1K83I

Crystal structure of yeast rna polymerase ii complexed with the inhibitor alpha amanitin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
122
structure length
122
Chain Sequence
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Transcription: Alpha-Amanitin-RNA Polymerase II Cocrystal at 2.8 A Resolution.
pubmed doi rcsb
molecule tags Transcription/toxin
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
total genus 12
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2001-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1k83I02
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1k83I01
4A3EI 4A3II 3VB9A 2PK7A 2JR6A 3S17I 3CQZI 3GTOI 1N2FA 1Y1VI 1TFIA 4NBBA 5C4XI 3GTMS 4A3JI 3K7AI 4NB8A 3S1RI 2VUMI 2DE5A 3S15I 2E2HI 3ESWA 2F4OA 1PFTA 1ZB8A 1I3QI 4NBAA 4A3FI 4A3MI 2JA8I 5IP9I 4BBSI 2E2JI 1RO4A 3H3VJ 2NVTI 1YUAA 2JNYA 5FLMI 1WW9A 4BY1I 4A93I 1ZB9A 2K5RA 5CM2M 2JA5I 3S14I 1Y1WI 3GTLI 4MH4A 5C3EI 5C44I 3GTKI 1USPB 3EERA 4NBGA 2BJOA 3FKII 3LUSA 4Y7NI 4X6AI 2JA6I 5IP7I 2B63I 2P3YA 4NB9A 3VMIA 1TWFI 2RBLA 1TWGI 2NVXI 1Y1VS 2HF1A 3HOYI 2JS4A 4QTUA 3GTMI 3GCFA 3GTGI 3S2HI 4Y52I 4BBRI 3GTQI 2R7ZI 3I07A 4NBHA 5C4JI 3HOZI 1SFOI 3M3YI 3U50C 1TWAI 1I50I 4XX2A 3PO3I 1K83I 3HOUI 2JA7I 4A3LI 2E2II 4NBFA 2YU9I 4NOZA 3VMHA 1TWHI 3HOWI 2AKLA 3Q87A 2KPIA 3I4NI 4NBCA 3S1NI 4BXXI 1L1OC 3S2DI 3GTPI 4NBEA 4QTTA 3S16I 2R92I 1RLYA 1X3ZA 1X3WA 4A3BI 3D6WA 2NVYI 3RZDI 3I4MI 3PO3S 1I6HI 1USPA 1ML8A 1VLAA 4A3CI 2F4MA 3HOVI 3M4OI 4A3KI 1WCMI 1TWCI 3GTJI 3H0GI 1QYPA 3S1QI 4NBDA 2NVQI 1DL6A 2DE7A 1LQLA 4BY7I 3HOXI 3RZOI 4A3DI 3S1MI 2DE6A 3PO2I 1NUIA 3VMGA 2J6AA 2R93I 3GKQA 4A3GI 1R9TI
chains in the Genus database with same CATH superfamily
4A3EI 4RVDA 3CC41 2RPRA 2QR1B 1Y1VI 3IX0A 2KI7B 2VPZA 3VTNA 3CCEZ 2E2HI 2F4OA 2K3RA 4NBAA 2QEX1 2LIYA 4MD9A 2Y0SA 3CCVZ 3OW2Y 5FLMI 3OW2Z 1VQ5Z 4E31A 2LFUA 4MONA 3NFZA 3CC21 4MH4A 3GTLI 2OZKA 5C44I 2V8IA 4NBGA 1VQP1 2JA6I 2QLVB 2O53A 4TNUA 1TWGI 3CME1 4RS4A 2Q4ZA 1FDIA 3GCFA 4CL1A 1VQ51 2PM9A 3I07A 2VPXA 4NBHA 1K9M2 1ZH1A 2QEXZ 3U50C 1AA6A 3CCMZ 2GTHA 4MD7A 4E2ZA 3TE5B 2G2KA 4DQYB 2E9HA 1KD12 4NOZA 4E32A 3CCSZ 3VMHA 1VQ61 3HOWI 2AKLA 1KD11 1QVGY 3FQQA 2KPIA 1QVFY 3CC4Z 4RVFA 1VQOZ 4NFRA 1QVFZ 3S16I 1YI2Z 2E7ZA 2OTLZ 2R92I 1RLYA 4E2WA 1NP6A 3D6WA 2NVYI 2RHBA 1K732 3I4MI 1K9M1 5IT9f 5IT9b 1USPA 1ML8A 3P5JB 5T67A 1VLAA 2F4MA 3M4OI 3KIHA 2JIQA 1TWCI 3S1QI 1QYPA 1Q861 4MRIA 2DE7A 2OTL1 1LQLA 4A3DI 3S1MI 2DE6A 2J6AA 3GKQA 2NAPA 4E2YA 1VQO1 3CCU1 1VQN1 2AYDA 1RNIA 3CQZI 2QRCB 1YIT1 2RIQA 3I55Z 5D1OA 3GTMS 3K7AI 2IV2X 4NB8A 1WJ2A 3EEDA 3S1RI 1NJI1 2WAQA 2PMZA 3I56Z 5A2Qb 5A2Qf 3J81b 3J81f 1QXFA 4A3FI 4E33A 1WZNA 4S1TA 4HH4A 3CCV1 2E2JI 3H3VJ 2OOXB 2M6NA 4NH1C 4A93I 2JA5I 1Q16A 1M1K1 3CXCY 5C3EI 1K8A1 2Q51A 3GTKI 3I561 1X0TA 4DK1A 3LUSA 4Y7NI 1VQPZ 5IP7I 3I551 1YUKA 3CC2Z 1TWFI 2NVXI 2HF1A 2V3VA 5T64A 3CC71 1S72Z 3GTMI 2R6MA 4Y52I 4BBRI 3GTQI 3CC7Z 3CCJZ 3CCQ1 2W04A 1SFOI 3M3YI 1VQKZ 2JIMA 3BG0B 3HOUI 2JA7I 2VPWA 2LEXA 3Q87A 3CCLZ 3FQMA 1L1OC 3GTPI 1YIJZ 1P9NA 4A3BI 3CCRZ 3MONA 3RZDI 2IZ3A 1I6HI 1Q7Y2 2JIPA 4A3CI 1YJWZ 3CD6Z 4A3KI 3G711 2GU2A 2NVQI 1DL6A 3J80b 3J80f 1N8R2 3RZOI 1NUIA 3VMGA 2R93I 2V8KA 1KC81 4A3GI 3TDHB 1VQ91 3S17I 3CXCZ 3CMEZ 1KC82 2W03A 2HU9A 1N2FA 3HKZA 1TFIA 1N8R1 4NBBA 4RVGA 5C4XI 1VQ71 1Q812 3JAMb 3JAMf 3G6EZ 2VF1A 1JWHC 2VUMI 2QA4Z 1YIJ1 1YI21 3S15I 3ESWA 1YJ91 4A3MI 1I3QI 1VQ4Z 5IP9I 1M902 3NDIA 3IR7A 2NVTI 1YUAA 2EGTA 4BY1I 1ZB9A 2OTJZ 2K5RA 5CM2M 3S14I 1Y1WI 2VPYA 4E2XA 1VQ81 1YJN1 1USPB 3IFUA 4E30A 3CCM1 3FKII 3NH4A 2M48A 4AYBA 1RO2A 3F3PC 1VQ8Z 2RBLA 2JS4A 1QVGZ 1VQ41 3S2HI 5C4JI 3NH5A 3HOZI 3J7A4 1TWAI 1I50I 3MZKB 2QA41 1Q821 1K83I 1Q7Y1 4A3LI 2E2II 1S7MA 1KRLA 4NBFA 3G6E1 1VQ7Z 1Y8CA 2V8JA 2YU9I 1YHQ1 1VQL1 1JJ2Z 3I4NI 5FLXb 5FLXf 2VUGA 4HGYA 1M1K2 3BG1B 1Q822 1X3ZA 3CCE1 3CD61 2GTIA 1VQLZ 1YITZ 1W2BY 1Q811 3HOVI 1WCMI 4NBDA 2ZAEB 3CMA1 1Z02A 2B63I 3G4SZ 2I3CA 2V45A 3KIFA 4A3II 3VB9A 2PK7A 2JR6A 3CCL1 3GTOI 3F3FC 1VQMZ 5AN9F 1M901 4A3JI 1Q862 1QF8A 2H85A 3CCJ1 3CCQZ 2DE5A 1VQK1 1PFTA 1ZB8A 4BBSI 2JA8I 2JIOA 1RO4A 1VQ6Z 2JNYA 1WW9A 3D9XA 3MZLB 1SIWA 1S721 3CPWY 1RO0A 1FDOA 5T6BA 3EERA 2BJOA 2YADA 4X6AI 2P3YA 4NB9A 1YJNZ 1VQM1 3T4NB 3IF8A 1RQFA 4RV9A 3VMIA 1KQSY 4MXUA 1Y1VS 1Z03A 3HOYI 1VQ9Z 1JJ2Y 4QTUA 2JUBA 2OTJ1 3GTGI 4RVHA 1KQSZ 2IZ4A 3G4S1 2R7ZI 2WB1A 1YJ9Z 3D2LA 3NDJA 4EWCA 4XX2A 3CPWZ 3PO3I 2RT9A 2QKDA 5D1OB 2OOYB 1K731 1Z01A 1K8A2 5D1PA 3CCUZ 1W2BZ 1TWHI 2P28A 4NBCA 3S1NI 2JIRA 4BXXI 1VQNZ 2QREB 3S2DI 4NBEA 4QTTA 3QWUA 1X3WA 2JMOA 2O4HA 4HGZA 1NJI2 3G71Z 1YHQZ 3PO3S 1WIIA 1YJW1 4MD8A 3GTJI 3H0GI 2QRDB 3CMAZ 3NH8A 3CCR1 4DGLA 4BY7I 3HOXI 3PO2I 5LL6f 3CCS1 1R9TI
chains in the Genus database with same CATH topology
4A3EI 4RVDA 3CC41 2RPRA 2QR1B 1Y1VI 3IX0A 2KI7B 3VTNA 3CCEZ 2E2HI 2F4OA 2K3RA 4NBAA 2QEX1 2LIYA 4MD9A 2Y0SA 3CCVZ 3OW2Y 5FLMI 3OW2Z 1VQ5Z 4E31A 2LFUA 4MONA 3NFZA 3CC21 4MH4A 3GTLI 2OZKA 5C44I 2V8IA 4NBGA 1VQP1 2JA6I 2QLVB 2O53A 4TNUA 1TWGI 3CME1 4RS4A 2Q4ZA 3GCFA 4CL1A 1VQ51 2PM9A 3I07A 4NBHA 1K9M2 1ZH1A 2QEXZ 3U50C 3CCMZ 2GTHA 4MD7A 4E2ZA 3TE5B 2G2KA 4DQYB 2E9HA 1KD12 4NOZA 4E32A 3CCSZ 3VMHA 1VQ61 3HOWI 2AKLA 1KD11 1QVGY 3FQQA 2KPIA 1QVFY 3CC4Z 4RVFA 1VQOZ 4NFRA 1QVFZ 3S16I 1YI2Z 2OTLZ 2R92I 1RLYA 4E2WA 1NP6A 3D6WA 2NVYI 2RHBA 1K732 3I4MI 1K9M1 5IT9f 5IT9b 1USPA 1ML8A 3P5JB 5T67A 1VLAA 2F4MA 3M4OI 3KIHA 1TWCI 3S1QI 1QYPA 1Q861 4MRIA 2DE7A 2OTL1 1LQLA 4A3DI 3S1MI 2DE6A 2J6AA 3GKQA 4E2YA 1VQO1 3CCU1 1VQN1 1RNIA 3CQZI 2QRCB 1YIT1 2RIQA 3I55Z 5D1OA 3GTMS 3K7AI 4NB8A 3EEDA 3S1RI 1NJI1 2WAQA 2PMZA 3I56Z 5A2Qb 5A2Qf 3J81b 3J81f 4A3FI 4E33A 4S1TA 4HH4A 3CCV1 2E2JI 3H3VJ 2OOXB 2M6NA 4NH1C 4A93I 2JA5I 1M1K1 3CXCY 5C3EI 1K8A1 2Q51A 3GTKI 3I561 1X0TA 4DK1A 3LUSA 4Y7NI 1VQPZ 5IP7I 3I551 1YUKA 3CC2Z 1TWFI 2NVXI 2HF1A 5T64A 3CC71 1S72Z 3GTMI 2R6MA 4Y52I 4BBRI 3GTQI 3CC7Z 3CCJZ 3CCQ1 2W04A 1SFOI 3M3YI 1VQKZ 3BG0B 3HOUI 2JA7I 3Q87A 3CCLZ 3FQMA 1L1OC 3GTPI 1YIJZ 1P9NA 4A3BI 3CCRZ 3MONA 3RZDI 2IZ3A 1I6HI 1Q7Y2 4A3CI 1YJWZ 3CD6Z 4A3KI 3G711 2GU2A 2NVQI 1DL6A 3J80b 3J80f 1N8R2 3RZOI 1NUIA 3VMGA 2R93I 2V8KA 1KC81 4A3GI 3TDHB 1VQ91 3S17I 3CXCZ 3CMEZ 1KC82 2W03A 2HU9A 1N2FA 3HKZA 1TFIA 1N8R1 4NBBA 4RVGA 5C4XI 1VQ71 1Q812 3JAMb 3JAMf 3G6EZ 2VF1A 1JWHC 2VUMI 2QA4Z 1YIJ1 1YI21 3S15I 3ESWA 1YJ91 4A3MI 1I3QI 1VQ4Z 5IP9I 1M902 3NDIA 2NVTI 1YUAA 2EGTA 4BY1I 1ZB9A 2OTJZ 2K5RA 5CM2M 3S14I 1Y1WI 4E2XA 1VQ81 1YJN1 1USPB 3IFUA 4E30A 3CCM1 3FKII 3NH4A 2M48A 4AYBA 1RO2A 3F3PC 1VQ8Z 2RBLA 2JS4A 1QVGZ 1VQ41 3S2HI 5C4JI 3NH5A 3HOZI 3J7A4 1TWAI 1I50I 3MZKB 2QA41 1Q821 1K83I 1Q7Y1 4A3LI 2E2II 1S7MA 1KRLA 4NBFA 3G6E1 1VQ7Z 2V8JA 2YU9I 1YHQ1 1VQL1 1JJ2Z 3I4NI 5FLXb 5FLXf 2VUGA 4HGYA 1M1K2 3BG1B 1Q822 1X3ZA 3CCE1 3CD61 2GTIA 1VQLZ 1YITZ 1W2BY 1Q811 3HOVI 1WCMI 4NBDA 2ZAEB 3CMA1 1Z02A 2B63I 3G4SZ 2I3CA 3KIFA 4A3II 3VB9A 2PK7A 2JR6A 3CCL1 3GTOI 3F3FC 1VQMZ 5AN9F 1M901 4A3JI 1Q862 1QF8A 2H85A 3CCJ1 3CCQZ 2DE5A 1VQK1 1PFTA 1ZB8A 4BBSI 2JA8I 1RO4A 1VQ6Z 2JNYA 1WW9A 3D9XA 3MZLB 1S721 3CPWY 1RO0A 5T6BA 3EERA 2BJOA 2YADA 4X6AI 2P3YA 4NB9A 1YJNZ 1VQM1 3T4NB 3IF8A 1RQFA 4RV9A 3VMIA 1KQSY 4MXUA 1Y1VS 1Z03A 3HOYI 1VQ9Z 1JJ2Y 4QTUA 2JUBA 2OTJ1 3GTGI 4RVHA 1KQSZ 2IZ4A 3G4S1 2R7ZI 2WB1A 1YJ9Z 3NDJA 4EWCA 4XX2A 3CPWZ 3PO3I 2RT9A 2QKDA 5D1OB 2OOYB 1K731 1Z01A 1K8A2 5D1PA 3CCUZ 1W2BZ 1TWHI 2P28A 4NBCA 3S1NI 4BXXI 1VQNZ 2QREB 3S2DI 4NBEA 4QTTA 3QWUA 1X3WA 2JMOA 2O4HA 4HGZA 1NJI2 3G71Z 1YHQZ 3PO3S 1WIIA 1YJW1 4MD8A 3GTJI 3H0GI 2QRDB 3CMAZ 3NH8A 3CCR1 4DGLA 4BY7I 3HOXI 3PO2I 5LL6f 3CCS1 1R9TI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3E I;  4A3I I;  3VB9 A;  2PK7 A;  2JR6 A;  3S17 I;  3CQZ I;  3GTO I;  1N2F A;  1Y1V I;  1TFI A;  4NBB A;  5C4X I;  3GTM S;  4A3J I;  3K7A I;  4NB8 A;  3S1R I;  2VUM I;  2DE5 A;  3S15 I;  2E2H I;  3ESW A;  2F4O A;  1PFT A;  1ZB8 A;  1I3Q I;  4NBA A;  4A3F I;  4A3M I;  2JA8 I;  5IP9 I;  4BBS I;  2E2J I;  1RO4 A;  3H3V J;  2NVT I;  1YUA A;  2JNY A;  5FLM I;  1WW9 A;  4BY1 I;  4A93 I;  1ZB9 A;  2K5R A;  5CM2 M;  2JA5 I;  3S14 I;  1Y1W I;  3GTL I;  4MH4 A;  5C3E I;  5C44 I;  3GTK I;  1USP B;  3EER A;  4NBG A;  2BJO A;  3FKI I;  3LUS A;  4Y7N I;  4X6A I;  2JA6 I;  5IP7 I;  2B63 I;  2P3Y A;  4NB9 A;  3VMI A;  1TWF I;  2RBL A;  1TWG I;  2NVX I;  1Y1V S;  2HF1 A;  3HOY I;  2JS4 A;  4QTU A;  3GTM I;  3GCF A;  3GTG I;  3S2H I;  4Y52 I;  4BBR I;  3GTQ I;  2R7Z I;  3I07 A;  4NBH A;  5C4J I;  3HOZ I;  1SFO I;  3M3Y I;  3U50 C;  1TWA I;  1I50 I;  4XX2 A;  3PO3 I;  1K83 I;  3HOU I;  2JA7 I;  4A3L I;  2E2I I;  4NBF A;  2YU9 I;  4NOZ A;  3VMH A;  1TWH I;  3HOW I;  2AKL A;  3Q87 A;  2KPI A;  3I4N I;  4NBC A;  3S1N I;  4BXX I;  1L1O C;  3S2D I;  3GTP I;  4NBE A;  4QTT A;  3S16 I;  2R92 I;  1RLY A;  1X3Z A;  1X3W A;  4A3B I;  3D6W A;  2NVY I;  3RZD I;  3I4M I;  3PO3 S;  1I6H I;  1USP A;  1ML8 A;  1VLA A;  4A3C I;  2F4M A;  3HOV I;  3M4O I;  4A3K I;  1WCM I;  1TWC I;  3GTJ I;  3H0G I;  1QYP A;  3S1Q I;  4NBD A;  2NVQ I;  1DL6 A;  2DE7 A;  1LQL A;  4BY7 I;  3HOX I;  3RZO I;  4A3D I;  3S1M I;  2DE6 A;  3PO2 I;  1NUI A;  3VMG A;  2J6A A;  2R93 I;  3GKQ A;  4A3G I;  1R9T I; 
#chains in the Genus database with same CATH topology
 4A3E I;  4RVD A;  3CC4 1;  2RPR A;  2QR1 B;  1Y1V I;  3IX0 A;  2KI7 B;  2VPZ A;  3VTN A;  3CCE Z;  2E2H I;  2F4O A;  2K3R A;  4NBA A;  2QEX 1;  2LIY A;  4MD9 A;  2Y0S A;  3CCV Z;  3OW2 Y;  5FLM I;  3OW2 Z;  1VQ5 Z;  4E31 A;  2LFU A;  4MON A;  3NFZ A;  3CC2 1;  4MH4 A;  3GTL I;  2OZK A;  5C44 I;  2V8I A;  4NBG A;  1VQP 1;  2JA6 I;  2QLV B;  2O53 A;  4TNU A;  1TWG I;  3CME 1;  4RS4 A;  2Q4Z A;  1FDI A;  3GCF A;  4CL1 A;  1VQ5 1;  2PM9 A;  3I07 A;  2VPX A;  4NBH A;  1K9M 2;  1ZH1 A;  2QEX Z;  3U50 C;  1AA6 A;  3CCM Z;  2GTH A;  4MD7 A;  4E2Z A;  3TE5 B;  2G2K A;  4DQY B;  2E9H A;  1KD1 2;  4NOZ A;  4E32 A;  3CCS Z;  3VMH A;  1VQ6 1;  3HOW I;  2AKL A;  1KD1 1;  1QVG Y;  3FQQ A;  2KPI A;  1QVF Y;  3CC4 Z;  4RVF A;  1VQO Z;  4NFR A;  1QVF Z;  3S16 I;  1YI2 Z;  2E7Z A;  2OTL Z;  2R92 I;  1RLY A;  4E2W A;  1NP6 A;  3D6W A;  2NVY I;  2RHB A;  1K73 2;  3I4M I;  1K9M 1;  5IT9 f;  5IT9 b;  1USP A;  1ML8 A;  3P5J B;  5T67 A;  1VLA A;  2F4M A;  3M4O I;  3KIH A;  2JIQ A;  1TWC I;  3S1Q I;  1QYP A;  1Q86 1;  4MRI A;  2DE7 A;  2OTL 1;  1LQL A;  4A3D I;  3S1M I;  2DE6 A;  2J6A A;  3GKQ A;  2NAP A;  4E2Y A;  1VQO 1;  3CCU 1;  1VQN 1;  2AYD A;  1RNI A;  3CQZ I;  2QRC B;  1YIT 1;  2RIQ A;  3I55 Z;  5D1O A;  3GTM S;  3K7A I;  2IV2 X;  4NB8 A;  1WJ2 A;  3EED A;  3S1R I;  1NJI 1;  2WAQ A;  2PMZ A;  3I56 Z;  5A2Q b;  5A2Q f;  3J81 b;  3J81 f;  1QXF A;  4A3F I;  4E33 A;  1WZN A;  4S1T A;  4HH4 A;  3CCV 1;  2E2J I;  3H3V J;  2OOX B;  2M6N A;  4NH1 C;  4A93 I;  2JA5 I;  1Q16 A;  1M1K 1;  3CXC Y;  5C3E I;  1K8A 1;  2Q51 A;  3GTK I;  3I56 1;  1X0T A;  4DK1 A;  3LUS A;  4Y7N I;  1VQP Z;  5IP7 I;  3I55 1;  1YUK A;  3CC2 Z;  1TWF I;  2NVX I;  2HF1 A;  2V3V A;  5T64 A;  3CC7 1;  1S72 Z;  3GTM I;  2R6M A;  4Y52 I;  4BBR I;  3GTQ I;  3CC7 Z;  3CCJ Z;  3CCQ 1;  2W04 A;  1SFO I;  3M3Y I;  1VQK Z;  2JIM A;  3BG0 B;  3HOU I;  2JA7 I;  2VPW A;  2LEX A;  3Q87 A;  3CCL Z;  3FQM A;  1L1O C;  3GTP I;  1YIJ Z;  1P9N A;  4A3B I;  3CCR Z;  3MON A;  3RZD I;  2IZ3 A;  1I6H I;  1Q7Y 2;  2JIP A;  4A3C I;  1YJW Z;  3CD6 Z;  4A3K I;  3G71 1;  2GU2 A;  2NVQ I;  1DL6 A;  3J80 b;  3J80 f;  1N8R 2;  3RZO I;  1NUI A;  3VMG A;  2R93 I;  2V8K A;  1KC8 1;  4A3G I;  3TDH B;  1VQ9 1;  3S17 I;  3CXC Z;  3CME Z;  1KC8 2;  2W03 A;  2HU9 A;  1N2F A;  3HKZ A;  1TFI A;  1N8R 1;  4NBB A;  4RVG A;  5C4X I;  1VQ7 1;  1Q81 2;  3JAM b;  3JAM f;  3G6E Z;  2VF1 A;  1JWH C;  2VUM I;  2QA4 Z;  1YIJ 1;  1YI2 1;  3S15 I;  3ESW A;  1YJ9 1;  4A3M I;  1I3Q I;  1VQ4 Z;  5IP9 I;  1M90 2;  3NDI A;  3IR7 A;  2NVT I;  1YUA A;  2EGT A;  4BY1 I;  1ZB9 A;  2OTJ Z;  2K5R A;  5CM2 M;  3S14 I;  1Y1W I;  2VPY A;  4E2X A;  1VQ8 1;  1YJN 1;  1USP B;  3IFU A;  4E30 A;  3CCM 1;  3FKI I;  3NH4 A;  2M48 A;  4AYB A;  1RO2 A;  3F3P C;  1VQ8 Z;  2RBL A;  2JS4 A;  1QVG Z;  1VQ4 1;  3S2H I;  5C4J I;  3NH5 A;  3HOZ I;  3J7A 4;  1TWA I;  1I50 I;  3MZK B;  2QA4 1;  1Q82 1;  1K83 I;  1Q7Y 1;  4A3L I;  2E2I I;  1S7M A;  1KRL A;  4NBF A;  3G6E 1;  1VQ7 Z;  1Y8C A;  2V8J A;  2YU9 I;  1YHQ 1;  1VQL 1;  1JJ2 Z;  3I4N I;  5FLX b;  5FLX f;  2VUG A;  4HGY A;  1M1K 2;  3BG1 B;  1Q82 2;  1X3Z A;  3CCE 1;  3CD6 1;  2GTI A;  1VQL Z;  1YIT Z;  1W2B Y;  1Q81 1;  3HOV I;  1WCM I;  4NBD A;  2ZAE B;  3CMA 1;  1Z02 A;  2B63 I;  3G4S Z;  2I3C A;  2V45 A;  3KIF A;  4A3I I;  3VB9 A;  2PK7 A;  2JR6 A;  3CCL 1;  3GTO I;  3F3F C;  1VQM Z;  5AN9 F;  1M90 1;  4A3J I;  1Q86 2;  1QF8 A;  2H85 A;  3CCJ 1;  3CCQ Z;  2DE5 A;  1VQK 1;  1PFT A;  1ZB8 A;  4BBS I;  2JA8 I;  2JIO A;  1RO4 A;  1VQ6 Z;  2JNY A;  1WW9 A;  3D9X A;  3MZL B;  1SIW A;  1S72 1;  3CPW Y;  1RO0 A;  1FDO A;  5T6B A;  3EER A;  2BJO A;  2YAD A;  4X6A I;  2P3Y A;  4NB9 A;  1YJN Z;  1VQM 1;  3T4N B;  3IF8 A;  1RQF A;  4RV9 A;  3VMI A;  1KQS Y;  4MXU A;  1Y1V S;  1Z03 A;  3HOY I;  1VQ9 Z;  1JJ2 Y;  4QTU A;  2JUB A;  2OTJ 1;  3GTG I;  4RVH A;  1KQS Z;  2IZ4 A;  3G4S 1;  2R7Z I;  2WB1 A;  1YJ9 Z;  3D2L A;  3NDJ A;  4EWC A;  4XX2 A;  3CPW Z;  3PO3 I;  2RT9 A;  2QKD A;  5D1O B;  2OOY B;  1K73 1;  1Z01 A;  1K8A 2;  5D1P A;  3CCU Z;  1W2B Z;  1TWH I;  2P28 A;  4NBC A;  3S1N I;  2JIR A;  4BXX I;  1VQN Z;  2QRE B;  3S2D I;  4NBE A;  4QTT A;  3QWU A;  1X3W A;  2JMO A;  2O4H A;  4HGZ A;  1NJI 2;  3G71 Z;  1YHQ Z;  3PO3 S;  1WII A;  1YJW 1;  4MD8 A;  3GTJ I;  3H0G I;  2QRD B;  3CMA Z;  3NH8 A;  3CCR 1;  4DGL A;  4BY7 I;  3HOX I;  3PO2 I;  5LL6 f;  3CCS 1;  1R9T I; 
#chains in the Genus database with same CATH homology
 4A3E I;  4RVD A;  3CC4 1;  2RPR A;  2QR1 B;  1Y1V I;  3IX0 A;  2KI7 B;  3VTN A;  3CCE Z;  2E2H I;  2F4O A;  2K3R A;  4NBA A;  2QEX 1;  2LIY A;  4MD9 A;  2Y0S A;  3CCV Z;  3OW2 Y;  5FLM I;  3OW2 Z;  1VQ5 Z;  4E31 A;  2LFU A;  4MON A;  3NFZ A;  3CC2 1;  4MH4 A;  3GTL I;  2OZK A;  5C44 I;  2V8I A;  4NBG A;  1VQP 1;  2JA6 I;  2QLV B;  2O53 A;  4TNU A;  1TWG I;  3CME 1;  4RS4 A;  2Q4Z A;  3GCF A;  4CL1 A;  1VQ5 1;  2PM9 A;  3I07 A;  4NBH A;  1K9M 2;  1ZH1 A;  2QEX Z;  3U50 C;  3CCM Z;  2GTH A;  4MD7 A;  4E2Z A;  3TE5 B;  2G2K A;  4DQY B;  2E9H A;  1KD1 2;  4NOZ A;  4E32 A;  3CCS Z;  3VMH A;  1VQ6 1;  3HOW I;  2AKL A;  1KD1 1;  1QVG Y;  3FQQ A;  2KPI A;  1QVF Y;  3CC4 Z;  4RVF A;  1VQO Z;  4NFR A;  1QVF Z;  3S16 I;  1YI2 Z;  2OTL Z;  2R92 I;  1RLY A;  4E2W A;  1NP6 A;  3D6W A;  2NVY I;  2RHB A;  1K73 2;  3I4M I;  1K9M 1;  5IT9 f;  5IT9 b;  1USP A;  1ML8 A;  3P5J B;  5T67 A;  1VLA A;  2F4M A;  3M4O I;  3KIH A;  1TWC I;  3S1Q I;  1QYP A;  1Q86 1;  4MRI A;  2DE7 A;  2OTL 1;  1LQL A;  4A3D I;  3S1M I;  2DE6 A;  2J6A A;  3GKQ A;  4E2Y A;  1VQO 1;  3CCU 1;  1VQN 1;  1RNI A;  3CQZ I;  2QRC B;  1YIT 1;  2RIQ A;  3I55 Z;  5D1O A;  3GTM S;  3K7A I;  4NB8 A;  3EED A;  3S1R I;  1NJI 1;  2WAQ A;  2PMZ A;  3I56 Z;  5A2Q b;  5A2Q f;  3J81 b;  3J81 f;  4A3F I;  4E33 A;  4S1T A;  4HH4 A;  3CCV 1;  2E2J I;  3H3V J;  2OOX B;  2M6N A;  4NH1 C;  4A93 I;  2JA5 I;  1M1K 1;  3CXC Y;  5C3E I;  1K8A 1;  2Q51 A;  3GTK I;  3I56 1;  1X0T A;  4DK1 A;  3LUS A;  4Y7N I;  1VQP Z;  5IP7 I;  3I55 1;  1YUK A;  3CC2 Z;  1TWF I;  2NVX I;  2HF1 A;  5T64 A;  3CC7 1;  1S72 Z;  3GTM I;  2R6M A;  4Y52 I;  4BBR I;  3GTQ I;  3CC7 Z;  3CCJ Z;  3CCQ 1;  2W04 A;  1SFO I;  3M3Y I;  1VQK Z;  3BG0 B;  3HOU I;  2JA7 I;  3Q87 A;  3CCL Z;  3FQM A;  1L1O C;  3GTP I;  1YIJ Z;  1P9N A;  4A3B I;  3CCR Z;  3MON A;  3RZD I;  2IZ3 A;  1I6H I;  1Q7Y 2;  4A3C I;  1YJW Z;  3CD6 Z;  4A3K I;  3G71 1;  2GU2 A;  2NVQ I;  1DL6 A;  3J80 b;  3J80 f;  1N8R 2;  3RZO I;  1NUI A;  3VMG A;  2R93 I;  2V8K A;  1KC8 1;  4A3G I;  3TDH B;  1VQ9 1;  3S17 I;  3CXC Z;  3CME Z;  1KC8 2;  2W03 A;  2HU9 A;  1N2F A;  3HKZ A;  1TFI A;  1N8R 1;  4NBB A;  4RVG A;  5C4X I;  1VQ7 1;  1Q81 2;  3JAM b;  3JAM f;  3G6E Z;  2VF1 A;  1JWH C;  2VUM I;  2QA4 Z;  1YIJ 1;  1YI2 1;  3S15 I;  3ESW A;  1YJ9 1;  4A3M I;  1I3Q I;  1VQ4 Z;  5IP9 I;  1M90 2;  3NDI A;  2NVT I;  1YUA A;  2EGT A;  4BY1 I;  1ZB9 A;  2OTJ Z;  2K5R A;  5CM2 M;  3S14 I;  1Y1W I;  4E2X A;  1VQ8 1;  1YJN 1;  1USP B;  3IFU A;  4E30 A;  3CCM 1;  3FKI I;  3NH4 A;  2M48 A;  4AYB A;  1RO2 A;  3F3P C;  1VQ8 Z;  2RBL A;  2JS4 A;  1QVG Z;  1VQ4 1;  3S2H I;  5C4J I;  3NH5 A;  3HOZ I;  3J7A 4;  1TWA I;  1I50 I;  3MZK B;  2QA4 1;  1Q82 1;  1K83 I;  1Q7Y 1;  4A3L I;  2E2I I;  1S7M A;  1KRL A;  4NBF A;  3G6E 1;  1VQ7 Z;  2V8J A;  2YU9 I;  1YHQ 1;  1VQL 1;  1JJ2 Z;  3I4N I;  5FLX b;  5FLX f;  2VUG A;  4HGY A;  1M1K 2;  3BG1 B;  1Q82 2;  1X3Z A;  3CCE 1;  3CD6 1;  2GTI A;  1VQL Z;  1YIT Z;  1W2B Y;  1Q81 1;  3HOV I;  1WCM I;  4NBD A;  2ZAE B;  3CMA 1;  1Z02 A;  2B63 I;  3G4S Z;  2I3C A;  3KIF A;  4A3I I;  3VB9 A;  2PK7 A;  2JR6 A;  3CCL 1;  3GTO I;  3F3F C;  1VQM Z;  5AN9 F;  1M90 1;  4A3J I;  1Q86 2;  1QF8 A;  2H85 A;  3CCJ 1;  3CCQ Z;  2DE5 A;  1VQK 1;  1PFT A;  1ZB8 A;  4BBS I;  2JA8 I;  1RO4 A;  1VQ6 Z;  2JNY A;  1WW9 A;  3D9X A;  3MZL B;  1S72 1;  3CPW Y;  1RO0 A;  5T6B A;  3EER A;  2BJO A;  2YAD A;  4X6A I;  2P3Y A;  4NB9 A;  1YJN Z;  1VQM 1;  3T4N B;  3IF8 A;  1RQF A;  4RV9 A;  3VMI A;  1KQS Y;  4MXU A;  1Y1V S;  1Z03 A;  3HOY I;  1VQ9 Z;  1JJ2 Y;  4QTU A;  2JUB A;  2OTJ 1;  3GTG I;  4RVH A;  1KQS Z;  2IZ4 A;  3G4S 1;  2R7Z I;  2WB1 A;  1YJ9 Z;  3NDJ A;  4EWC A;  4XX2 A;  3CPW Z;  3PO3 I;  2RT9 A;  2QKD A;  5D1O B;  2OOY B;  1K73 1;  1Z01 A;  1K8A 2;  5D1P A;  3CCU Z;  1W2B Z;  1TWH I;  2P28 A;  4NBC A;  3S1N I;  4BXX I;  1VQN Z;  2QRE B;  3S2D I;  4NBE A;  4QTT A;  3QWU A;  1X3W A;  2JMO A;  2O4H A;  4HGZ A;  1NJI 2;  3G71 Z;  1YHQ Z;  3PO3 S;  1WII A;  1YJW 1;  4MD8 A;  3GTJ I;  3H0G I;  2QRD B;  3CMA Z;  3NH8 A;  3CCR 1;  4DGL A;  4BY7 I;  3HOX I;  3PO2 I;  5LL6 f;  3CCS 1;  1R9T I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...