A;  1VQN Z;  2JS4 A;  2WB1 A;  1S7M A;  1VQL 1;  1VQ6 1;  2QEX Z;  3G6E Z;  3CC7 Z;  1RQF A;  1NUI A;  2RIQ A;  3VMG A;  3HOY I;  3PO3 S;  2DE6 A;  1Z03 A;  2Q51 A;  3CCR 1;  3S17 I;  2NVT I;  2V8K A;  5D1O B;  4NFR A;  1Q81 2;  4Y52 I;  3CCS 1;  2YAD A;  1YIT Z;  2IZ3 A;  1QVG Z;  4RV9 A;  2QA4 Z;  1K8A 1;  1K9M 2;  4A3G I;  4MXU A;  4RS4 A;  3HOW I;  4A3L I;  1FDO A;  4NBC A;  3JAM b;  1KD1 1;  4NBH A;  3CCQ 1;  4NBE A;  3K7A I;  2R6M A;  3GCF A;  3CCJ Z;  2PM9 A;  3CCM Z;  1QVG Y;  1VQ8 Z;  2H85 A;  1RO2 A;  1Y8C A;  3LUS A;  2KI7 B;  1QF8 A;  2JIM A;  3CXC Z;  4NB9 A;  2R7Z I;  5C3E I;  1WZN A;  3NFZ A;  4A3F I;  4E30 A;  3GTM S;  2VUG A;  3NDJ A;  1YUA A;  1KC8 2;  1Q7Y 1;  3M3Y I;  2W04 A;  4NBB A;  2JA6 I;  3GTL I;  1Z01 A;  2G2K A;  4NBD A;  1R9T I;  4TNU A;  1ML8 A;  1QVF Z;  2HF1 A;  2JA8 I;  1SIW A;  4A3M I;  3ESW A;  3CXC Y;  3GKQ A;  3T4N B;  2VF1 A;  1VQN 1;  3EER A;  1YJ9 Z;  3S1Q I;  1QYP A;  4MD9 A;  1VLA A;  1WJ2 A;  2E7Z A;  2VPX A;  2QEX 1;  1VQ7 Z;  3U50 C;  3G6E 1;  3CC7 1;  3NH4 A;  2JIR A;  1QVF Y;  2OTJ Z;  1S72 Z;  3S15 I;  4BY7 I;  1X0T A;  5LL6 f;  1M90 2;  2VUM I;  2QRD B;  2E2H I;  2M48 A;  1YIT 1;  3D2L A;  5IT9 f;  3IX0 A;  2QA4 1;  1NP6 A;  1USP B;  3BG1 B;  1VQ4 Z;  2JIP A;  1YJW Z;  3MON A;  4S1T A;  3PO2 I;  5C44 I;  4E2Z A;  1Q86 1;  3KIH A;  5C4J I;  1VQK Z;  2IV2 X;  1RNI A;  3RZO I;  3IF8 A;  4RVD A;  3CCJ 1;  3FQM A;  3CCM 1;  1NJI 2;  3GTP I;  2E9H A;  1VQ8 1;  1Q82 2;  3I56 Z;  1Y1V S;  3CCU Z;  1K73 1;  1M1K 2;  3I07 A;  1I6H I;  1JWH C;  2NVY I;  4RVG A;  1WCM I;  2QKD A;  3CCL Z;  1TWC I;  2P28 A;  2QRC B;  3CME Z;  4BY1 I;  1AA6 A;  1RO0 A;  2V3V A;  1TWF I;  2RPR A;  3VTN A;  1TWG I;  4E2W A;  3I4N I;  3HOX I;  1QXF A;  1N2F A;  1P9N A;  5C4X I;  1YJ9 1;  3HOZ I;  3CQZ I;  5IT9 b;  3CCE Z;  3F3P C;  4RVH A;  1VQ7 1;  1VQO Z;  3FQQ A;  1X3Z A;  4QTT A;  3GTG I;  2OTJ 1;  4DQY B;  1S72 1;  2E2I I;  2B63 I;  5AN9 F;  2GU2 A;  5FLM I;  3H0G I; 
#chains in the Genus database with same CATH homology
 1I50 I;  2F4O A;  3NDI A;  2J6A A;  2QR1 B;  1KC8 1;  2V8J A;  3I55 Z;  4AYB A;  1VQ4 1;  3CPW Z;  2R93 I;  4A3J I;  3OW2 Z;  3D6W A;  1YJW 1;  1WW9 A;  3NH5 A;  1K83 I;  3Q87 A;  1L1O C;  1VQM Z;  3S1M I;  2GTH A;  3VB9 A;  3I56 1;  1VQL Z;  3GTK I;  4A3D I;  3CCU 1;  2NVX I;  2K3R A;  2PMZ A;  3CPW Y;  3OW2 Y;  2F4M A;  4DGL A;  5IP7 I;  3CCL 1;  1ZH1 A;  2JA5 I;  4E31 A;  4A3E I;  3RZD I;  1VQP Z;  2K5R A;  3CME 1;  4NBF A;  3TDH B;  2JA7 I;  4MD8 A;  3VMH A;  3QWU A;  1TWH I;  4NB8 A;  4NBG A;  3F3F C;  2DE5 A;  2OOX B;  4BXX I;  3CCE 1;  2NVQ I;  2QRE B;  3GTJ I;  1SFO I;  1VQO 1;  2Y0S A;  3P5J B;  2QLV B;  2JNY A;  3G71 Z;  3CC2 Z;  5T64 A;  3GTM I;  5FLX f;  1NJI 1;  3HOV I;  1Q82 1;  3S1R I;  1VQ5 Z;  3GTQ I;  4NBA A;  1W2B Z;  2PK7 A;  3I55 1;  1YUK A;  5D1P A;  1YHQ Z;  1ZB9 A;  1YJN Z;  2RBL A;  3I4M I;  4MON A;  5D1O A;  3NH8 A;  4HGZ A;  3CD6 Z;  5CM2 M;  2OOY B;  1N8R 2;  1Q81 1;  2HU9 A;  1VQM 1;  3G4S Z;  1ZB8 A;  1W2B Y;  1DL6 A;  2JUB A;  4MH4 A;  4EWC A;  2OTL Z;  1WII A;  1K9M 1;  4CL1 A;  1K73 2;  1YIJ Z;  4NH1 C;  3IFU A;  2ZAE B;  1PFT A;  2GTI A;  4A3B I;  2YU9 I;  4E33 A;  3CCV Z;  3HKZ A;  1VQP 1;  1Z02 A;  4MD7 A;  4A93 I;  3S1N I;  2RT9 A;  4MRI A;  1LQL A;  2DE7 A;  3CC4 Z;  2OZK A;  4RVF A;  5FLX b;  2WAQ A;  4QTU A;  4XX2 A;  5IP9 I;  1I3Q I;  2O53 A;  1VQ9 Z;  3J81 b;  1YI2 Z;  5T6B A;  1K8A 2;  3BG0 B;  4Y7N I;  3H3V J;  3CMA Z;  3TE5 B;  1JJ2 Z;  3J7A 4;  3EED A;  1Y1V I;  3G71 1;  3CC2 1;  1X3W A;  1KD1 2;  1VQK 1;  2LFU A;  3D9X A;  3PO3 I;  1VQ6 Z;  1VQ5 1;  3MZK B;  2M6N A;  5A2Q f;  4HH4 A;  1JJ2 Y;  2KPI A;  1RO4 A;  1Q7Y 2;  1YHQ 1;  2E2J I;  2AKL A;  1YJN 1;  2LIY A;  4E2X A;  1M90 1;  3CD6 1;  3J80 f;  3CCR Z;  1RLY A;  4NOZ A;  1USP A;  3CCS Z;  1KQS Z;  3GTO I;  3G4S 1;  2I3C A;  2RHB A;  2OTL 1;  2BJO A;  3FKI I;  3S2D I;  1YIJ 1;  2O4H A;  2V8I A;  5T67 A;  3S2H I;  3CCV 1;  3VMI A;  3CCQ Z;  3MZL B;  1KRL A;  1KQS Y;  2EGT A;  3M4O I;  3CC4 1;  4HGY A;  4A3C I;  2P3Y A;  4E2Y A;  1M1K 1;  4A3K I;  2Q4Z A;  2JMO A;  4A3I I;  3J81 f;  1TWA I;  1VQ9 1;  1YI2 1;  5A2Q b;  2W03 A;  3CMA 1;  3KIF A;  3S16 I;  3JAM f;  1Y1W I;  1Q86 2;  4DK1 A;  3S14 I;  4X6A I;  2JR6 A;  1N8R 1;  2R92 I;  4E32 A;  3J80 b;  4BBS I;  1TFI A;  3HOU I;  4BBR I;  2IZ4 A;  1VQN Z;  2JS4 A;  2WB1 A;  1S7M A;  1VQL 1;  1VQ6 1;  2QEX Z;  3G6E Z;  3CC7 Z;  1RQF A;  1NUI A;  2RIQ A;  3VMG A;  3HOY I;  3PO3 S;  2DE6 A;  1Z03 A;  2Q51 A;  3CCR 1;  3S17 I;  2NVT I;  2V8K A;  5D1O B;  4NFR A;  1Q81 2;  4Y52 I;  3CCS 1;  2YAD A;  1YIT Z;  2IZ3 A;  1QVG Z;  4RV9 A;  2QA4 Z;  1K8A 1;  1K9M 2;  4A3G I;  4MXU A;  4RS4 A;  3HOW I;  4A3L I;  4NBC A;  3JAM b;  1KD1 1;  4NBH A;  3CCQ 1;  4NBE A;  3K7A I;  2R6M A;  3GCF A;  3CCJ Z;  2PM9 A;  3CCM Z;  1QVG Y;  1VQ8 Z;  2H85 A;  1RO2 A;  3LUS A;  2KI7 B;  1QF8 A;  3CXC Z;  4NB9 A;  2R7Z I;  5C3E I;  3NFZ A;  4A3F I;  4E30 A;  3GTM S;  2VUG A;  3NDJ A;  1YUA A;  1KC8 2;  1Q7Y 1;  3M3Y I;  2W04 A;  4NBB A;  2JA6 I;  3GTL I;  1Z01 A;  2G2K A;  4NBD A;  1R9T I;  4TNU A;  1ML8 A;  1QVF Z;  2HF1 A;  2JA8 I;  4A3M I;  3ESW A;  3CXC Y;  3GKQ A;  3T4N B;  2VF1 A;  1VQN 1;  3EER A;  1YJ9 Z;  3S1Q I;  1QYP A;  4MD9 A;  1VLA A;  2QEX 1;  1VQ7 Z;  3U50 C;  3G6E 1;  3CC7 1;  3NH4 A;  1QVF Y;  2OTJ Z;  1S72 Z;  3S15 I;  4BY7 I;  1X0T A;  5LL6 f;  1M90 2;  2VUM I;  2QRD B;  2E2H I;  2M48 A;  1YIT 1;  5IT9 f;  3IX0 A;  2QA4 1;  1NP6 A;  1USP B;  3BG1 B;  1VQ4 Z;  1YJW Z;  3MON A;  4S1T A;  3PO2 I;  5C44 I;  4E2Z A;  1Q86 1;  3KIH A;  5C4J I;  1VQK Z;  1RNI A;  3RZO I;  3IF8 A;  4RVD A;  3CCJ 1;  3FQM A;  3CCM 1;  1NJI 2;  3GTP I;  2E9H A;  1VQ8 1;  1Q82 2;  3I56 Z;  1Y1V S;  3CCU Z;  1K73 1;  1M1K 2;  3I07 A;  1I6H I;  1JWH C;  2NVY I;  4RVG A;  1WCM I;  2QKD A;  3CCL Z;  1TWC I;  2P28 A;  2QRC B;  3CME Z;  4BY1 I;  1RO0 A;  1TWF I;  2RPR A;  3VTN A;  1TWG I;  4E2W A;  3I4N I;  3HOX I;  1N2F A;  1P9N A;  5C4X I;  1YJ9 1;  3HOZ I;  3CQZ I;  5IT9 b;  3CCE Z;  3F3P C;  4RVH A;  1VQ7 1;  1VQO Z;  3FQQ A;  1X3Z A;  4QTT A;  3GTG I;  2OTJ 1;  4DQY B;  1S72 1;  2E2I I;  2B63 I;  5AN9 F;  2GU2 A;  5FLM I;  3H0G I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...