1K83I

Crystal structure of yeast rna polymerase ii complexed with the inhibitor alpha amanitin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
122
structure length
122
Chain Sequence
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Structural Basis of Transcription: Alpha-Amanitin-RNA Polymerase II Cocrystal at 2.8 A Resolution.
pubmed doi rcsb
molecule tags Transcription/toxin
total genus 12
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2001-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1k83I02
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1k83I01
1LQLA 4QTTA 3LUSA 4NBAA 3GTJI 3CQZI 1WW9A 1Y1WI 3PO2I 3RZDI 4XX2A 4Y52I 4A3GI 2DE7A 2RBLA 3S1RI 1TWAI 3HOWI 4NB8A 2JS4A 3GTQI 2BJOA 5C4JI 3VMIA 4A3DI 1SFOI 2B63I 4NBGA 2JA7I 2VUMI 2JA8I 2NVTI 3GTKI 4Y7NI 1X3ZA 2R92I 2DE5A 3HOXI 4NBEA 1Y1VS 3GTMS 1ZB8A 3GCFA 3GKQA 1L1OC 2F4OA 1TWFI 3HOUI 2NVXI 3Q87A 3HOVI 3S1MI 1I50I 3M4OI 5IP9I 3S2DI 2HF1A 2JA5I 5CM2M 2E2II 2NVQI 2NVYI 2F4MA 3K7AI 3PO3I 4NBDA 4A3LI 4A3CI 4X6AI 1Y1VI 1I3QI 5IP7I 3GTMI 1VLAA 4BY7I 3I4NI 2K5RA 3GTLI 3VMGA 2AKLA 3PO3S 2DE6A 3GTPI 1ZB9A 2JR6A 2R7ZI 3S17I 3H3VJ 4NB9A 5C4XI 2R93I 3VMHA 2E2JI 2J6AA 2JA6I 3VB9A 3HOYI 1USPA 3I07A 1N2FA 3S16I 4A93I 1TWHI 1RLYA 3GTOI 3I4MI 1PFTA 1NUIA 3U50C 3S14I 1RO4A 4BBRI 3GTGI 4A3KI 4A3FI 3S2HI 2JNYA 1QYPA 4NOZA 1K83I 4A3MI 4A3II 1R9TI 3EERA 2KPIA 5C3EI 1DL6A 5FLMI 1X3WA 4NBCA 3S15I 3HOZI 1YUAA 3FKII 3H0GI 5C44I 4A3EI 4NBBA 3D6WA 1USPB 3ESWA 3S1NI 1ML8A 4MH4A 1I6HI 2P3YA 4A3JI 2YU9I 4BY1I 4QTUA 3S1QI 1WCMI 4BXXI 4A3BI 3RZOI 4NBFA 1TWGI 3M3YI 4NBHA 4BBSI 2PK7A 2E2HI 1TFIA 1TWCI
chains in the Genus database with same CATH superfamily
2WAQA 3GTJI 1VQ9Z 1FDIA 3CPWZ 3RZDI 4MD8A 2DE7A 2RBLA 2RIQA 4NB8A 1YJW1 2JS4A 3QWUA 1QVGY 5AN9F 2BJOA 3D9XA 3CCQ1 4CL1A 4NBGA 2JA7I 2VUMI 1QF8A 2NVTI 4Y7NI 1Q7Y2 2R92I 2DE5A 1Y1VS 1YHQ1 3GCFA 3GKQA 1L1OC 2VPYA 4E2WA 3HOUI 3CCE1 2VPXA 2ZAEB 3M4OI 5IP9I 1KRLA 3S2DI 5CM2M 1YHQZ 1AA6A 1VQKZ 1K8A2 4X6AI 3IF8A 1VQ41 1VQL1 3I4NI 2AKLA 2V45A 4E2ZA 3GTPI 1ZB9A 3H3VJ 3VTNA 1VQLZ 2JA6I 1NP6A 1N8R2 2I3CA 4RVDA 2QA41 1VQ8Z 5D1PA 2OTL1 4A93I 3NDIA 3OW2Y 1RO0A 1PFTA 4RV9A 1NUIA 1RQFA 1RO4A 2QRDB 2V3VA 2JIPA 4A3KI 1KD11 3CMA1 1VQNZ 4HGYA 1YIJZ 2OTLZ 4E2XA 1K83I 4A3II 4TNUA 2JIRA 2KPIA 4MRIA 3CC21 4NBCA 4E31A 4EWCA 3IFUA 5T67A 3FKII 3I561 1ZH1A 5C44I 4E30A 4A3EI 1JJ2Y 4NBBA 3KIHA 2PM9A 3D6WA 3CXCZ 1USPB 2RT9A 3ESWA 1ML8A 1I6HI 3CC2Z 1KC81 3I56Z 3RZOI 1WZNA 4BBSI 1TFIA 4QTTA 1YUKA 3MONA 4NBAA 3PO2I 2EGTA 4XX2A 5FLXf 4A3GI 1KQSY 3S1RI 3HOWI 4NFRA 3G71Z 1VQ91 3G4S1 2VPWA 3CME1 1X3ZA 2HU9A 1ZB8A 2VF1A 1FDOA 2F4OA 3CC41 3G4SZ 1Z01A 3Q87A 3D2LA 3CMEZ 1I50I 2QLVB 5D1OB 1KD12 2QRCB 2QEX1 3CCV1 2E2II 4HH4A 3CC4Z 4NBDA 5LL6f 2W04A 5A2Qf 4AYBA 5IP7I 4BY7I 2K5RA 3NFZA 3GTLI 2IV2X 2QEXZ 3CCVZ 3PO3S 2DE6A 3KIFA 3NDJA 4RVGA 1X0TA 3CCRZ 3CCJ1 1VQK1 3VB9A 1KC82 3P5JB 3HOYI 1USPA 1TWHI 1W2BZ 3CCJZ 1VQ51 3CD6Z 5A2Qb 3S14I 4BBRI 1M1K1 3NH4A 1Q821 1VQ81 1VQ5Z 1X3WA 1YUAA 1VQN1 1VQPZ 1YIJ1 2VUGA 2P28A 1Q16A 2OZKA 1QVFY 3S1QI 1QVGZ 3NH5A 4MD9A 2GTHA 1YJN1 5IT9f 3IX0A 1LQLA 3LUSA 1WW9A 2WB1A 2AYDA 3TE5B 4RVFA 3IR7A 2RPRA 1YJNZ 3EEDA 3GTQI 2V8IA 1Y8CA 3J7A4 2M48A 3VMIA 1SFOI 4RS4A 3F3FC 1P9NA 1Q811 5IT9b 1YIT1 3CPWY 1TWFI 4DGLA 3MZLB 4E32A 3JAMf 2NVXI 3S1MI 3G711 1RO2A 1WIIA 1M1K2 1YITZ 1Q822 2NVYI 2V8JA 3CCUZ 2F4MA 2O4HA 3K7AI 3OW2Z 4A3LI 3TDHB 1QVFZ 4MXUA 4A3CI 3GTMI 2E7ZA 4MD7A 1Z02A 1VQMZ 3FQQA 2OOXB 2JR6A 4RVHA 5T6BA 2Q4ZA 5C4XI 3JAMb 2R93I 3CCS1 2E2JI 3CCM1 5FLXb 3I07A 1N2FA 3S16I 2QR1B 1RLYA 4E33A 1JJ2Z 1S7MA 3CCSZ 3CCMZ 3S2HI 1SIWA 3CCR1 2PMZA 1VQ61 3F3PC 4A3MI 4E2YA 1R9TI 1VQ7Z 2OTJ1 3J81f 1DL6A 5FLMI 3CD61 1M901 1VQ6Z 1RNIA 3G6E1 4DQYB 3H0GI 2M6NA 1K731 2OTJZ 1KQSZ 1Q812 2P3YA 2YU9I 4QTUA 1YJ91 1YI21 3NH8A 3G6EZ 4BXXI 3BG1B 1Q861 3FQMA 4NBFA 1TWGI 2IZ4A 1YJWZ 4MONA 1S721 3J81b 1VQP1 1YI2Z 1YJ9Z 3CCQZ 1Z03A 2QREB 2IZ3A 3CQZI 1Y1WI 4Y52I 2LEXA 2NAPA 1WJ2A 1S72Z 3CXCY 1TWAI 2GTIA 2JIQA 1QXFA 3CCEZ 1K9M1 5C4JI 4A3DI 1NJI1 2RHBA 2B63I 2JA8I 3GTKI 3HOXI 2G2KA 4NBEA 2JMOA 3GTMS 4HGZA 2E9HA 1VQ4Z 2JIMA 5D1OA 3HOVI 2HF1A 2JA5I 2NVQI 3PO3I 1Y1VI 1I3QI 2OOYB 2W03A 2QA4Z 1VLAA 3T4NB 2R6MA 3VMGA 1M902 2KI7B 2LIYA 4NH1C 2JIOA 1K732 2R7ZI 3S17I 3CMAZ 4NB9A 3CCU1 3VMHA 2V8KA 2H85A 2J6AA 1Q7Y1 3J80f 2O53A 1Q862 3BG0B 3HKZA 1VQO1 3GTOI 3I4MI 3U50C 1VQM1 3GTGI 2VPZA 4A3FI 3MZKB 3I551 2JNYA 1QYPA 3CC71 4NOZA 2YADA 3EERA 1VQOZ 1K8A1 1JWHC 5C3EI 3I55Z 3CC7Z 3S15I 1K9M2 3J80b 2JUBA 3HOZI 1NJI2 1W2BY 2K3RA 2Y0SA 3CCL1 2GU2A 4S1TA 4DK1A 3S1NI 4MH4A 4A3JI 1VQ71 4BY1I 1N8R1 2LFUA 1WCMI 5T64A 2QKDA 4A3BI 3M3YI 4NBHA 2Q51A 3CCLZ 2PK7A 2E2HI 1TWCI
chains in the Genus database with same CATH topology
2WAQA 3GTJI 1VQ9Z 3CPWZ 3RZDI 4MD8A 2DE7A 2RBLA 2RIQA 4NB8A 1YJW1 2JS4A 3QWUA 1QVGY 5AN9F 2BJOA 3D9XA 3CCQ1 4CL1A 4NBGA 2JA7I 2VUMI 1QF8A 2NVTI 4Y7NI 1Q7Y2 2R92I 2DE5A 1Y1VS 1YHQ1 3GCFA 3GKQA 1L1OC 4E2WA 3HOUI 3CCE1 2ZAEB 3M4OI 5IP9I 1KRLA 3S2DI 5CM2M 1YHQZ 1VQKZ 1K8A2 4X6AI 3IF8A 1VQ41 1VQL1 3I4NI 2AKLA 4E2ZA 3GTPI 1ZB9A 3H3VJ 3VTNA 1VQLZ 2JA6I 1NP6A 1N8R2 2I3CA 4RVDA 2QA41 1VQ8Z 5D1PA 2OTL1 4A93I 3NDIA 3OW2Y 1RO0A 1PFTA 4RV9A 1NUIA 1RQFA 1RO4A 2QRDB 4A3KI 1KD11 3CMA1 1VQNZ 4HGYA 1YIJZ 2OTLZ 4E2XA 1K83I 4A3II 4TNUA 2KPIA 4MRIA 3CC21 4NBCA 4E31A 4EWCA 3IFUA 5T67A 3FKII 3I561 1ZH1A 5C44I 4E30A 4A3EI 1JJ2Y 4NBBA 3KIHA 2PM9A 3D6WA 3CXCZ 1USPB 2RT9A 3ESWA 1ML8A 1I6HI 3CC2Z 1KC81 3I56Z 3RZOI 4BBSI 1TFIA 4QTTA 1YUKA 3MONA 4NBAA 3PO2I 2EGTA 4XX2A 5FLXf 4A3GI 1KQSY 3S1RI 3HOWI 4NFRA 3G71Z 1VQ91 3G4S1 3CME1 1X3ZA 2HU9A 1ZB8A 2VF1A 2F4OA 3CC41 3G4SZ 1Z01A 3Q87A 3CMEZ 1I50I 2QLVB 5D1OB 1KD12 2QRCB 2QEX1 3CCV1 2E2II 4HH4A 3CC4Z 4NBDA 5LL6f 2W04A 5A2Qf 4AYBA 5IP7I 4BY7I 2K5RA 3NFZA 3GTLI 2QEXZ 3CCVZ 3PO3S 2DE6A 3KIFA 3NDJA 4RVGA 1X0TA 3CCRZ 3CCJ1 1VQK1 3VB9A 1KC82 3P5JB 3HOYI 1USPA 1TWHI 1W2BZ 3CCJZ 1VQ51 3CD6Z 5A2Qb 3S14I 4BBRI 1M1K1 3NH4A 1Q821 1VQ81 1VQ5Z 1X3WA 1YUAA 1VQN1 1VQPZ 1YIJ1 2VUGA 2P28A 2OZKA 1QVFY 3S1QI 1QVGZ 3NH5A 4MD9A 2GTHA 1YJN1 5IT9f 3IX0A 1LQLA 3LUSA 1WW9A 2WB1A 3TE5B 4RVFA 2RPRA 1YJNZ 3EEDA 3GTQI 2V8IA 3J7A4 2M48A 3VMIA 1SFOI 4RS4A 3F3FC 1P9NA 1Q811 5IT9b 1YIT1 3CPWY 1TWFI 4DGLA 3MZLB 4E32A 3JAMf 2NVXI 3S1MI 3G711 1RO2A 1WIIA 1M1K2 1YITZ 1Q822 2NVYI 2V8JA 3CCUZ 2F4MA 2O4HA 3K7AI 3OW2Z 4A3LI 3TDHB 1QVFZ 4MXUA 4A3CI 3GTMI 4MD7A 1Z02A 1VQMZ 3FQQA 2OOXB 2JR6A 4RVHA 5T6BA 2Q4ZA 5C4XI 3JAMb 2R93I 3CCS1 2E2JI 3CCM1 5FLXb 3I07A 1N2FA 3S16I 2QR1B 1RLYA 4E33A 1JJ2Z 1S7MA 3CCSZ 3CCMZ 3S2HI 3CCR1 2PMZA 1VQ61 3F3PC 4A3MI 4E2YA 1R9TI 1VQ7Z 2OTJ1 3J81f 1DL6A 5FLMI 3CD61 1M901 1VQ6Z 1RNIA 3G6E1 4DQYB 3H0GI 2M6NA 1K731 2OTJZ 1KQSZ 1Q812 2P3YA 2YU9I 4QTUA 1YJ91 1YI21 3NH8A 3G6EZ 4BXXI 3BG1B 1Q861 3FQMA 4NBFA 1TWGI 2IZ4A 1YJWZ 4MONA 1S721 3J81b 1VQP1 1YI2Z 1YJ9Z 3CCQZ 1Z03A 2QREB 2IZ3A 3CQZI 1Y1WI 4Y52I 1S72Z 3CXCY 1TWAI 2GTIA 3CCEZ 1K9M1 5C4JI 4A3DI 1NJI1 2RHBA 2B63I 2JA8I 3GTKI 3HOXI 2G2KA 4NBEA 2JMOA 3GTMS 4HGZA 2E9HA 1VQ4Z 5D1OA 3HOVI 2HF1A 2JA5I 2NVQI 3PO3I 1Y1VI 1I3QI 2OOYB 2W03A 2QA4Z 1VLAA 3T4NB 2R6MA 3VMGA 1M902 2KI7B 2LIYA 4NH1C 1K732 2R7ZI 3S17I 3CMAZ 4NB9A 3CCU1 3VMHA 2V8KA 2H85A 2J6AA 1Q7Y1 3J80f 2O53A 1Q862 3BG0B 3HKZA 1VQO1 3GTOI 3I4MI 3U50C 1VQM1 3GTGI 4A3FI 3MZKB 3I551 2JNYA 1QYPA 3CC71 4NOZA 2YADA 3EERA 1VQOZ 1K8A1 1JWHC 5C3EI 3I55Z 3CC7Z 3S15I 1K9M2 3J80b 2JUBA 3HOZI 1NJI2 1W2BY 2K3RA 2Y0SA 3CCL1 2GU2A 4S1TA 4DK1A 3S1NI 4MH4A 4A3JI 1VQ71 4BY1I 1N8R1 2LFUA 1WCMI 5T64A 2QKDA 4A3BI 3M3YI 4NBHA 2Q51A 3CCLZ 2PK7A 2E2HI 1TWCI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LQL A;  4QTT A;  3LUS A;  4NBA A;  3GTJ I;  3CQZ I;  1WW9 A;  1Y1W I;  3PO2 I;  3RZD I;  4XX2 A;  4Y52 I;  4A3G I;  2DE7 A;  2RBL A;  3S1R I;  1TWA I;  3HOW I;  4NB8 A;  2JS4 A;  3GTQ I;  2BJO A;  5C4J I;  3VMI A;  4A3D I;  1SFO I;  2B63 I;  4NBG A;  2JA7 I;  2VUM I;  2JA8 I;  2NVT I;  3GTK I;  4Y7N I;  1X3Z A;  2R92 I;  2DE5 A;  3HOX I;  4NBE A;  1Y1V S;  3GTM S;  1ZB8 A;  3GCF A;  3GKQ A;  1L1O C;  2F4O A;  1TWF I;  3HOU I;  2NVX I;  3Q87 A;  3HOV I;  3S1M I;  1I50 I;  3M4O I;  5IP9 I;  3S2D I;  2HF1 A;  2JA5 I;  5CM2 M;  2E2I I;  2NVQ I;  2NVY I;  2F4M A;  3K7A I;  3PO3 I;  4NBD A;  4A3L I;  4A3C I;  4X6A I;  1Y1V I;  1I3Q I;  5IP7 I;  3GTM I;  1VLA A;  4BY7 I;  3I4N I;  2K5R A;  3GTL I;  3VMG A;  2AKL A;  3PO3 S;  2DE6 A;  3GTP I;  1ZB9 A;  2JR6 A;  2R7Z I;  3S17 I;  3H3V J;  4NB9 A;  5C4X I;  2R93 I;  3VMH A;  2E2J I;  2J6A A;  2JA6 I;  3VB9 A;  3HOY I;  1USP A;  3I07 A;  1N2F A;  3S16 I;  4A93 I;  1TWH I;  1RLY A;  3GTO I;  3I4M I;  1PFT A;  1NUI A;  3U50 C;  3S14 I;  1RO4 A;  4BBR I;  3GTG I;  4A3K I;  4A3F I;  3S2H I;  2JNY A;  1QYP A;  4NOZ A;  1K83 I;  4A3M I;  4A3I I;  1R9T I;  3EER A;  2KPI A;  5C3E I;  1DL6 A;  5FLM I;  1X3W A;  4NBC A;  3S15 I;  3HOZ I;  1YUA A;  3FKI I;  3H0G I;  5C44 I;  4A3E I;  4NBB A;  3D6W A;  1USP B;  3ESW A;  3S1N I;  1ML8 A;  4MH4 A;  1I6H I;  2P3Y A;  4A3J I;  2YU9 I;  4BY1 I;  4QTU A;  3S1Q I;  1WCM I;  4BXX I;  4A3B I;  3RZO I;  4NBF A;  1TWG I;  3M3Y I;  4NBH A;  4BBS I;  2PK7 A;  2E2H I;  1TFI A;  1TWC I; 
#chains in the Genus database with same CATH topology
 2WAQ A;  3GTJ I;  1VQ9 Z;  1FDI A;  3CPW Z;  3RZD I;  4MD8 A;  2DE7 A;  2RBL A;  2RIQ A;  4NB8 A;  1YJW 1;  2JS4 A;  3QWU A;  1QVG Y;  5AN9 F;  2BJO A;  3D9X A;  3CCQ 1;  4CL1 A;  4NBG A;  2JA7 I;  2VUM I;  1QF8 A;  2NVT I;  4Y7N I;  1Q7Y 2;  2R92 I;  2DE5 A;  1Y1V S;  1YHQ 1;  3GCF A;  3GKQ A;  1L1O C;  2VPY A;  4E2W A;  3HOU I;  3CCE 1;  2VPX A;  2ZAE B;  3M4O I;  5IP9 I;  1KRL A;  3S2D I;  5CM2 M;  1YHQ Z;  1AA6 A;  1VQK Z;  1K8A 2;  4X6A I;  3IF8 A;  1VQ4 1;  1VQL 1;  3I4N I;  2AKL A;  2V45 A;  4E2Z A;  3GTP I;  1ZB9 A;  3H3V J;  3VTN A;  1VQL Z;  2JA6 I;  1NP6 A;  1N8R 2;  2I3C A;  4RVD A;  2QA4 1;  1VQ8 Z;  5D1P A;  2OTL 1;  4A93 I;  3NDI A;  3OW2 Y;  1RO0 A;  1PFT A;  4RV9 A;  1NUI A;  1RQF A;  1RO4 A;  2QRD B;  2V3V A;  2JIP A;  4A3K I;  1KD1 1;  3CMA 1;  1VQN Z;  4HGY A;  1YIJ Z;  2OTL Z;  4E2X A;  1K83 I;  4A3I I;  4TNU A;  2JIR A;  2KPI A;  4MRI A;  3CC2 1;  4NBC A;  4E31 A;  4EWC A;  3IFU A;  5T67 A;  3FKI I;  3I56 1;  1ZH1 A;  5C44 I;  4E30 A;  4A3E I;  1JJ2 Y;  4NBB A;  3KIH A;  2PM9 A;  3D6W A;  3CXC Z;  1USP B;  2RT9 A;  3ESW A;  1ML8 A;  1I6H I;  3CC2 Z;  1KC8 1;  3I56 Z;  3RZO I;  1WZN A;  4BBS I;  1TFI A;  4QTT A;  1YUK A;  3MON A;  4NBA A;  3PO2 I;  2EGT A;  4XX2 A;  5FLX f;  4A3G I;  1KQS Y;  3S1R I;  3HOW I;  4NFR A;  3G71 Z;  1VQ9 1;  3G4S 1;  2VPW A;  3CME 1;  1X3Z A;  2HU9 A;  1ZB8 A;  2VF1 A;  1FDO A;  2F4O A;  3CC4 1;  3G4S Z;  1Z01 A;  3Q87 A;  3D2L A;  3CME Z;  1I50 I;  2QLV B;  5D1O B;  1KD1 2;  2QRC B;  2QEX 1;  3CCV 1;  2E2I I;  4HH4 A;  3CC4 Z;  4NBD A;  5LL6 f;  2W04 A;  5A2Q f;  4AYB A;  5IP7 I;  4BY7 I;  2K5R A;  3NFZ A;  3GTL I;  2IV2 X;  2QEX Z;  3CCV Z;  3PO3 S;  2DE6 A;  3KIF A;  3NDJ A;  4RVG A;  1X0T A;  3CCR Z;  3CCJ 1;  1VQK 1;  3VB9 A;  1KC8 2;  3P5J B;  3HOY I;  1USP A;  1TWH I;  1W2B Z;  3CCJ Z;  1VQ5 1;  3CD6 Z;  5A2Q b;  3S14 I;  4BBR I;  1M1K 1;  3NH4 A;  1Q82 1;  1VQ8 1;  1VQ5 Z;  1X3W A;  1YUA A;  1VQN 1;  1VQP Z;  1YIJ 1;  2VUG A;  2P28 A;  1Q16 A;  2OZK A;  1QVF Y;  3S1Q I;  1QVG Z;  3NH5 A;  4MD9 A;  2GTH A;  1YJN 1;  5IT9 f;  3IX0 A;  1LQL A;  3LUS A;  1WW9 A;  2WB1 A;  2AYD A;  3TE5 B;  4RVF A;  3IR7 A;  2RPR A;  1YJN Z;  3EED A;  3GTQ I;  2V8I A;  1Y8C A;  3J7A 4;  2M48 A;  3VMI A;  1SFO I;  4RS4 A;  3F3F C;  1P9N A;  1Q81 1;  5IT9 b;  1YIT 1;  3CPW Y;  1TWF I;  4DGL A;  3MZL B;  4E32 A;  3JAM f;  2NVX I;  3S1M I;  3G71 1;  1RO2 A;  1WII A;  1M1K 2;  1YIT Z;  1Q82 2;  2NVY I;  2V8J A;  3CCU Z;  2F4M A;  2O4H A;  3K7A I;  3OW2 Z;  4A3L I;  3TDH B;  1QVF Z;  4MXU A;  4A3C I;  3GTM I;  2E7Z A;  4MD7 A;  1Z02 A;  1VQM Z;  3FQQ A;  2OOX B;  2JR6 A;  4RVH A;  5T6B A;  2Q4Z A;  5C4X I;  3JAM b;  2R93 I;  3CCS 1;  2E2J I;  3CCM 1;  5FLX b;  3I07 A;  1N2F A;  3S16 I;  2QR1 B;  1RLY A;  4E33 A;  1JJ2 Z;  1S7M A;  3CCS Z;  3CCM Z;  3S2H I;  1SIW A;  3CCR 1;  2PMZ A;  1VQ6 1;  3F3P C;  4A3M I;  4E2Y A;  1R9T I;  1VQ7 Z;  2OTJ 1;  3J81 f;  1DL6 A;  5FLM I;  3CD6 1;  1M90 1;  1VQ6 Z;  1RNI A;  3G6E 1;  4DQY B;  3H0G I;  2M6N A;  1K73 1;  2OTJ Z;  1KQS Z;  1Q81 2;  2P3Y A;  2YU9 I;  4QTU A;  1YJ9 1;  1YI2 1;  3NH8 A;  3G6E Z;  4BXX I;  3BG1 B;  1Q86 1;  3FQM A;  4NBF A;  1TWG I;  2IZ4 A;  1YJW Z;  4MON A;  1S72 1;  3J81 b;  1VQP 1;  1YI2 Z;  1YJ9 Z;  3CCQ Z;  1Z03 A;  2QRE B;  2IZ3 A;  3CQZ I;  1Y1W I;  4Y52 I;  2LEX A;  2NAP A;  1WJ2 A;  1S72 Z;  3CXC Y;  1TWA I;  2GTI A;  2JIQ A;  1QXF A;  3CCE Z;  1K9M 1;  5C4J I;  4A3D I;  1NJI 1;  2RHB A;  2B63 I;  2JA8 I;  3GTK I;  3HOX I;  2G2K A;  4NBE A;  2JMO A;  3GTM S;  4HGZ A;  2E9H A;  1VQ4 Z;  2JIM A;  5D1O A;  3HOV I;  2HF1 A;  2JA5 I;  2NVQ I;  3PO3 I;  1Y1V I;  1I3Q I;  2OOY B;  2W03 A;  2QA4 Z;  1VLA A;  3T4N B;  2R6M A;  3VMG A;  1M90 2;  2KI7 B;  2LIY A;  4NH1 C;  2JIO A;  1K73 2;  2R7Z I;  3S17 I;  3CMA Z;  4NB9 A;  3CCU 1;  3VMH A;  2V8K A;  2H85 A;  2J6A A;  1Q7Y 1;  3J80 f;  2O53 A;  1Q86 2;  3BG0 B;  3HKZ A;  1VQO 1;  3GTO I;  3I4M I;  3U50 C;  1VQM 1;  3GTG I;  2VPZ A;  4A3F I;  3MZK B;  3I55 1;  2JNY A;  1QYP A;  3CC7 1;  4NOZ A;  2YAD A;  3EER A;  1VQO Z;  1K8A 1;  1JWH C;  5C3E I;  3I55 Z;  3CC7 Z;  3S15 I;  1K9M 2;  3J80 b;  2JUB A;  3HOZ I;  1NJI 2;  1W2B Y;  2K3R A;  2Y0S A;  3CCL 1;  2GU2 A;  4S1T A;  4DK1 A;  3S1N I;  4MH4 A;  4A3J I;  1VQ7 1;  4BY1 I;  1N8R 1;  2LFU A;  1WCM I;  5T64 A;  2QKD A;  4A3B I;  3M3Y I;  4NBH A;  2Q51 A;  3CCL Z;  2PK7 A;  2E2H I;  1TWC I; 
#chains in the Genus database with same CATH homology
 2WAQ A;  3GTJ I;  1VQ9 Z;  3CPW Z;  3RZD I;  4MD8 A;  2DE7 A;  2RBL A;  2RIQ A;  4NB8 A;  1YJW 1;  2JS4 A;  3QWU A;  1QVG Y;  5AN9 F;  2BJO A;  3D9X A;  3CCQ 1;  4CL1 A;  4NBG A;  2JA7 I;  2VUM I;  1QF8 A;  2NVT I;  4Y7N I;  1Q7Y 2;  2R92 I;  2DE5 A;  1Y1V S;  1YHQ 1;  3GCF A;  3GKQ A;  1L1O C;  4E2W A;  3HOU I;  3CCE 1;  2ZAE B;  3M4O I;  5IP9 I;  1KRL A;  3S2D I;  5CM2 M;  1YHQ Z;  1VQK Z;  1K8A 2;  4X6A I;  3IF8 A;  1VQ4 1;  1VQL 1;  3I4N I;  2AKL A;  4E2Z A;  3GTP I;  1ZB9 A;  3H3V J;  3VTN A;  1VQL Z;  2JA6 I;  1NP6 A;  1N8R 2;  2I3C A;  4RVD A;  2QA4 1;  1VQ8 Z;  5D1P A;  2OTL 1;  4A93 I;  3NDI A;  3OW2 Y;  1RO0 A;  1PFT A;  4RV9 A;  1NUI A;  1RQF A;  1RO4 A;  2QRD B;  4A3K I;  1KD1 1;  3CMA 1;  1VQN Z;  4HGY A;  1YIJ Z;  2OTL Z;  4E2X A;  1K83 I;  4A3I I;  4TNU A;  2KPI A;  4MRI A;  3CC2 1;  4NBC A;  4E31 A;  4EWC A;  3IFU A;  5T67 A;  3FKI I;  3I56 1;  1ZH1 A;  5C44 I;  4E30 A;  4A3E I;  1JJ2 Y;  4NBB A;  3KIH A;  2PM9 A;  3D6W A;  3CXC Z;  1USP B;  2RT9 A;  3ESW A;  1ML8 A;  1I6H I;  3CC2 Z;  1KC8 1;  3I56 Z;  3RZO I;  4BBS I;  1TFI A;  4QTT A;  1YUK A;  3MON A;  4NBA A;  3PO2 I;  2EGT A;  4XX2 A;  5FLX f;  4A3G I;  1KQS Y;  3S1R I;  3HOW I;  4NFR A;  3G71 Z;  1VQ9 1;  3G4S 1;  3CME 1;  1X3Z A;  2HU9 A;  1ZB8 A;  2VF1 A;  2F4O A;  3CC4 1;  3G4S Z;  1Z01 A;  3Q87 A;  3CME Z;  1I50 I;  2QLV B;  5D1O B;  1KD1 2;  2QRC B;  2QEX 1;  3CCV 1;  2E2I I;  4HH4 A;  3CC4 Z;  4NBD A;  5LL6 f;  2W04 A;  5A2Q f;  4AYB A;  5IP7 I;  4BY7 I;  2K5R A;  3NFZ A;  3GTL I;  2QEX Z;  3CCV Z;  3PO3 S;  2DE6 A;  3KIF A;  3NDJ A;  4RVG A;  1X0T A;  3CCR Z;  3CCJ 1;  1VQK 1;  3VB9 A;  1KC8 2;  3P5J B;  3HOY I;  1USP A;  1TWH I;  1W2B Z;  3CCJ Z;  1VQ5 1;  3CD6 Z;  5A2Q b;  3S14 I;  4BBR I;  1M1K 1;  3NH4 A;  1Q82 1;  1VQ8 1;  1VQ5 Z;  1X3W A;  1YUA A;  1VQN 1;  1VQP Z;  1YIJ 1;  2VUG A;  2P28 A;  2OZK A;  1QVF Y;  3S1Q I;  1QVG Z;  3NH5 A;  4MD9 A;  2GTH A;  1YJN 1;  5IT9 f;  3IX0 A;  1LQL A;  3LUS A;  1WW9 A;  2WB1 A;  3TE5 B;  4RVF A;  2RPR A;  1YJN Z;  3EED A;  3GTQ I;  2V8I A;  3J7A 4;  2M48 A;  3VMI A;  1SFO I;  4RS4 A;  3F3F C;  1P9N A;  1Q81 1;  5IT9 b;  1YIT 1;  3CPW Y;  1TWF I;  4DGL A;  3MZL B;  4E32 A;  3JAM f;  2NVX I;  3S1M I;  3G71 1;  1RO2 A;  1WII A;  1M1K 2;  1YIT Z;  1Q82 2;  2NVY I;  2V8J A;  3CCU Z;  2F4M A;  2O4H A;  3K7A I;  3OW2 Z;  4A3L I;  3TDH B;  1QVF Z;  4MXU A;  4A3C I;  3GTM I;  4MD7 A;  1Z02 A;  1VQM Z;  3FQQ A;  2OOX B;  2JR6 A;  4RVH A;  5T6B A;  2Q4Z A;  5C4X I;  3JAM b;  2R93 I;  3CCS 1;  2E2J I;  3CCM 1;  5FLX b;  3I07 A;  1N2F A;  3S16 I;  2QR1 B;  1RLY A;  4E33 A;  1JJ2 Z;  1S7M A;  3CCS Z;  3CCM Z;  3S2H I;  3CCR 1;  2PMZ A;  1VQ6 1;  3F3P C;  4A3M I;  4E2Y A;  1R9T I;  1VQ7 Z;  2OTJ 1;  3J81 f;  1DL6 A;  5FLM I;  3CD6 1;  1M90 1;  1VQ6 Z;  1RNI A;  3G6E 1;  4DQY B;  3H0G I;  2M6N A;  1K73 1;  2OTJ Z;  1KQS Z;  1Q81 2;  2P3Y A;  2YU9 I;  4QTU A;  1YJ9 1;  1YI2 1;  3NH8 A;  3G6E Z;  4BXX I;  3BG1 B;  1Q86 1;  3FQM A;  4NBF A;  1TWG I;  2IZ4 A;  1YJW Z;  4MON A;  1S72 1;  3J81 b;  1VQP 1;  1YI2 Z;  1YJ9 Z;  3CCQ Z;  1Z03 A;  2QRE B;  2IZ3 A;  3CQZ I;  1Y1W I;  4Y52 I;  1S72 Z;  3CXC Y;  1TWA I;  2GTI A;  3CCE Z;  1K9M 1;  5C4J I;  4A3D I;  1NJI 1;  2RHB A;  2B63 I;  2JA8 I;  3GTK I;  3HOX I;  2G2K A;  4NBE A;  2JMO A;  3GTM S;  4HGZ A;  2E9H A;  1VQ4 Z;  5D1O A;  3HOV I;  2HF1 A;  2JA5 I;  2NVQ I;  3PO3 I;  1Y1V I;  1I3Q I;  2OOY B;  2W03 A;  2QA4 Z;  1VLA A;  3T4N B;  2R6M A;  3VMG A;  1M90 2;  2KI7 B;  2LIY A;  4NH1 C;  1K73 2;  2R7Z I;  3S17 I;  3CMA Z;  4NB9 A;  3CCU 1;  3VMH A;  2V8K A;  2H85 A;  2J6A A;  1Q7Y 1;  3J80 f;  2O53 A;  1Q86 2;  3BG0 B;  3HKZ A;  1VQO 1;  3GTO I;  3I4M I;  3U50 C;  1VQM 1;  3GTG I;  4A3F I;  3MZK B;  3I55 1;  2JNY A;  1QYP A;  3CC7 1;  4NOZ A;  2YAD A;  3EER A;  1VQO Z;  1K8A 1;  1JWH C;  5C3E I;  3I55 Z;  3CC7 Z;  3S15 I;  1K9M 2;  3J80 b;  2JUB A;  3HOZ I;  1NJI 2;  1W2B Y;  2K3R A;  2Y0S A;  3CCL 1;  2GU2 A;  4S1T A;  4DK1 A;  3S1N I;  4MH4 A;  4A3J I;  1VQ7 1;  4BY1 I;  1N8R 1;  2LFU A;  1WCM I;  5T64 A;  2QKD A;  4A3B I;  3M3Y I;  4NBH A;  2Q51 A;  3CCL Z;  2PK7 A;  2E2H I;  1TWC I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...