1K83I

Crystal structure of yeast rna polymerase ii complexed with the inhibitor alpha amanitin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
122
structure length
122
Chain Sequence
b'MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Structural Basis of Transcription: Alpha-Amanitin-RNA Polymerase II Cocrystal at 2.8 A Resolution.
pubmed doi rcsb
molecule tags Transcription/toxin
total genus 12
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2001-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1k83I02
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1k83I01
3U50C 3HOZI 4NBEA 4A3GI 3HOWI 4A3JI 3HOYI 1TWGI 5C4JI 3GTMI 3FKII 3I07A 1L1OC 2PK7A 3I4MI 3S1QI 2NVQI 4A3LI 4X6AI 2JA8I 3PO2I 2NVYI 4A3CI 2E2JI 1TWCI 2F4OA 1TFIA 1Y1VS 1I6HI 1R9TI 1WCMI 3VMIA 3K7AI 3S17I 4XX2A 3GTOI 1TWHI 2JA7I 5IP7I 2YU9I 4NOZA 2JA5I 1N2FA 3EERA 3CQZI 3PO3I 3S1MI 5C44I 2DE6A 3S16I 2KPIA 3GTLI 1LQLA 4Y7NI 3Q87A 2J6AA 1X3WA 4MH4A 3S14I 5C3EI 5FLMI 3GTJI 3LUSA 3S2DI 1DL6A 2R92I 3RZDI 4BBSI 4BBRI 3GTPI 3GKQA 2F4MA 2E2HI 3GTKI 1K83I 1Y1WI 3HOXI 5C4XI 4NBFA 3VMHA 1TWAI 1ML8A 3VB9A 1ZB8A 1ZB9A 4A3BI 4QTUA 4A3KI 1PFTA 4A93I 3M4OI 2K5RA 2B63I 1I50I 3I4NI 3M3YI 4NBCA 3GCFA 4A3EI 3HOUI 4BY7I 4QTTA 2JS4A 2VUMI 4A3MI 2E2II 2R93I 3VMGA 4BY1I 1NUIA 1USPB 2JA6I 1SFOI 1Y1VI 4NBAA 3HOVI 4NBBA 4NBGA 3D6WA 4A3FI 1WW9A 4NB9A 2RBLA 1RLYA 3H3VJ 4NBHA 2NVXI 1VLAA 1X3ZA 3S1NI 4Y52I 2NVTI 3PO3S 1RO4A 3GTMS 3H0GI 1QYPA 3S2HI 2JNYA 3GTQI 1TWFI 4A3DI 2BJOA 2HF1A 1YUAA 2R7ZI 4A3II 3ESWA 2JR6A 2P3YA 4BXXI 3S15I 3S1RI 1USPA 2AKLA 1I3QI 2DE7A 5IP9I 2DE5A 4NBDA 3GTGI 5CM2M 3RZOI 4NB8A
chains in the Genus database with same CATH superfamily
3U50C 3HOZI 4NBEA 1WZNA 2V8IA 3CXCY 4A3JI 1VQ7Z 1Q812 1Q7Y2 3CMEZ 1Q7Y1 2PK7A 3I4MI 3G6EZ 1VQ81 3CCL1 2NVQI 4MD9A 1K8A2 2VPYA 3CMAZ 3PO2I 3CXCZ 2QEXZ 2E2JI 4HGYA 3IF8A 3EEDA 4MONA 2LEXA 2VF1A 4XX2A 3GTOI 5D1OB 2NAPA 3TDHB 2YU9I 1VQPZ 3JAMf 5IT9b 2JMOA 3GTLI 1X3WA 3S14I 4MD7A 5FLMI 3S2DI 2IV2X 4BBSI 3GKQA 1KC82 1KQSY 1KC81 2GTIA 1JWHC 4NBFA 2E7ZA 3CCE1 3CCV1 4A3BI 4A93I 1K9M1 3CC41 1Z01A 3J80f 1KQSZ 1YJ9Z 2JUBA 2V8JA 3F3PC 3VTNA 3J7A4 3GCFA 4A3EI 4QTTA 3CCU1 2E2II 1NUIA 1NJI2 4NBGA 1YIJZ 1NJI1 4DGLA 3G71Z 1QVGZ 4NB9A 2M6NA 2NVXI 1SIWA 2JIMA 1Q822 2NVTI 3PO3S 1Q821 2E9HA 1QYPA 4NH1C 3IFUA 1YUAA 2V3VA 1S721 3ESWA 3CD61 3S1RI 3S15I 2RHBA 3F3FC 3CCR1 3HOVI 3GTGI 1VQMZ 1YJWZ 4E2YA 3I55Z 3P5JB 1TWGI 1VQ71 3GTMI 3CME1 3CCQZ 3G6E1 4A3LI 4X6AI 2QA4Z 2V8KA 3CMA1 5A2Qf 3CC7Z 5T67A 2QEX1 2VPWA 3FQQA 1TWHI 1YI21 4NOZA 1N2FA 3EERA 1VQP1 3S1MI 2DE6A 1Q811 3S16I 4DQYB 4Y7NI 2J6AA 4MH4A 1Y8CA 1K8A1 3LUSA 4RS4A 1Z03A 2F4MA 2VPXA 5LL6f 3CC2Z 2O53A 1K83I 3HOXI 2M48A 5C4XI 1RQFA 3VMHA 2LFUA 1S7MA 1WIIA 3BG1B 1VQLZ 4QTUA 3KIHA 4A3KI 1FDIA 2IZ4A 1RO2A 2K5RA 3CCMZ 1I50I 2YADA 1QVFY 1YJ91 1VQNZ 3I56Z 3HOUI 3FQMA 4E2XA 2K3RA 4RVHA 1SFOI 1Y1VI 1VQ9Z 4A3FI 1QVFZ 1YIJ1 1WW9A 3G711 1QF8A 1VQ6Z 1K732 3H3VJ 2O4HA 2JIOA 1K731 2QR1B 1RO4A 5FLXb 3CCLZ 3MZKB 2JNYA 3GTQI 2OOXB 5T64A 2R7ZI 1QVGY 3T4NB 4A3II 1USPA 3NFZA 4MXUA 3BG0B 2LIYA 1AA6A 5T6BA 1VQM1 4A3GI 3HOWI 3HOYI 3IR7A 3I551 4TNUA 5C4JI 3I07A 1L1OC 1VQ5Z 3CCQ1 1VQKZ 3D9XA 1Q862 2NVYI 2QA41 1QXFA 4A3CI 1Q861 2WAQA 3CC71 1TWCI 2F4OA 1TFIA 1Q16A 1R9TI 3CCSZ 3S17I 1X0TA 3K7AI 2JIQA 4E31A 2JA7I 2JA5I 2QRCB 2KPIA 2PMZA 3Q87A 2H85A 2OTLZ 3TE5B 1VQ4Z 3RZDI 1YJNZ 2Q51A 4BBRI 3GTPI 4AYBA 2E2HI 3GTKI 3G4SZ 2OTJZ 3J81b 1Y1WI 3CC21 3CCJZ 5A2Qb 3D2LA 1TWAI 3VB9A 4DK1A 1ZB8A 2QKDA 1VQL1 1PFTA 4HH4A 3M4OI 1YHQZ 2B63I 3CCM1 3KIFA 4BY7I 1VQN1 3I561 3OW2Y 1NP6A 2RT9A 4A3MI 2R93I 4BY1I 1USPB 4NBBA 1RNIA 1VQ91 1Z02A 2VPZA 3HKZA 2RBLA 3OW2Z 1VQ61 2RIQA 1X3ZA 3S1NI 2OZKA 2QLVB 1M902 1N8R2 3S2HI 1M901 1TWFI 1YITZ 1N8R1 4A3DI 2GTHA 2EGTA 2HF1A 2P28A 3NH8A 2AYDA 2JR6A 2G2KA 2AKLA 3JAMb 1VQOZ 5IT9f 1I3QI 2DE7A 5IP9I 5CM2M 3RZOI 1YI2Z 2QRDB 4E33A 4E2WA 2KI7B 1P9NA 3QWUA 3FKII 1VQ8Z 3S1QI 1VQ51 1VQK1 4MD8A 2V45A 3MONA 2JA8I 1Y1VS 5FLXf 1I6HI 4RV9A 1ZH1A 2Q4ZA 1WCMI 2Y0SA 3J80b 3CCS1 3VMIA 1KRLA 1YJW1 2R6MA 5IP7I 1K9M2 3CQZI 3PO3I 2W03A 5C44I 1M1K2 1M1K1 1LQLA 5C3EI 2OTL1 2WB1A 3GTJI 3NDIA 1VQ41 1W2BY 1DL6A 2R92I 3IX0A 4E2ZA 1YJN1 2W04A 3G4S1 1FDOA 4E30A 2OTJ1 5AN9F 3CCEZ 5D1OA 3CCJ1 3CCVZ 1ML8A 1ZB9A 1W2BZ 1YUKA 3CC4Z 4S1TA 1JJ2Y 1YHQ1 3I4NI 1RO0A 4CL1A 3M3YI 4NBCA 4HGZA 3CCUZ 4E32A 4MRIA 2JS4A 2VUMI 4NFRA 2RPRA 3VMGA 2JA6I 1JJ2Z 4NBAA 1WJ2A 3D6WA 1RLYA 2I3CA 2QREB 4NBHA 2IZ3A 1VLAA 2HU9A 4Y52I 3GTMS 2OOYB 3NH4A 4RVDA 3H0GI 2GU2A 3NH5A 3CPWY 1YIT1 2BJOA 3J81f 2JIPA 1S72Z 1KD12 2ZAEB 5D1PA 1KD11 3CD6Z 2P3YA 2JIRA 4BXXI 4RVGA 2VUGA 3MZLB 3CCRZ 3CPWZ 1VQO1 3NDJA 2DE5A 4NBDA 2PM9A 4RVFA 4NB8A 4EWCA
chains in the Genus database with same CATH topology
3U50C 3HOZI 4NBEA 2V8IA 3CXCY 4A3JI 1VQ7Z 1Q812 1Q7Y2 3CMEZ 1Q7Y1 2PK7A 3I4MI 3G6EZ 1VQ81 3CCL1 2NVQI 4MD9A 1K8A2 3CMAZ 3PO2I 3CXCZ 2QEXZ 2E2JI 4HGYA 3IF8A 3EEDA 4MONA 2VF1A 4XX2A 3GTOI 5D1OB 3TDHB 2YU9I 1VQPZ 3JAMf 5IT9b 2JMOA 3GTLI 1X3WA 3S14I 4MD7A 5FLMI 3S2DI 4BBSI 3GKQA 1KC82 1KQSY 1KC81 2GTIA 1JWHC 4NBFA 3CCE1 3CCV1 4A3BI 4A93I 1K9M1 3CC41 1Z01A 3J80f 1KQSZ 1YJ9Z 2JUBA 2V8JA 3F3PC 3VTNA 3J7A4 3GCFA 4A3EI 4QTTA 3CCU1 2E2II 1NUIA 1NJI2 4NBGA 1YIJZ 1NJI1 4DGLA 3G71Z 1QVGZ 4NB9A 2M6NA 2NVXI 1Q822 2NVTI 3PO3S 1Q821 2E9HA 1QYPA 4NH1C 3IFUA 1YUAA 1S721 3ESWA 3CD61 3S1RI 3S15I 2RHBA 3F3FC 3CCR1 3HOVI 3GTGI 1VQMZ 1YJWZ 4E2YA 3I55Z 3P5JB 1TWGI 1VQ71 3GTMI 3CME1 3CCQZ 3G6E1 4A3LI 4X6AI 2QA4Z 2V8KA 3CMA1 5A2Qf 3CC7Z 5T67A 2QEX1 3FQQA 1TWHI 1YI21 4NOZA 1N2FA 3EERA 1VQP1 3S1MI 2DE6A 1Q811 3S16I 4DQYB 4Y7NI 2J6AA 4MH4A 1K8A1 3LUSA 4RS4A 1Z03A 2F4MA 5LL6f 3CC2Z 2O53A 1K83I 3HOXI 2M48A 5C4XI 1RQFA 3VMHA 2LFUA 1S7MA 1WIIA 3BG1B 1VQLZ 4QTUA 3KIHA 4A3KI 2IZ4A 1RO2A 2K5RA 3CCMZ 1I50I 2YADA 1QVFY 1YJ91 1VQNZ 3I56Z 3HOUI 3FQMA 4E2XA 2K3RA 4RVHA 1SFOI 1Y1VI 1VQ9Z 4A3FI 1QVFZ 1YIJ1 1WW9A 3G711 1QF8A 1VQ6Z 1K732 3H3VJ 2O4HA 1K731 2QR1B 1RO4A 5FLXb 3CCLZ 3MZKB 2JNYA 3GTQI 2OOXB 5T64A 2R7ZI 1QVGY 3T4NB 4A3II 1USPA 3NFZA 4MXUA 3BG0B 2LIYA 5T6BA 1VQM1 4A3GI 3HOWI 3HOYI 3I551 4TNUA 5C4JI 3I07A 1L1OC 1VQ5Z 3CCQ1 1VQKZ 3D9XA 1Q862 2NVYI 2QA41 4A3CI 1Q861 2WAQA 3CC71 1TWCI 2F4OA 1TFIA 1R9TI 3CCSZ 3S17I 1X0TA 3K7AI 4E31A 2JA7I 2JA5I 2QRCB 2KPIA 2PMZA 3Q87A 2H85A 2OTLZ 3TE5B 1VQ4Z 3RZDI 1YJNZ 2Q51A 4BBRI 3GTPI 4AYBA 2E2HI 3GTKI 3G4SZ 2OTJZ 3J81b 1Y1WI 3CC21 3CCJZ 5A2Qb 1TWAI 3VB9A 4DK1A 1ZB8A 2QKDA 1VQL1 1PFTA 4HH4A 3M4OI 1YHQZ 2B63I 3CCM1 3KIFA 4BY7I 1VQN1 3I561 3OW2Y 1NP6A 2RT9A 4A3MI 2R93I 4BY1I 1USPB 4NBBA 1RNIA 1VQ91 1Z02A 3HKZA 2RBLA 3OW2Z 1VQ61 2RIQA 1X3ZA 3S1NI 2OZKA 2QLVB 1M902 1N8R2 3S2HI 1M901 1TWFI 1YITZ 1N8R1 4A3DI 2GTHA 2EGTA 2HF1A 2P28A 3NH8A 2JR6A 2G2KA 2AKLA 3JAMb 1VQOZ 5IT9f 1I3QI 2DE7A 5IP9I 5CM2M 3RZOI 1YI2Z 2QRDB 4E33A 4E2WA 2KI7B 1P9NA 3QWUA 3FKII 1VQ8Z 3S1QI 1VQ51 1VQK1 4MD8A 3MONA 2JA8I 1Y1VS 5FLXf 1I6HI 4RV9A 1ZH1A 2Q4ZA 1WCMI 2Y0SA 3J80b 3CCS1 3VMIA 1KRLA 1YJW1 2R6MA 5IP7I 1K9M2 3CQZI 3PO3I 2W03A 5C44I 1M1K2 1M1K1 1LQLA 5C3EI 2OTL1 2WB1A 3GTJI 3NDIA 1VQ41 1W2BY 1DL6A 2R92I 3IX0A 4E2ZA 1YJN1 2W04A 3G4S1 4E30A 2OTJ1 5AN9F 3CCEZ 5D1OA 3CCJ1 3CCVZ 1ML8A 1ZB9A 1W2BZ 1YUKA 3CC4Z 4S1TA 1JJ2Y 1YHQ1 3I4NI 1RO0A 4CL1A 3M3YI 4NBCA 4HGZA 3CCUZ 4E32A 4MRIA 2JS4A 2VUMI 4NFRA 2RPRA 3VMGA 2JA6I 1JJ2Z 4NBAA 3D6WA 1RLYA 2I3CA 2QREB 4NBHA 2IZ3A 1VLAA 2HU9A 4Y52I 3GTMS 2OOYB 3NH4A 4RVDA 3H0GI 2GU2A 3NH5A 3CPWY 1YIT1 2BJOA 3J81f 1S72Z 1KD12 2ZAEB 5D1PA 1KD11 3CD6Z 2P3YA 4BXXI 4RVGA 2VUGA 3MZLB 3CCRZ 3CPWZ 1VQO1 3NDJA 2DE5A 4NBDA 2PM9A 4RVFA 4NB8A 4EWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U50 C;  3HOZ I;  4NBE A;  4A3G I;  3HOW I;  4A3J I;  3HOY I;  1TWG I;  5C4J I;  3GTM I;  3FKI I;  3I07 A;  1L1O C;  2PK7 A;  3I4M I;  3S1Q I;  2NVQ I;  4A3L I;  4X6A I;  2JA8 I;  3PO2 I;  2NVY I;  4A3C I;  2E2J I;  1TWC I;  2F4O A;  1TFI A;  1Y1V S;  1I6H I;  1R9T I;  1WCM I;  3VMI A;  3K7A I;  3S17 I;  4XX2 A;  3GTO I;  1TWH I;  2JA7 I;  5IP7 I;  2YU9 I;  4NOZ A;  2JA5 I;  1N2F A;  3EER A;  3CQZ I;  3PO3 I;  3S1M I;  5C44 I;  2DE6 A;  3S16 I;  2KPI A;  3GTL I;  1LQL A;  4Y7N I;  3Q87 A;  2J6A A;  1X3W A;  4MH4 A;  3S14 I;  5C3E I;  5FLM I;  3GTJ I;  3LUS A;  3S2D I;  1DL6 A;  2R92 I;  3RZD I;  4BBS I;  4BBR I;  3GTP I;  3GKQ A;  2F4M A;  2E2H I;  3GTK I;  1K83 I;  1Y1W I;  3HOX I;  5C4X I;  4NBF A;  3VMH A;  1TWA I;  1ML8 A;  3VB9 A;  1ZB8 A;  1ZB9 A;  4A3B I;  4QTU A;  4A3K I;  1PFT A;  4A93 I;  3M4O I;  2K5R A;  2B63 I;  1I50 I;  3I4N I;  3M3Y I;  4NBC A;  3GCF A;  4A3E I;  3HOU I;  4BY7 I;  4QTT A;  2JS4 A;  2VUM I;  4A3M I;  2E2I I;  2R93 I;  3VMG A;  4BY1 I;  1NUI A;  1USP B;  2JA6 I;  1SFO I;  1Y1V I;  4NBA A;  3HOV I;  4NBB A;  4NBG A;  3D6W A;  4A3F I;  1WW9 A;  4NB9 A;  2RBL A;  1RLY A;  3H3V J;  4NBH A;  2NVX I;  1VLA A;  1X3Z A;  3S1N I;  4Y52 I;  2NVT I;  3PO3 S;  1RO4 A;  3GTM S;  3H0G I;  1QYP A;  3S2H I;  2JNY A;  3GTQ I;  1TWF I;  4A3D I;  2BJO A;  2HF1 A;  1YUA A;  2R7Z I;  4A3I I;  3ESW A;  2JR6 A;  2P3Y A;  4BXX I;  3S15 I;  3S1R I;  1USP A;  2AKL A;  1I3Q I;  2DE7 A;  5IP9 I;  2DE5 A;  4NBD A;  3GTG I;  5CM2 M;  3RZO I;  4NB8 A; 
#chains in the Genus database with same CATH topology
 3U50 C;  3HOZ I;  4NBE A;  1WZN A;  2V8I A;  3CXC Y;  4A3J I;  1VQ7 Z;  1Q81 2;  1Q7Y 2;  3CME Z;  1Q7Y 1;  2PK7 A;  3I4M I;  3G6E Z;  1VQ8 1;  3CCL 1;  2NVQ I;  4MD9 A;  1K8A 2;  2VPY A;  3CMA Z;  3PO2 I;  3CXC Z;  2QEX Z;  2E2J I;  4HGY A;  3IF8 A;  3EED A;  4MON A;  2LEX A;  2VF1 A;  4XX2 A;  3GTO I;  5D1O B;  2NAP A;  3TDH B;  2YU9 I;  1VQP Z;  3JAM f;  5IT9 b;  2JMO A;  3GTL I;  1X3W A;  3S14 I;  4MD7 A;  5FLM I;  3S2D I;  2IV2 X;  4BBS I;  3GKQ A;  1KC8 2;  1KQS Y;  1KC8 1;  2GTI A;  1JWH C;  4NBF A;  2E7Z A;  3CCE 1;  3CCV 1;  4A3B I;  4A93 I;  1K9M 1;  3CC4 1;  1Z01 A;  3J80 f;  1KQS Z;  1YJ9 Z;  2JUB A;  2V8J A;  3F3P C;  3VTN A;  3J7A 4;  3GCF A;  4A3E I;  4QTT A;  3CCU 1;  2E2I I;  1NUI A;  1NJI 2;  4NBG A;  1YIJ Z;  1NJI 1;  4DGL A;  3G71 Z;  1QVG Z;  4NB9 A;  2M6N A;  2NVX I;  1SIW A;  2JIM A;  1Q82 2;  2NVT I;  3PO3 S;  1Q82 1;  2E9H A;  1QYP A;  4NH1 C;  3IFU A;  1YUA A;  2V3V A;  1S72 1;  3ESW A;  3CD6 1;  3S1R I;  3S15 I;  2RHB A;  3F3F C;  3CCR 1;  3HOV I;  3GTG I;  1VQM Z;  1YJW Z;  4E2Y A;  3I55 Z;  3P5J B;  1TWG I;  1VQ7 1;  3GTM I;  3CME 1;  3CCQ Z;  3G6E 1;  4A3L I;  4X6A I;  2QA4 Z;  2V8K A;  3CMA 1;  5A2Q f;  3CC7 Z;  5T67 A;  2QEX 1;  2VPW A;  3FQQ A;  1TWH I;  1YI2 1;  4NOZ A;  1N2F A;  3EER A;  1VQP 1;  3S1M I;  2DE6 A;  1Q81 1;  3S16 I;  4DQY B;  4Y7N I;  2J6A A;  4MH4 A;  1Y8C A;  1K8A 1;  3LUS A;  4RS4 A;  1Z03 A;  2F4M A;  2VPX A;  5LL6 f;  3CC2 Z;  2O53 A;  1K83 I;  3HOX I;  2M48 A;  5C4X I;  1RQF A;  3VMH A;  2LFU A;  1S7M A;  1WII A;  3BG1 B;  1VQL Z;  4QTU A;  3KIH A;  4A3K I;  1FDI A;  2IZ4 A;  1RO2 A;  2K5R A;  3CCM Z;  1I50 I;  2YAD A;  1QVF Y;  1YJ9 1;  1VQN Z;  3I56 Z;  3HOU I;  3FQM A;  4E2X A;  2K3R A;  4RVH A;  1SFO I;  1Y1V I;  1VQ9 Z;  4A3F I;  1QVF Z;  1YIJ 1;  1WW9 A;  3G71 1;  1QF8 A;  1VQ6 Z;  1K73 2;  3H3V J;  2O4H A;  2JIO A;  1K73 1;  2QR1 B;  1RO4 A;  5FLX b;  3CCL Z;  3MZK B;  2JNY A;  3GTQ I;  2OOX B;  5T64 A;  2R7Z I;  1QVG Y;  3T4N B;  4A3I I;  1USP A;  3NFZ A;  4MXU A;  3BG0 B;  2LIY A;  1AA6 A;  5T6B A;  1VQM 1;  4A3G I;  3HOW I;  3HOY I;  3IR7 A;  3I55 1;  4TNU A;  5C4J I;  3I07 A;  1L1O C;  1VQ5 Z;  3CCQ 1;  1VQK Z;  3D9X A;  1Q86 2;  2NVY I;  2QA4 1;  1QXF A;  4A3C I;  1Q86 1;  2WAQ A;  3CC7 1;  1TWC I;  2F4O A;  1TFI A;  1Q16 A;  1R9T I;  3CCS Z;  3S17 I;  1X0T A;  3K7A I;  2JIQ A;  4E31 A;  2JA7 I;  2JA5 I;  2QRC B;  2KPI A;  2PMZ A;  3Q87 A;  2H85 A;  2OTL Z;  3TE5 B;  1VQ4 Z;  3RZD I;  1YJN Z;  2Q51 A;  4BBR I;  3GTP I;  4AYB A;  2E2H I;  3GTK I;  3G4S Z;  2OTJ Z;  3J81 b;  1Y1W I;  3CC2 1;  3CCJ Z;  5A2Q b;  3D2L A;  1TWA I;  3VB9 A;  4DK1 A;  1ZB8 A;  2QKD A;  1VQL 1;  1PFT A;  4HH4 A;  3M4O I;  1YHQ Z;  2B63 I;  3CCM 1;  3KIF A;  4BY7 I;  1VQN 1;  3I56 1;  3OW2 Y;  1NP6 A;  2RT9 A;  4A3M I;  2R93 I;  4BY1 I;  1USP B;  4NBB A;  1RNI A;  1VQ9 1;  1Z02 A;  2VPZ A;  3HKZ A;  2RBL A;  3OW2 Z;  1VQ6 1;  2RIQ A;  1X3Z A;  3S1N I;  2OZK A;  2QLV B;  1M90 2;  1N8R 2;  3S2H I;  1M90 1;  1TWF I;  1YIT Z;  1N8R 1;  4A3D I;  2GTH A;  2EGT A;  2HF1 A;  2P28 A;  3NH8 A;  2AYD A;  2JR6 A;  2G2K A;  2AKL A;  3JAM b;  1VQO Z;  5IT9 f;  1I3Q I;  2DE7 A;  5IP9 I;  5CM2 M;  3RZO I;  1YI2 Z;  2QRD B;  4E33 A;  4E2W A;  2KI7 B;  1P9N A;  3QWU A;  3FKI I;  1VQ8 Z;  3S1Q I;  1VQ5 1;  1VQK 1;  4MD8 A;  2V45 A;  3MON A;  2JA8 I;  1Y1V S;  5FLX f;  1I6H I;  4RV9 A;  1ZH1 A;  2Q4Z A;  1WCM I;  2Y0S A;  3J80 b;  3CCS 1;  3VMI A;  1KRL A;  1YJW 1;  2R6M A;  5IP7 I;  1K9M 2;  3CQZ I;  3PO3 I;  2W03 A;  5C44 I;  1M1K 2;  1M1K 1;  1LQL A;  5C3E I;  2OTL 1;  2WB1 A;  3GTJ I;  3NDI A;  1VQ4 1;  1W2B Y;  1DL6 A;  2R92 I;  3IX0 A;  4E2Z A;  1YJN 1;  2W04 A;  3G4S 1;  1FDO A;  4E30 A;  2OTJ 1;  5AN9 F;  3CCE Z;  5D1O A;  3CCJ 1;  3CCV Z;  1ML8 A;  1ZB9 A;  1W2B Z;  1YUK A;  3CC4 Z;  4S1T A;  1JJ2 Y;  1YHQ 1;  3I4N I;  1RO0 A;  4CL1 A;  3M3Y I;  4NBC A;  4HGZ A;  3CCU Z;  4E32 A;  4MRI A;  2JS4 A;  2VUM I;  4NFR A;  2RPR A;  3VMG A;  2JA6 I;  1JJ2 Z;  4NBA A;  1WJ2 A;  3D6W A;  1RLY A;  2I3C A;  2QRE B;  4NBH A;  2IZ3 A;  1VLA A;  2HU9 A;  4Y52 I;  3GTM S;  2OOY B;  3NH4 A;  4RVD A;  3H0G I;  2GU2 A;  3NH5 A;  3CPW Y;  1YIT 1;  2BJO A;  3J81 f;  2JIP A;  1S72 Z;  1KD1 2;  2ZAE B;  5D1P A;  1KD1 1;  3CD6 Z;  2P3Y A;  2JIR A;  4BXX I;  4RVG A;  2VUG A;  3MZL B;  3CCR Z;  3CPW Z;  1VQO 1;  3NDJ A;  2DE5 A;  4NBD A;  2PM9 A;  4RVF A;  4NB8 A;  4EWC A; 
#chains in the Genus database with same CATH homology
 3U50 C;  3HOZ I;  4NBE A;  2V8I A;  3CXC Y;  4A3J I;  1VQ7 Z;  1Q81 2;  1Q7Y 2;  3CME Z;  1Q7Y 1;  2PK7 A;  3I4M I;  3G6E Z;  1VQ8 1;  3CCL 1;  2NVQ I;  4MD9 A;  1K8A 2;  3CMA Z;  3PO2 I;  3CXC Z;  2QEX Z;  2E2J I;  4HGY A;  3IF8 A;  3EED A;  4MON A;  2VF1 A;  4XX2 A;  3GTO I;  5D1O B;  3TDH B;  2YU9 I;  1VQP Z;  3JAM f;  5IT9 b;  2JMO A;  3GTL I;  1X3W A;  3S14 I;  4MD7 A;  5FLM I;  3S2D I;  4BBS I;  3GKQ A;  1KC8 2;  1KQS Y;  1KC8 1;  2GTI A;  1JWH C;  4NBF A;  3CCE 1;  3CCV 1;  4A3B I;  4A93 I;  1K9M 1;  3CC4 1;  1Z01 A;  3J80 f;  1KQS Z;  1YJ9 Z;  2JUB A;  2V8J A;  3F3P C;  3VTN A;  3J7A 4;  3GCF A;  4A3E I;  4QTT A;  3CCU 1;  2E2I I;  1NUI A;  1NJI 2;  4NBG A;  1YIJ Z;  1NJI 1;  4DGL A;  3G71 Z;  1QVG Z;  4NB9 A;  2M6N A;  2NVX I;  1Q82 2;  2NVT I;  3PO3 S;  1Q82 1;  2E9H A;  1QYP A;  4NH1 C;  3IFU A;  1YUA A;  1S72 1;  3ESW A;  3CD6 1;  3S1R I;  3S15 I;  2RHB A;  3F3F C;  3CCR 1;  3HOV I;  3GTG I;  1VQM Z;  1YJW Z;  4E2Y A;  3I55 Z;  3P5J B;  1TWG I;  1VQ7 1;  3GTM I;  3CME 1;  3CCQ Z;  3G6E 1;  4A3L I;  4X6A I;  2QA4 Z;  2V8K A;  3CMA 1;  5A2Q f;  3CC7 Z;  5T67 A;  2QEX 1;  3FQQ A;  1TWH I;  1YI2 1;  4NOZ A;  1N2F A;  3EER A;  1VQP 1;  3S1M I;  2DE6 A;  1Q81 1;  3S16 I;  4DQY B;  4Y7N I;  2J6A A;  4MH4 A;  1K8A 1;  3LUS A;  4RS4 A;  1Z03 A;  2F4M A;  5LL6 f;  3CC2 Z;  2O53 A;  1K83 I;  3HOX I;  2M48 A;  5C4X I;  1RQF A;  3VMH A;  2LFU A;  1S7M A;  1WII A;  3BG1 B;  1VQL Z;  4QTU A;  3KIH A;  4A3K I;  2IZ4 A;  1RO2 A;  2K5R A;  3CCM Z;  1I50 I;  2YAD A;  1QVF Y;  1YJ9 1;  1VQN Z;  3I56 Z;  3HOU I;  3FQM A;  4E2X A;  2K3R A;  4RVH A;  1SFO I;  1Y1V I;  1VQ9 Z;  4A3F I;  1QVF Z;  1YIJ 1;  1WW9 A;  3G71 1;  1QF8 A;  1VQ6 Z;  1K73 2;  3H3V J;  2O4H A;  1K73 1;  2QR1 B;  1RO4 A;  5FLX b;  3CCL Z;  3MZK B;  2JNY A;  3GTQ I;  2OOX B;  5T64 A;  2R7Z I;  1QVG Y;  3T4N B;  4A3I I;  1USP A;  3NFZ A;  4MXU A;  3BG0 B;  2LIY A;  5T6B A;  1VQM 1;  4A3G I;  3HOW I;  3HOY I;  3I55 1;  4TNU A;  5C4J I;  3I07 A;  1L1O C;  1VQ5 Z;  3CCQ 1;  1VQK Z;  3D9X A;  1Q86 2;  2NVY I;  2QA4 1;  4A3C I;  1Q86 1;  2WAQ A;  3CC7 1;  1TWC I;  2F4O A;  1TFI A;  1R9T I;  3CCS Z;  3S17 I;  1X0T A;  3K7A I;  4E31 A;  2JA7 I;  2JA5 I;  2QRC B;  2KPI A;  2PMZ A;  3Q87 A;  2H85 A;  2OTL Z;  3TE5 B;  1VQ4 Z;  3RZD I;  1YJN Z;  2Q51 A;  4BBR I;  3GTP I;  4AYB A;  2E2H I;  3GTK I;  3G4S Z;  2OTJ Z;  3J81 b;  1Y1W I;  3CC2 1;  3CCJ Z;  5A2Q b;  1TWA I;  3VB9 A;  4DK1 A;  1ZB8 A;  2QKD A;  1VQL 1;  1PFT A;  4HH4 A;  3M4O I;  1YHQ Z;  2B63 I;  3CCM 1;  3KIF A;  4BY7 I;  1VQN 1;  3I56 1;  3OW2 Y;  1NP6 A;  2RT9 A;  4A3M I;  2R93 I;  4BY1 I;  1USP B;  4NBB A;  1RNI A;  1VQ9 1;  1Z02 A;  3HKZ A;  2RBL A;  3OW2 Z;  1VQ6 1;  2RIQ A;  1X3Z A;  3S1N I;  2OZK A;  2QLV B;  1M90 2;  1N8R 2;  3S2H I;  1M90 1;  1TWF I;  1YIT Z;  1N8R 1;  4A3D I;  2GTH A;  2EGT A;  2HF1 A;  2P28 A;  3NH8 A;  2JR6 A;  2G2K A;  2AKL A;  3JAM b;  1VQO Z;  5IT9 f;  1I3Q I;  2DE7 A;  5IP9 I;  5CM2 M;  3RZO I;  1YI2 Z;  2QRD B;  4E33 A;  4E2W A;  2KI7 B;  1P9N A;  3QWU A;  3FKI I;  1VQ8 Z;  3S1Q I;  1VQ5 1;  1VQK 1;  4MD8 A;  3MON A;  2JA8 I;  1Y1V S;  5FLX f;  1I6H I;  4RV9 A;  1ZH1 A;  2Q4Z A;  1WCM I;  2Y0S A;  3J80 b;  3CCS 1;  3VMI A;  1KRL A;  1YJW 1;  2R6M A;  5IP7 I;  1K9M 2;  3CQZ I;  3PO3 I;  2W03 A;  5C44 I;  1M1K 2;  1M1K 1;  1LQL A;  5C3E I;  2OTL 1;  2WB1 A;  3GTJ I;  3NDI A;  1VQ4 1;  1W2B Y;  1DL6 A;  2R92 I;  3IX0 A;  4E2Z A;  1YJN 1;  2W04 A;  3G4S 1;  4E30 A;  2OTJ 1;  5AN9 F;  3CCE Z;  5D1O A;  3CCJ 1;  3CCV Z;  1ML8 A;  1ZB9 A;  1W2B Z;  1YUK A;  3CC4 Z;  4S1T A;  1JJ2 Y;  1YHQ 1;  3I4N I;  1RO0 A;  4CL1 A;  3M3Y I;  4NBC A;  4HGZ A;  3CCU Z;  4E32 A;  4MRI A;  2JS4 A;  2VUM I;  4NFR A;  2RPR A;  3VMG A;  2JA6 I;  1JJ2 Z;  4NBA A;  3D6W A;  1RLY A;  2I3C A;  2QRE B;  4NBH A;  2IZ3 A;  1VLA A;  2HU9 A;  4Y52 I;  3GTM S;  2OOY B;  3NH4 A;  4RVD A;  3H0G I;  2GU2 A;  3NH5 A;  3CPW Y;  1YIT 1;  2BJO A;  3J81 f;  1S72 Z;  1KD1 2;  2ZAE B;  5D1P A;  1KD1 1;  3CD6 Z;  2P3Y A;  4BXX I;  4RVG A;  2VUG A;  3MZL B;  3CCR Z;  3CPW Z;  1VQO 1;  3NDJ A;  2DE5 A;  4NBD A;  2PM9 A;  4RVF A;  4NB8 A;  4EWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...