1K83I

Crystal structure of yeast rna polymerase ii complexed with the inhibitor alpha amanitin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
122
structure length
122
Chain Sequence
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Transcription: Alpha-Amanitin-RNA Polymerase II Cocrystal at 2.8 A Resolution.
pubmed doi rcsb
molecule tags Transcription/toxin
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
total genus 12
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2001-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1k83I02
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1k83I01
3VMGA 4NBCA 2E2II 1TWCI 3CQZI 1DL6A 1RLYA 4NB8A 3HOXI 3GTQI 1RO4A 1SFOI 3GTGI 3M3YI 3S2HI 4Y7NI 1R9TI 2R93I 4A3JI 3EERA 2BJOA 1LQLA 5FLMI 1QYPA 4BY1I 1WCMI 4A3LI 4NBFA 4A3BI 1L1OC 1I3QI 3S14I 3H0GI 4MH4A 2JA8I 1X3WA 3RZDI 2NVTI 1K83I 3U50C 4NBBA 1PFTA 3LUSA 4BBSI 1I50I 4NBDA 2RBLA 5C4JI 3GTMI 5IP7I 2AKLA 3S17I 1WW9A 3VB9A 4NB9A 3VMIA 4BXXI 3I07A 5IP9I 3K7AI 4A3EI 4A3II 4Y52I 4A3CI 3RZOI 3HOVI 4A3KI 3S2DI 5C3EI 2F4MA 1TWAI 4A3DI 3GTKI 2R7ZI 4A93I 1NUIA 3GKQA 1Y1WI 2E2HI 2DE5A 2K5RA 1N2FA 3H3VJ 3GTJI 5C4XI 4NBGA 1VLAA 2NVXI 4X6AI 2DE6A 1YUAA 2HF1A 3GCFA 2DE7A 4NBHA 2P3YA 3PO3I 1X3ZA 3ESWA 4XX2A 4A3FI 3HOWI 3I4NI 3FKII 1Y1VI 2JA6I 3HOZI 2R92I 3GTOI 4A3GI 3PO2I 2YU9I 3I4MI 1ZB9A 4BY7I 3S1RI 3S16I 2VUMI 1I6HI 1Y1VS 1TWGI 5CM2M 4BBRI 4NBAA 1USPA 3GTMS 1USPB 3VMHA 2B63I 2NVYI 3S1NI 1TWFI 2JR6A 3Q87A 3PO3S 2J6AA 4A3MI 4QTTA 2JA7I 2NVQI 4NOZA 3HOYI 3D6WA 3M4OI 5C44I 2KPIA 2JS4A 1TWHI 3S15I 2E2JI 2F4OA 3S1MI 1ZB8A 2PK7A 2JA5I 3HOUI 3GTPI 3S1QI 1ML8A 4QTUA 1TFIA 3GTLI 4NBEA 2JNYA
chains in the Genus database with same CATH superfamily
3VMGA 2E2II 1TWCI 4NB8A 3QWUA 3CCJ1 3GTQI 2M48A 5FLXf 1RO4A 2VPZA 3S2HI 3JAMf 4Y7NI 2QEXZ 1Q16A 2BJOA 1LQLA 5FLMI 4BY1I 1RO0A 4TNUA 1L1OC 2ZAEB 3H0GI 4MH4A 1FDOA 3CD61 4EWCA 1K83I 1KD11 4E2XA 2R6MA 1PFTA 4HGYA 1I50I 1SIWA 4NBDA 1VQP1 2RBLA 2K3RA 1QVGY 3VB9A 1JJ2Z 2VPXA 1YIJZ 1YJ91 4A3EI 4A3II 3RZOI 3G6E1 1W2BZ 3HOVI 5C3EI 1YI2Z 2OTL1 1Z01A 2JMOA 1TWAI 1YHQ1 2R7ZI 2NAPA 1N8R1 2GTIA 1Y1WI 2DE5A 2K5RA 4NBGA 4E31A 2IV2X 3CCMZ 4X6AI 2DE6A 4E30A 4MD7A 2P3YA 1Z02A 3CME1 1Q811 2AYDA 1K8A2 1P9NA 3FKII 2JA6I 4BY7I 1TWGI 2O53A 1N8R2 1USPA 1QXFA 3GTMS 1NP6A 2O4HA 3S1NI 2JIPA 3PO3S 3CXCY 3CPWZ 3HOYI 1TWHI 1RO2A 1YJNZ 1K8A1 1ML8A 1TFIA 5IT9f 3CMA1 3GTLI 2JNYA 2V45A 3TDHB 3CQZI 1YIJ1 1KQSZ 1NJI2 1VQ4Z 3M3YI 2RIQA 1R9TI 4A3JI 3CC7Z 3CPWY 1QYPA 2Q4ZA 3P5JB 5T67A 2VPWA 4NBFA 1M901 2OOXB 2JA8I 3CMEZ 2GU2A 1YUKA 3NH5A 4RVFA 2V8IA 3G4SZ 4HGZA 1KC81 1VQM1 3F3PC 1KQSY 3T4NB 3BG1B 4MD9A 3K7AI 1QVFY 3CCJZ 2QREB 2OTJZ 2F4MA 4A3DI 3GTKI 4S1TA 1S721 3NH8A 3KIFA 3NDJA 1N2FA 1YIT1 3CCSZ 2G2KA 5LL6f 3GTJI 5C4XI 3NFZA 3CC41 1VLAA 2NVXI 2HF1A 2YADA 5IT9b 3ESWA 1K9M2 1VQ81 4E32A 2VF1A 3TE5B 3CCR1 3OW2Y 2QRDB 2KI7B 3S16I 2WB1A 1Q7Y2 2QA4Z 2JIMA 2Q51A 2B63I 2PM9A 2JR6A 3EEDA 3CCL1 3IFUA 4NOZA 3FQQA 2M6NA 3D6WA 2WAQA 3CC2Z 1WJ2A 3G71Z 3KIHA 2E2JI 2F4OA 3S1MI 4RV9A 3HOUI 2W03A 2QEX1 4QTUA 1K731 3J80b 4MD8A 3CCS1 3G711 3FQMA 4NBCA 1DL6A 2QR1B 1RLYA 1Q822 1VQ9Z 1SFOI 3CXCZ 5A2Qb 2R93I 3EERA 5A2Qf 1VQ61 1Q812 2V8JA 2LEXA 3CCUZ 2QLVB 5D1OB 1VQ6Z 2HU9A 3S14I 2V8KA 3F3FC 3J81b 3I56Z 3CCE1 2EGTA 2NVTI 1FDIA 4NBBA 1VQ8Z 1VQOZ 1WIIA 3LUSA 4BBSI 3I55Z 4RS4A 4DQYB 1Q821 3CC4Z 3S17I 1WW9A 3OW2Z 4NB9A 3I07A 1VQK1 4Y52I 4A3CI 4DGLA 1NJI1 4A3KI 3HKZA 1YHQZ 3S2DI 3IX0A 1VQ41 1NUIA 2QRCB 3GKQA 2E2HI 1VQLZ 1VQ5Z 1VQKZ 2W04A 1QF8A 1KD12 2H85A 2VUGA 1VQO1 1WZNA 2PMZA 3GCFA 2DE7A 1M902 3J80f 1VQN1 1X3ZA 4XX2A 4A3FI 1Q862 2IZ3A 3HOWI 3I4NI 3G4S1 1VQ7Z 3J7A4 2YU9I 1ZB9A 2IZ4A 3S1RI 4MONA 1I6HI 3CCU1 4BBRI 4NBAA 2OZKA 1VQ71 2P28A 1USPB 2JUBA 2NVYI 3Q87A 4A3MI 3JAMb 3I561 3MONA 2QKDA 4RVDA 1YJ9Z 5AN9F 2KPIA 2JS4A 2RT9A 4AYBA 2PK7A 2OOYB 1YITZ 1K732 3CC21 1VQ51 3GTPI 3S1QI 3BG0B 3CCLZ 4NBEA 2RPRA 1X0TA 5T6BA 3HOXI 3CD6Z 2JIRA 3GTGI 3NDIA 1YI21 1QVGZ 1JJ2Y 3IF8A 4E33A 4MRIA 4E2WA 3D2LA 3CCVZ 2VPYA 1Q7Y1 1WCMI 4A3LI 4A3BI 4RVGA 1I3QI 1VQPZ 1X3WA 3RZDI 3CCRZ 1VQNZ 1JWHC 3IR7A 3U50C 3D9XA 4DK1A 3CCV1 1M1K2 5C4JI 3GTMI 2E9HA 5IP7I 3CCM1 3MZKB 1K9M1 1ZH1A 2AKLA 2OTJ1 1Y8CA 1YJN1 3VMIA 4BXXI 3VTNA 5IP9I 2LIYA 1YJW1 2I3CA 1M1K1 3J81f 1AA6A 3G6EZ 1VQMZ 4A93I 2RHBA 4E2ZA 4HH4A 3I551 5D1PA 3H3VJ 2E7ZA 1VQL1 1QVFZ 1YUAA 3CCQ1 3CCEZ 1KC82 4NBHA 2LFUA 3PO3I 1Z03A 2GTHA 2QA41 1S7MA 1Y1VI 3HOZI 4NH1C 2R92I 3GTOI 4A3GI 3PO2I 3I4MI 3CCQZ 1RNIA 2VUMI 2Y0SA 1Y1VS 1W2BY 3MZLB 5CM2M 1VQ91 3CC71 4E2YA 1KRLA 3VMHA 2JIOA 5FLXb 1TWFI 2J6AA 2OTLZ 4QTTA 2JA7I 2NVQI 2JIQA 1YJWZ 1RQFA 3M4OI 5C44I 4RVHA 3S15I 5D1OA 1ZB8A 3CMAZ 4MXUA 2JA5I 2V3VA 5T64A 1S72Z 4CL1A 1Q861 3NH4A 4NFRA
chains in the Genus database with same CATH topology
3VMGA 2E2II 1TWCI 4NB8A 3QWUA 3CCJ1 3GTQI 2M48A 5FLXf 1RO4A 3S2HI 3JAMf 4Y7NI 2QEXZ 2BJOA 1LQLA 5FLMI 4BY1I 1RO0A 4TNUA 1L1OC 2ZAEB 3H0GI 4MH4A 3CD61 4EWCA 1K83I 1KD11 4E2XA 2R6MA 1PFTA 4HGYA 1I50I 4NBDA 1VQP1 2RBLA 2K3RA 1QVGY 3VB9A 1JJ2Z 1YIJZ 1YJ91 4A3EI 4A3II 3RZOI 3G6E1 1W2BZ 3HOVI 5C3EI 1YI2Z 2OTL1 1Z01A 2JMOA 1TWAI 1YHQ1 2R7ZI 1N8R1 2GTIA 1Y1WI 2DE5A 2K5RA 4NBGA 4E31A 3CCMZ 4X6AI 2DE6A 4E30A 4MD7A 2P3YA 1Z02A 3CME1 1Q811 1K8A2 1P9NA 3FKII 2JA6I 4BY7I 1TWGI 2O53A 1N8R2 1USPA 3GTMS 1NP6A 2O4HA 3S1NI 3PO3S 3CXCY 3CPWZ 3HOYI 1TWHI 1RO2A 1YJNZ 1K8A1 1ML8A 1TFIA 5IT9f 3CMA1 3GTLI 2JNYA 3TDHB 3CQZI 1YIJ1 1KQSZ 1NJI2 1VQ4Z 3M3YI 2RIQA 1R9TI 4A3JI 3CC7Z 3CPWY 1QYPA 2Q4ZA 3P5JB 5T67A 4NBFA 1M901 2OOXB 2JA8I 3CMEZ 2GU2A 1YUKA 3NH5A 4RVFA 2V8IA 3G4SZ 4HGZA 1KC81 1VQM1 3F3PC 1KQSY 3T4NB 3BG1B 4MD9A 3K7AI 1QVFY 3CCJZ 2QREB 2OTJZ 2F4MA 4A3DI 3GTKI 4S1TA 1S721 3NH8A 3KIFA 3NDJA 1N2FA 1YIT1 3CCSZ 2G2KA 5LL6f 3GTJI 5C4XI 3NFZA 3CC41 1VLAA 2NVXI 2HF1A 2YADA 5IT9b 3ESWA 1K9M2 1VQ81 4E32A 2VF1A 3TE5B 3CCR1 3OW2Y 2QRDB 2KI7B 3S16I 2WB1A 1Q7Y2 2QA4Z 2Q51A 2B63I 2PM9A 2JR6A 3EEDA 3CCL1 3IFUA 4NOZA 3FQQA 2M6NA 3D6WA 2WAQA 3CC2Z 3G71Z 3KIHA 2E2JI 2F4OA 3S1MI 4RV9A 3HOUI 2W03A 2QEX1 4QTUA 1K731 3J80b 4MD8A 3CCS1 3G711 3FQMA 4NBCA 1DL6A 2QR1B 1RLYA 1Q822 1VQ9Z 1SFOI 3CXCZ 5A2Qb 2R93I 3EERA 5A2Qf 1VQ61 1Q812 2V8JA 3CCUZ 2QLVB 5D1OB 1VQ6Z 2HU9A 3S14I 2V8KA 3F3FC 3J81b 3I56Z 3CCE1 2EGTA 2NVTI 4NBBA 1VQ8Z 1VQOZ 1WIIA 3LUSA 4BBSI 3I55Z 4RS4A 4DQYB 1Q821 3CC4Z 3S17I 1WW9A 3OW2Z 4NB9A 3I07A 1VQK1 4Y52I 4A3CI 4DGLA 1NJI1 4A3KI 3HKZA 1YHQZ 3S2DI 3IX0A 1VQ41 1NUIA 2QRCB 3GKQA 2E2HI 1VQLZ 1VQ5Z 1VQKZ 2W04A 1QF8A 1KD12 2H85A 2VUGA 1VQO1 2PMZA 3GCFA 2DE7A 1M902 3J80f 1VQN1 1X3ZA 4XX2A 4A3FI 1Q862 2IZ3A 3HOWI 3I4NI 3G4S1 1VQ7Z 3J7A4 2YU9I 1ZB9A 2IZ4A 3S1RI 4MONA 1I6HI 3CCU1 4BBRI 4NBAA 2OZKA 1VQ71 2P28A 1USPB 2JUBA 2NVYI 3Q87A 4A3MI 3JAMb 3I561 3MONA 2QKDA 4RVDA 1YJ9Z 5AN9F 2KPIA 2JS4A 2RT9A 4AYBA 2PK7A 2OOYB 1YITZ 1K732 3CC21 1VQ51 3GTPI 3S1QI 3BG0B 3CCLZ 4NBEA 2RPRA 1X0TA 5T6BA 3HOXI 3CD6Z 3GTGI 3NDIA 1YI21 1QVGZ 1JJ2Y 3IF8A 4E33A 4MRIA 4E2WA 3CCVZ 1Q7Y1 1WCMI 4A3LI 4A3BI 4RVGA 1I3QI 1VQPZ 1X3WA 3RZDI 3CCRZ 1VQNZ 1JWHC 3U50C 3D9XA 4DK1A 3CCV1 1M1K2 5C4JI 3GTMI 2E9HA 5IP7I 3CCM1 3MZKB 1K9M1 1ZH1A 2AKLA 2OTJ1 1YJN1 3VMIA 4BXXI 3VTNA 5IP9I 2LIYA 1YJW1 2I3CA 1M1K1 3J81f 3G6EZ 1VQMZ 4A93I 2RHBA 4E2ZA 4HH4A 3I551 5D1PA 3H3VJ 1VQL1 1QVFZ 1YUAA 3CCQ1 3CCEZ 1KC82 4NBHA 2LFUA 3PO3I 1Z03A 2GTHA 2QA41 1S7MA 1Y1VI 3HOZI 4NH1C 2R92I 3GTOI 4A3GI 3PO2I 3I4MI 3CCQZ 1RNIA 2VUMI 2Y0SA 1Y1VS 1W2BY 3MZLB 5CM2M 1VQ91 3CC71 4E2YA 1KRLA 3VMHA 5FLXb 1TWFI 2J6AA 2OTLZ 4QTTA 2JA7I 2NVQI 1YJWZ 1RQFA 3M4OI 5C44I 4RVHA 3S15I 5D1OA 1ZB8A 3CMAZ 4MXUA 2JA5I 5T64A 1S72Z 4CL1A 1Q861 3NH4A 4NFRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VMG A;  4NBC A;  2E2I I;  1TWC I;  3CQZ I;  1DL6 A;  1RLY A;  4NB8 A;  3HOX I;  3GTQ I;  1RO4 A;  1SFO I;  3GTG I;  3M3Y I;  3S2H I;  4Y7N I;  1R9T I;  2R93 I;  4A3J I;  3EER A;  2BJO A;  1LQL A;  5FLM I;  1QYP A;  4BY1 I;  1WCM I;  4A3L I;  4NBF A;  4A3B I;  1L1O C;  1I3Q I;  3S14 I;  3H0G I;  4MH4 A;  2JA8 I;  1X3W A;  3RZD I;  2NVT I;  1K83 I;  3U50 C;  4NBB A;  1PFT A;  3LUS A;  4BBS I;  1I50 I;  4NBD A;  2RBL A;  5C4J I;  3GTM I;  5IP7 I;  2AKL A;  3S17 I;  1WW9 A;  3VB9 A;  4NB9 A;  3VMI A;  4BXX I;  3I07 A;  5IP9 I;  3K7A I;  4A3E I;  4A3I I;  4Y52 I;  4A3C I;  3RZO I;  3HOV I;  4A3K I;  3S2D I;  5C3E I;  2F4M A;  1TWA I;  4A3D I;  3GTK I;  2R7Z I;  4A93 I;  1NUI A;  3GKQ A;  1Y1W I;  2E2H I;  2DE5 A;  2K5R A;  1N2F A;  3H3V J;  3GTJ I;  5C4X I;  4NBG A;  1VLA A;  2NVX I;  4X6A I;  2DE6 A;  1YUA A;  2HF1 A;  3GCF A;  2DE7 A;  4NBH A;  2P3Y A;  3PO3 I;  1X3Z A;  3ESW A;  4XX2 A;  4A3F I;  3HOW I;  3I4N I;  3FKI I;  1Y1V I;  2JA6 I;  3HOZ I;  2R92 I;  3GTO I;  4A3G I;  3PO2 I;  2YU9 I;  3I4M I;  1ZB9 A;  4BY7 I;  3S1R I;  3S16 I;  2VUM I;  1I6H I;  1Y1V S;  1TWG I;  5CM2 M;  4BBR I;  4NBA A;  1USP A;  3GTM S;  1USP B;  3VMH A;  2B63 I;  2NVY I;  3S1N I;  1TWF I;  2JR6 A;  3Q87 A;  3PO3 S;  2J6A A;  4A3M I;  4QTT A;  2JA7 I;  2NVQ I;  4NOZ A;  3HOY I;  3D6W A;  3M4O I;  5C44 I;  2KPI A;  2JS4 A;  1TWH I;  3S15 I;  2E2J I;  2F4O A;  3S1M I;  1ZB8 A;  2PK7 A;  2JA5 I;  3HOU I;  3GTP I;  3S1Q I;  1ML8 A;  4QTU A;  1TFI A;  3GTL I;  4NBE A;  2JNY A; 
#chains in the Genus database with same CATH topology
 3VMG A;  2E2I I;  1TWC I;  4NB8 A;  3QWU A;  3CCJ 1;  3GTQ I;  2M48 A;  5FLX f;  1RO4 A;  2VPZ A;  3S2H I;  3JAM f;  4Y7N I;  2QEX Z;  1Q16 A;  2BJO A;  1LQL A;  5FLM I;  4BY1 I;  1RO0 A;  4TNU A;  1L1O C;  2ZAE B;  3H0G I;  4MH4 A;  1FDO A;  3CD6 1;  4EWC A;  1K83 I;  1KD1 1;  4E2X A;  2R6M A;  1PFT A;  4HGY A;  1I50 I;  1SIW A;  4NBD A;  1VQP 1;  2RBL A;  2K3R A;  1QVG Y;  3VB9 A;  1JJ2 Z;  2VPX A;  1YIJ Z;  1YJ9 1;  4A3E I;  4A3I I;  3RZO I;  3G6E 1;  1W2B Z;  3HOV I;  5C3E I;  1YI2 Z;  2OTL 1;  1Z01 A;  2JMO A;  1TWA I;  1YHQ 1;  2R7Z I;  2NAP A;  1N8R 1;  2GTI A;  1Y1W I;  2DE5 A;  2K5R A;  4NBG A;  4E31 A;  2IV2 X;  3CCM Z;  4X6A I;  2DE6 A;  4E30 A;  4MD7 A;  2P3Y A;  1Z02 A;  3CME 1;  1Q81 1;  2AYD A;  1K8A 2;  1P9N A;  3FKI I;  2JA6 I;  4BY7 I;  1TWG I;  2O53 A;  1N8R 2;  1USP A;  1QXF A;  3GTM S;  1NP6 A;  2O4H A;  3S1N I;  2JIP A;  3PO3 S;  3CXC Y;  3CPW Z;  3HOY I;  1TWH I;  1RO2 A;  1YJN Z;  1K8A 1;  1ML8 A;  1TFI A;  5IT9 f;  3CMA 1;  3GTL I;  2JNY A;  2V45 A;  3TDH B;  3CQZ I;  1YIJ 1;  1KQS Z;  1NJI 2;  1VQ4 Z;  3M3Y I;  2RIQ A;  1R9T I;  4A3J I;  3CC7 Z;  3CPW Y;  1QYP A;  2Q4Z A;  3P5J B;  5T67 A;  2VPW A;  4NBF A;  1M90 1;  2OOX B;  2JA8 I;  3CME Z;  2GU2 A;  1YUK A;  3NH5 A;  4RVF A;  2V8I A;  3G4S Z;  4HGZ A;  1KC8 1;  1VQM 1;  3F3P C;  1KQS Y;  3T4N B;  3BG1 B;  4MD9 A;  3K7A I;  1QVF Y;  3CCJ Z;  2QRE B;  2OTJ Z;  2F4M A;  4A3D I;  3GTK I;  4S1T A;  1S72 1;  3NH8 A;  3KIF A;  3NDJ A;  1N2F A;  1YIT 1;  3CCS Z;  2G2K A;  5LL6 f;  3GTJ I;  5C4X I;  3NFZ A;  3CC4 1;  1VLA A;  2NVX I;  2HF1 A;  2YAD A;  5IT9 b;  3ESW A;  1K9M 2;  1VQ8 1;  4E32 A;  2VF1 A;  3TE5 B;  3CCR 1;  3OW2 Y;  2QRD B;  2KI7 B;  3S16 I;  2WB1 A;  1Q7Y 2;  2QA4 Z;  2JIM A;  2Q51 A;  2B63 I;  2PM9 A;  2JR6 A;  3EED A;  3CCL 1;  3IFU A;  4NOZ A;  3FQQ A;  2M6N A;  3D6W A;  2WAQ A;  3CC2 Z;  1WJ2 A;  3G71 Z;  3KIH A;  2E2J I;  2F4O A;  3S1M I;  4RV9 A;  3HOU I;  2W03 A;  2QEX 1;  4QTU A;  1K73 1;  3J80 b;  4MD8 A;  3CCS 1;  3G71 1;  3FQM A;  4NBC A;  1DL6 A;  2QR1 B;  1RLY A;  1Q82 2;  1VQ9 Z;  1SFO I;  3CXC Z;  5A2Q b;  2R93 I;  3EER A;  5A2Q f;  1VQ6 1;  1Q81 2;  2V8J A;  2LEX A;  3CCU Z;  2QLV B;  5D1O B;  1VQ6 Z;  2HU9 A;  3S14 I;  2V8K A;  3F3F C;  3J81 b;  3I56 Z;  3CCE 1;  2EGT A;  2NVT I;  1FDI A;  4NBB A;  1VQ8 Z;  1VQO Z;  1WII A;  3LUS A;  4BBS I;  3I55 Z;  4RS4 A;  4DQY B;  1Q82 1;  3CC4 Z;  3S17 I;  1WW9 A;  3OW2 Z;  4NB9 A;  3I07 A;  1VQK 1;  4Y52 I;  4A3C I;  4DGL A;  1NJI 1;  4A3K I;  3HKZ A;  1YHQ Z;  3S2D I;  3IX0 A;  1VQ4 1;  1NUI A;  2QRC B;  3GKQ A;  2E2H I;  1VQL Z;  1VQ5 Z;  1VQK Z;  2W04 A;  1QF8 A;  1KD1 2;  2H85 A;  2VUG A;  1VQO 1;  1WZN A;  2PMZ A;  3GCF A;  2DE7 A;  1M90 2;  3J80 f;  1VQN 1;  1X3Z A;  4XX2 A;  4A3F I;  1Q86 2;  2IZ3 A;  3HOW I;  3I4N I;  3G4S 1;  1VQ7 Z;  3J7A 4;  2YU9 I;  1ZB9 A;  2IZ4 A;  3S1R I;  4MON A;  1I6H I;  3CCU 1;  4BBR I;  4NBA A;  2OZK A;  1VQ7 1;  2P28 A;  1USP B;  2JUB A;  2NVY I;  3Q87 A;  4A3M I;  3JAM b;  3I56 1;  3MON A;  2QKD A;  4RVD A;  1YJ9 Z;  5AN9 F;  2KPI A;  2JS4 A;  2RT9 A;  4AYB A;  2PK7 A;  2OOY B;  1YIT Z;  1K73 2;  3CC2 1;  1VQ5 1;  3GTP I;  3S1Q I;  3BG0 B;  3CCL Z;  4NBE A;  2RPR A;  1X0T A;  5T6B A;  3HOX I;  3CD6 Z;  2JIR A;  3GTG I;  3NDI A;  1YI2 1;  1QVG Z;  1JJ2 Y;  3IF8 A;  4E33 A;  4MRI A;  4E2W A;  3D2L A;  3CCV Z;  2VPY A;  1Q7Y 1;  1WCM I;  4A3L I;  4A3B I;  4RVG A;  1I3Q I;  1VQP Z;  1X3W A;  3RZD I;  3CCR Z;  1VQN Z;  1JWH C;  3IR7 A;  3U50 C;  3D9X A;  4DK1 A;  3CCV 1;  1M1K 2;  5C4J I;  3GTM I;  2E9H A;  5IP7 I;  3CCM 1;  3MZK B;  1K9M 1;  1ZH1 A;  2AKL A;  2OTJ 1;  1Y8C A;  1YJN 1;  3VMI A;  4BXX I;  3VTN A;  5IP9 I;  2LIY A;  1YJW 1;  2I3C A;  1M1K 1;  3J81 f;  1AA6 A;  3G6E Z;  1VQM Z;  4A93 I;  2RHB A;  4E2Z A;  4HH4 A;  3I55 1;  5D1P A;  3H3V J;  2E7Z A;  1VQL 1;  1QVF Z;  1YUA A;  3CCQ 1;  3CCE Z;  1KC8 2;  4NBH A;  2LFU A;  3PO3 I;  1Z03 A;  2GTH A;  2QA4 1;  1S7M A;  1Y1V I;  3HOZ I;  4NH1 C;  2R92 I;  3GTO I;  4A3G I;  3PO2 I;  3I4M I;  3CCQ Z;  1RNI A;  2VUM I;  2Y0S A;  1Y1V S;  1W2B Y;  3MZL B;  5CM2 M;  1VQ9 1;  3CC7 1;  4E2Y A;  1KRL A;  3VMH A;  2JIO A;  5FLX b;  1TWF I;  2J6A A;  2OTL Z;  4QTT A;  2JA7 I;  2NVQ I;  2JIQ A;  1YJW Z;  1RQF A;  3M4O I;  5C44 I;  4RVH A;  3S15 I;  5D1O A;  1ZB8 A;  3CMA Z;  4MXU A;  2JA5 I;  2V3V A;  5T64 A;  1S72 Z;  4CL1 A;  1Q86 1;  3NH4 A;  4NFR A; 
#chains in the Genus database with same CATH homology
 3VMG A;  2E2I I;  1TWC I;  4NB8 A;  3QWU A;  3CCJ 1;  3GTQ I;  2M48 A;  5FLX f;  1RO4 A;  3S2H I;  3JAM f;  4Y7N I;  2QEX Z;  2BJO A;  1LQL A;  5FLM I;  4BY1 I;  1RO0 A;  4TNU A;  1L1O C;  2ZAE B;  3H0G I;  4MH4 A;  3CD6 1;  4EWC A;  1K83 I;  1KD1 1;  4E2X A;  2R6M A;  1PFT A;  4HGY A;  1I50 I;  4NBD A;  1VQP 1;  2RBL A;  2K3R A;  1QVG Y;  3VB9 A;  1JJ2 Z;  1YIJ Z;  1YJ9 1;  4A3E I;  4A3I I;  3RZO I;  3G6E 1;  1W2B Z;  3HOV I;  5C3E I;  1YI2 Z;  2OTL 1;  1Z01 A;  2JMO A;  1TWA I;  1YHQ 1;  2R7Z I;  1N8R 1;  2GTI A;  1Y1W I;  2DE5 A;  2K5R A;  4NBG A;  4E31 A;  3CCM Z;  4X6A I;  2DE6 A;  4E30 A;  4MD7 A;  2P3Y A;  1Z02 A;  3CME 1;  1Q81 1;  1K8A 2;  1P9N A;  3FKI I;  2JA6 I;  4BY7 I;  1TWG I;  2O53 A;  1N8R 2;  1USP A;  3GTM S;  1NP6 A;  2O4H A;  3S1N I;  3PO3 S;  3CXC Y;  3CPW Z;  3HOY I;  1TWH I;  1RO2 A;  1YJN Z;  1K8A 1;  1ML8 A;  1TFI A;  5IT9 f;  3CMA 1;  3GTL I;  2JNY A;  3TDH B;  3CQZ I;  1YIJ 1;  1KQS Z;  1NJI 2;  1VQ4 Z;  3M3Y I;  2RIQ A;  1R9T I;  4A3J I;  3CC7 Z;  3CPW Y;  1QYP A;  2Q4Z A;  3P5J B;  5T67 A;  4NBF A;  1M90 1;  2OOX B;  2JA8 I;  3CME Z;  2GU2 A;  1YUK A;  3NH5 A;  4RVF A;  2V8I A;  3G4S Z;  4HGZ A;  1KC8 1;  1VQM 1;  3F3P C;  1KQS Y;  3T4N B;  3BG1 B;  4MD9 A;  3K7A I;  1QVF Y;  3CCJ Z;  2QRE B;  2OTJ Z;  2F4M A;  4A3D I;  3GTK I;  4S1T A;  1S72 1;  3NH8 A;  3KIF A;  3NDJ A;  1N2F A;  1YIT 1;  3CCS Z;  2G2K A;  5LL6 f;  3GTJ I;  5C4X I;  3NFZ A;  3CC4 1;  1VLA A;  2NVX I;  2HF1 A;  2YAD A;  5IT9 b;  3ESW A;  1K9M 2;  1VQ8 1;  4E32 A;  2VF1 A;  3TE5 B;  3CCR 1;  3OW2 Y;  2QRD B;  2KI7 B;  3S16 I;  2WB1 A;  1Q7Y 2;  2QA4 Z;  2Q51 A;  2B63 I;  2PM9 A;  2JR6 A;  3EED A;  3CCL 1;  3IFU A;  4NOZ A;  3FQQ A;  2M6N A;  3D6W A;  2WAQ A;  3CC2 Z;  3G71 Z;  3KIH A;  2E2J I;  2F4O A;  3S1M I;  4RV9 A;  3HOU I;  2W03 A;  2QEX 1;  4QTU A;  1K73 1;  3J80 b;  4MD8 A;  3CCS 1;  3G71 1;  3FQM A;  4NBC A;  1DL6 A;  2QR1 B;  1RLY A;  1Q82 2;  1VQ9 Z;  1SFO I;  3CXC Z;  5A2Q b;  2R93 I;  3EER A;  5A2Q f;  1VQ6 1;  1Q81 2;  2V8J A;  3CCU Z;  2QLV B;  5D1O B;  1VQ6 Z;  2HU9 A;  3S14 I;  2V8K A;  3F3F C;  3J81 b;  3I56 Z;  3CCE 1;  2EGT A;  2NVT I;  4NBB A;  1VQ8 Z;  1VQO Z;  1WII A;  3LUS A;  4BBS I;  3I55 Z;  4RS4 A;  4DQY B;  1Q82 1;  3CC4 Z;  3S17 I;  1WW9 A;  3OW2 Z;  4NB9 A;  3I07 A;  1VQK 1;  4Y52 I;  4A3C I;  4DGL A;  1NJI 1;  4A3K I;  3HKZ A;  1YHQ Z;  3S2D I;  3IX0 A;  1VQ4 1;  1NUI A;  2QRC B;  3GKQ A;  2E2H I;  1VQL Z;  1VQ5 Z;  1VQK Z;  2W04 A;  1QF8 A;  1KD1 2;  2H85 A;  2VUG A;  1VQO 1;  2PMZ A;  3GCF A;  2DE7 A;  1M90 2;  3J80 f;  1VQN 1;  1X3Z A;  4XX2 A;  4A3F I;  1Q86 2;  2IZ3 A;  3HOW I;  3I4N I;  3G4S 1;  1VQ7 Z;  3J7A 4;  2YU9 I;  1ZB9 A;  2IZ4 A;  3S1R I;  4MON A;  1I6H I;  3CCU 1;  4BBR I;  4NBA A;  2OZK A;  1VQ7 1;  2P28 A;  1USP B;  2JUB A;  2NVY I;  3Q87 A;  4A3M I;  3JAM b;  3I56 1;  3MON A;  2QKD A;  4RVD A;  1YJ9 Z;  5AN9 F;  2KPI A;  2JS4 A;  2RT9 A;  4AYB A;  2PK7 A;  2OOY B;  1YIT Z;  1K73 2;  3CC2 1;  1VQ5 1;  3GTP I;  3S1Q I;  3BG0 B;  3CCL Z;  4NBE A;  2RPR A;  1X0T A;  5T6B A;  3HOX I;  3CD6 Z;  3GTG I;  3NDI A;  1YI2 1;  1QVG Z;  1JJ2 Y;  3IF8 A;  4E33 A;  4MRI A;  4E2W A;  3CCV Z;  1Q7Y 1;  1WCM I;  4A3L I;  4A3B I;  4RVG A;  1I3Q I;  1VQP Z;  1X3W A;  3RZD I;  3CCR Z;  1VQN Z;  1JWH C;  3U50 C;  3D9X A;  4DK1 A;  3CCV 1;  1M1K 2;  5C4J I;  3GTM I;  2E9H A;  5IP7 I;  3CCM 1;  3MZK B;  1K9M 1;  1ZH1 A;  2AKL A;  2OTJ 1;  1YJN 1;  3VMI A;  4BXX I;  3VTN A;  5IP9 I;  2LIY A;  1YJW 1;  2I3C A;  1M1K 1;  3J81 f;  3G6E Z;  1VQM Z;  4A93 I;  2RHB A;  4E2Z A;  4HH4 A;  3I55 1;  5D1P A;  3H3V J;  1VQL 1;  1QVF Z;  1YUA A;  3CCQ 1;  3CCE Z;  1KC8 2;  4NBH A;  2LFU A;  3PO3 I;  1Z03 A;  2GTH A;  2QA4 1;  1S7M A;  1Y1V I;  3HOZ I;  4NH1 C;  2R92 I;  3GTO I;  4A3G I;  3PO2 I;  3I4M I;  3CCQ Z;  1RNI A;  2VUM I;  2Y0S A;  1Y1V S;  1W2B Y;  3MZL B;  5CM2 M;  1VQ9 1;  3CC7 1;  4E2Y A;  1KRL A;  3VMH A;  5FLX b;  1TWF I;  2J6A A;  2OTL Z;  4QTT A;  2JA7 I;  2NVQ I;  1YJW Z;  1RQF A;  3M4O I;  5C44 I;  4RVH A;  3S15 I;  5D1O A;  1ZB8 A;  3CMA Z;  4MXU A;  2JA5 I;  5T64 A;  1S72 Z;  4CL1 A;  1Q86 1;  3NH4 A;  4NFR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...