4A3JI

Rna polymerase ii initial transcribing complex with a 2nt dna-rna hybrid and soaked with gmpcpp
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural Basis of Initial RNA Polymerase II Transcription.
pubmed doi rcsb
total genus 16
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3jI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3jI02
3S1MI 1TWHI 5C3EI 1Y1VI 2NVYI 1PFTA 2JA5I 5FLMI 3HOYI 5IP9I 1R9TI 2K5RA 2YU9I 4NBEA 2R7ZI 2AKLA 4Y7NI 2NVQI 3HOVI 1YUAA 3S2HI 4BBSI 2P3YA 3GTLI 5IP7I 2JA6I 4NBHA 1I3QI 3GTOI 4A3EI 4XX2A 3VMGA 3GTKI 3D6WA 1Y1VS 1WW9A 4NOZA 3GTMS 4A3KI 3RZOI 1N2FA 3S1NI 2PK7A 5C4JI 3I4MI 4BY1I 1SFOI 3H3VJ 2NVTI 4X6AI 3FKII 3GTMI 2HF1A 1WCMI 4NBCA 3S1QI 4A3CI 1QYPA 4NBBA 2JS4A 1DL6A 4Y52I 4QTTA 3GKQA 3S15I 1RO4A 1USPA 3M4OI 3PO3S 2DE5A 5C4XI 2F4OA 2F4MA 3U50C 2JNYA 4A3LI 3PO2I 4A3MI 3PO3I 3HOZI 2JA7I 1I6HI 2E2HI 2BJOA 4MH4A 1VLAA 4A3JI 1LQLA 1Y1WI 3GTQI 1X3WA 1TWCI 3CQZI 3VB9A 2NVXI 4A3DI 3S16I 1I50I 1TWFI 1X3ZA 2J6AA 1ML8A 4NB8A 3GTJI 4NB9A 2DE6A 3GTPI 3LUSA 3RZDI 5CM2M 3EERA 2E2JI 3K7AI 1TFIA 3GCFA 4A3FI 4BBRI 3GTGI 2KPIA 4A93I 2JR6A 3I07A 5C44I 4NBFA 1USPB 4QTUA 2VUMI 4NBAA 3Q87A 1L1OC 1TWGI 3M3YI 1NUIA 2RBLA 3H0GI 4NBGA 3HOWI 4BXXI 1K83I 3S1RI 3S17I 4NBDA 2E2II 2B63I 2R93I 3I4NI 3ESWA 4BY7I 3S2DI 3HOUI 3VMHA 1ZB9A 3HOXI 4A3BI 1ZB8A 2DE7A 4A3GI 2R92I 3S14I 4A3II 2JA8I 1RLYA 3VMIA 1TWAI
chains in the Genus database with same CATH superfamily
1TWHI 1Y1VI 3FQMA 5FLMI 5IP9I 1AA6A 1KC82 2R7ZI 1YHQ1 2V45A 3I561 1VQK1 2KI7B 3KIFA 5D1OB 3GTLI 5IP7I 3GTOI 1X0TA 2JMOA 1VQ41 1YJWZ 1M1K2 1QVFY 1VQ6Z 1WW9A 3GTMS 1Q862 3CC7Z 1FDOA 2W04A 1RO0A 4RVFA 4E33A 1WCMI 4NBCA 4A3CI 2G2KA 2E7ZA 5FLXb 4E2ZA 1K8A1 2ZAEB 1S7MA 4DGLA 3S15I 1Z02A 3G711 1Z01A 3PO3S 2DE5A 2F4OA 2F4MA 4A3LI 3IFUA 3HOZI 1Z03A 1I6HI 1VLAA 4A3JI 1NJI1 3VB9A 3BG0B 3S16I 1TWFI 2P28A 1ML8A 1YJ9Z 3IR7A 2PMZA 2VPYA 3G4S1 5T6BA 1RQFA 1FDIA 3CCUZ 2QRCB 4A93I 1NP6A 2QRDB 4QTUA 1VQ81 1L1OC 4E2WA 3H0GI 1Q822 1K83I 1YJNZ 3S17I 2RIQA 2IZ3A 2H85A 2E2II 2R93I 2K3RA 3ESWA 2VF1A 1N8R1 4A3BI 2JIOA 5T64A 2R92I 2QEXZ 3CCM1 3CCLZ 2I3CA 4MD7A 4A3II 2JA8I 2PM9A 4TNUA 1YIT1 3VMIA 3S1MI 4RVHA 2RPRA 1RO2A 3HOYI 3CMEZ 2K5RA 4Y7NI 3NDJA 3D9XA 2OOYB 2GU2A 4BBSI 3CC4Z 1VQ5Z 4NBHA 1I3QI 4E31A 3VTNA 1YI2Z 3GTKI 3G6EZ 1VQ7Z 3CCSZ 2AYDA 3RZOI 1N2FA 5C4JI 1K732 2QEX1 2NAPA 3NDIA 3CMA1 1SFOI 3H3VJ 4X6AI 3EEDA 1KRLA 2HF1A 3CXCZ 4NBBA 2JS4A 3CME1 3NH5A 2W03A 1Q7Y1 1KQSZ 3GKQA 3CCVZ 1USPA 1NJI2 3J7A4 2YADA 2JIQA 2VPZA 1VQ51 3CCR1 2VPXA 1JJ2Z 3CCEZ 5D1OA 1YI21 1WIIA 3G6E1 1WZNA 4MH4A 3OW2Z 2GTIA 3J80b 1LQLA 3GTQI 1VQO1 3CXCY 3CQZI 1JWHC 2NVXI 1VQM1 1I50I 4NB8A 1KQSY 2J6AA 3IF8A 2DE6A 3P5JB 3GTPI 4E2YA 1VQLZ 3JAMb 5CM2M 3CCV1 1K9M1 1JJ2Y 3EERA 2E2JI 3K7AI 4A3FI 3GCFA 1VQNZ 4BBRI 1N8R2 3GTGI 1YJW1 3I07A 3HKZA 2VUMI 5T67A 4NBAA 1VQ61 3OW2Y 1TWGI 4BXXI 3S1RI 3CCJZ 3CC71 4NBDA 2GTHA 1QXFA 3J80f 1S72Z 1YUKA 2EGTA 3HOUI 1Q16A 2LFUA 1KC81 1WJ2A 2JIMA 2QR1B 4HGZA 3S14I 1VQL1 4NH1C 3JAMf 2QLVB 1TWAI 5C3EI 1M901 2NVYI 2JA5I 1R9TI 2YU9I 4NBEA 1M1K1 2AKLA 2IZ4A 2NVQI 1YUAA 3S2HI 1Q861 2P3YA 2R6MA 2HU9A 1VQPZ 4XX2A 1YJ91 3CD6Z 2JIPA 1Q811 1Y1VS 4NOZA 1Q7Y2 5IT9f 3S1NI 2PK7A 3J81b 3I4MI 4BY1I 3CCU1 2QA4Z 2NVTI 3FKII 2LEXA 3S1QI 1QYPA 1DL6A 3F3FC 1YJN1 4Y52I 4QTTA 4MRIA 2RHBA 3M4OI 5C4XI 3NFZA 2V8IA 3QWUA 2JNYA 4A3MI 1K8A2 2OTLZ 2Q4ZA 2WAQA 1YHQZ 2JA7I 3IX0A 2BJOA 3CCL1 4MONA 3J81f 2V3VA 3TE5B 1Y1WI 1K9M2 1TWCI 2M48A 5A2Qf 2QA41 1X3ZA 4RS4A 5AN9F 3NH4A 3RZDI 5LL6f 4E32A 3CC41 1W2BZ 3CPWZ 2JR6A 1USPB 1RNIA 1VQ71 2RBLA 3CC2Z 2OTL1 3CCS1 3F3PC 3G71Z 4BY7I 1SIWA 1M902 1ZB9A 1ZB8A 2DE7A 3MZLB 4E30A 1W2BY 3CPWY 3FQQA 4S1TA 2M6NA 1YIJZ 1PFTA 3CCE1 2OTJZ 2V8JA 1Q812 3CC21 3G4SZ 3HOVI 2RT9A 1KD11 2O4HA 2Y0SA 1K731 2JA6I 2QREB 4CL1A 4A3EI 3VMGA 1VQ8Z 5IT9b 3D6WA 4RVGA 4MXUA 3NH8A 4A3KI 4NFRA 4RVDA 3TDHB 3CCQZ 4E2XA 1VQN1 3GTMI 3BG1B 3KIHA 1YIJ1 2OTJ1 3CCJ1 5FLXf 3CCMZ 1RO4A 4DK1A 1S721 1ZH1A 1YITZ 3U50C 3PO2I 1QVGZ 2OZKA 3PO3I 1QF8A 3T4NB 3I55Z 2E2HI 3D2LA 3CCQ1 5A2Qb 1X3WA 1P9NA 2JUBA 4AYBA 4HGYA 2WB1A 4A3DI 1VQ9Z 2V8KA 3GTJI 2IV2X 4NB9A 2OOXB 3LUSA 1QVGY 4DQYB 3CMAZ 1TFIA 2E9HA 1VQP1 2KPIA 2Q51A 4MD9A 4EWCA 5C44I 4NBFA 4RV9A 3CD61 4HH4A 2VPWA 3Q87A 3M3YI 1NUIA 4NBGA 3I56Z 1VQKZ 3HOWI 3MONA 1Y8CA 2O53A 2B63I 3I551 3I4NI 3MZKB 3S2DI 1VQ4Z 2VUGA 2JIRA 3CCRZ 1VQ91 5D1PA 3VMHA 3HOXI 4A3GI 1Q821 4MD8A 2QKDA 1QVFZ 1KD12 1RLYA 1VQOZ 2LIYA 1VQMZ
chains in the Genus database with same CATH topology
1TWHI 1Y1VI 3FQMA 5FLMI 5IP9I 1KC82 2R7ZI 1YHQ1 1VQK1 3I561 2KI7B 3KIFA 5D1OB 3GTLI 5IP7I 3GTOI 1X0TA 2JMOA 1VQ41 1YJWZ 1M1K2 1QVFY 1VQ6Z 1WW9A 3GTMS 1Q862 3CC7Z 2W04A 1RO0A 4RVFA 4E33A 1WCMI 4NBCA 4A3CI 2G2KA 5FLXb 4E2ZA 1K8A1 2ZAEB 1S7MA 4DGLA 3S15I 1Z02A 3G711 1Z01A 3PO3S 2DE5A 2F4OA 2F4MA 4A3LI 3IFUA 3HOZI 1Z03A 1I6HI 1VLAA 4A3JI 1NJI1 3VB9A 3BG0B 3S16I 1TWFI 2P28A 1ML8A 1YJ9Z 2PMZA 3G4S1 5T6BA 1RQFA 3CCUZ 2QRCB 4A93I 1NP6A 2QRDB 4QTUA 1VQ81 1L1OC 4E2WA 3H0GI 1Q822 1K83I 1YJNZ 3S17I 2RIQA 2IZ3A 2H85A 2E2II 2R93I 2K3RA 3ESWA 2VF1A 1N8R1 4A3BI 5T64A 2R92I 2QEXZ 3CCM1 3CCLZ 2I3CA 4MD7A 4A3II 2JA8I 2PM9A 4TNUA 1YIT1 3VMIA 3S1MI 4RVHA 2RPRA 1RO2A 3HOYI 3CMEZ 2K5RA 4Y7NI 3NDJA 3D9XA 2OOYB 2GU2A 4BBSI 3CC4Z 1VQ5Z 4NBHA 1I3QI 4E31A 3VTNA 1YI2Z 3GTKI 3G6EZ 1VQ7Z 3CCSZ 3RZOI 1N2FA 5C4JI 1K732 2QEX1 3NDIA 3CMA1 1SFOI 3H3VJ 4X6AI 3EEDA 1KRLA 2HF1A 3CXCZ 4NBBA 2JS4A 3CME1 3NH5A 2W03A 1Q7Y1 1KQSZ 3GKQA 3CCVZ 1USPA 1NJI2 3J7A4 2YADA 1VQ51 3CCR1 1JJ2Z 3CCEZ 5D1OA 1YI21 1WIIA 3G6E1 4MH4A 3OW2Z 2GTIA 3J80b 1LQLA 3GTQI 1VQO1 3CXCY 3CQZI 1JWHC 2NVXI 1VQM1 1I50I 4NB8A 1KQSY 2J6AA 3IF8A 2DE6A 3P5JB 3GTPI 4E2YA 1VQLZ 3JAMb 5CM2M 3CCV1 1K9M1 1JJ2Y 3EERA 2E2JI 3K7AI 4A3FI 3GCFA 1VQNZ 4BBRI 1N8R2 3GTGI 1YJW1 3I07A 3HKZA 2VUMI 5T67A 4NBAA 1VQ61 3OW2Y 1TWGI 4BXXI 3S1RI 3CCJZ 3CC71 4NBDA 2GTHA 3J80f 1S72Z 1YUKA 2EGTA 3HOUI 2LFUA 1KC81 2QR1B 4HGZA 3S14I 1VQL1 4NH1C 3JAMf 2QLVB 1TWAI 5C3EI 1M901 2NVYI 2JA5I 1R9TI 2YU9I 4NBEA 1M1K1 2AKLA 2IZ4A 2NVQI 1YUAA 3S2HI 1Q861 2P3YA 2R6MA 2HU9A 1VQPZ 4XX2A 1YJ91 3CD6Z 1Q811 1Y1VS 4NOZA 1Q7Y2 5IT9f 3S1NI 2PK7A 3J81b 3I4MI 4BY1I 3CCU1 2QA4Z 2NVTI 3FKII 3S1QI 1QYPA 1DL6A 3F3FC 1YJN1 4Y52I 4QTTA 4MRIA 2RHBA 3M4OI 5C4XI 3NFZA 2V8IA 3QWUA 2JNYA 4A3MI 1K8A2 2OTLZ 2Q4ZA 2WAQA 1YHQZ 2JA7I 3IX0A 2BJOA 3CCL1 4MONA 3J81f 3TE5B 1Y1WI 1K9M2 1TWCI 2M48A 5A2Qf 2QA41 1X3ZA 4RS4A 5AN9F 3NH4A 3RZDI 5LL6f 4E32A 3CC41 1W2BZ 3CPWZ 2JR6A 1USPB 1RNIA 1VQ71 2RBLA 3CC2Z 2OTL1 3CCS1 3F3PC 3G71Z 4BY7I 1M902 1ZB9A 1ZB8A 2DE7A 3MZLB 4E30A 1W2BY 3CPWY 3FQQA 4S1TA 2M6NA 1YIJZ 1PFTA 3CCE1 2OTJZ 2V8JA 1Q812 3CC21 3G4SZ 3HOVI 2RT9A 1KD11 2O4HA 2Y0SA 1K731 2JA6I 2QREB 4CL1A 4A3EI 3VMGA 1VQ8Z 5IT9b 3D6WA 4RVGA 4MXUA 3NH8A 4A3KI 4NFRA 4RVDA 3TDHB 3CCQZ 4E2XA 1VQN1 3GTMI 3BG1B 3KIHA 1YIJ1 2OTJ1 3CCJ1 5FLXf 3CCMZ 1RO4A 4DK1A 1S721 1ZH1A 1YITZ 3U50C 3PO2I 1QVGZ 2OZKA 3PO3I 1QF8A 3T4NB 3I55Z 2E2HI 3CCQ1 5A2Qb 1X3WA 1P9NA 2JUBA 4AYBA 4HGYA 2WB1A 4A3DI 1VQ9Z 2V8KA 3GTJI 4NB9A 2OOXB 3LUSA 1QVGY 4DQYB 3CMAZ 1VQP1 1TFIA 2E9HA 2KPIA 2Q51A 4MD9A 4EWCA 5C44I 4NBFA 4RV9A 3CD61 4HH4A 3Q87A 3M3YI 1NUIA 4NBGA 3I56Z 1VQKZ 3HOWI 3MONA 2O53A 2B63I 3I551 3I4NI 3MZKB 3S2DI 1VQ4Z 2VUGA 3CCRZ 1VQ91 5D1PA 3VMHA 3HOXI 4A3GI 1Q821 4MD8A 2QKDA 1QVFZ 1KD12 1RLYA 1VQOZ 2LIYA 1VQMZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1M I;  1TWH I;  5C3E I;  1Y1V I;  2NVY I;  1PFT A;  2JA5 I;  5FLM I;  3HOY I;  5IP9 I;  1R9T I;  2K5R A;  2YU9 I;  4NBE A;  2R7Z I;  2AKL A;  4Y7N I;  2NVQ I;  3HOV I;  1YUA A;  3S2H I;  4BBS I;  2P3Y A;  3GTL I;  5IP7 I;  2JA6 I;  4NBH A;  1I3Q I;  3GTO I;  4A3E I;  4XX2 A;  3VMG A;  3GTK I;  3D6W A;  1Y1V S;  1WW9 A;  4NOZ A;  3GTM S;  4A3K I;  3RZO I;  1N2F A;  3S1N I;  2PK7 A;  5C4J I;  3I4M I;  4BY1 I;  1SFO I;  3H3V J;  2NVT I;  4X6A I;  3FKI I;  3GTM I;  2HF1 A;  1WCM I;  4NBC A;  3S1Q I;  4A3C I;  1QYP A;  4NBB A;  2JS4 A;  1DL6 A;  4Y52 I;  4QTT A;  3GKQ A;  3S15 I;  1RO4 A;  1USP A;  3M4O I;  3PO3 S;  2DE5 A;  5C4X I;  2F4O A;  2F4M A;  3U50 C;  2JNY A;  4A3L I;  3PO2 I;  4A3M I;  3PO3 I;  3HOZ I;  2JA7 I;  1I6H I;  2E2H I;  2BJO A;  4MH4 A;  1VLA A;  4A3J I;  1LQL A;  1Y1W I;  3GTQ I;  1X3W A;  1TWC I;  3CQZ I;  3VB9 A;  2NVX I;  4A3D I;  3S16 I;  1I50 I;  1TWF I;  1X3Z A;  2J6A A;  1ML8 A;  4NB8 A;  3GTJ I;  4NB9 A;  2DE6 A;  3GTP I;  3LUS A;  3RZD I;  5CM2 M;  3EER A;  2E2J I;  3K7A I;  1TFI A;  3GCF A;  4A3F I;  4BBR I;  3GTG I;  2KPI A;  4A93 I;  2JR6 A;  3I07 A;  5C44 I;  4NBF A;  1USP B;  4QTU A;  2VUM I;  4NBA A;  3Q87 A;  1L1O C;  1TWG I;  3M3Y I;  1NUI A;  2RBL A;  3H0G I;  4NBG A;  3HOW I;  4BXX I;  1K83 I;  3S1R I;  3S17 I;  4NBD A;  2E2I I;  2B63 I;  2R93 I;  3I4N I;  3ESW A;  4BY7 I;  3S2D I;  3HOU I;  3VMH A;  1ZB9 A;  3HOX I;  4A3B I;  1ZB8 A;  2DE7 A;  4A3G I;  2R92 I;  3S14 I;  4A3I I;  2JA8 I;  1RLY A;  3VMI A;  1TWA I; 
#chains in the Genus database with same CATH topology
 1TWH I;  1Y1V I;  3FQM A;  5FLM I;  5IP9 I;  1AA6 A;  1KC8 2;  2R7Z I;  1YHQ 1;  2V45 A;  3I56 1;  1VQK 1;  2KI7 B;  3KIF A;  5D1O B;  3GTL I;  5IP7 I;  3GTO I;  1X0T A;  2JMO A;  1VQ4 1;  1YJW Z;  1M1K 2;  1QVF Y;  1VQ6 Z;  1WW9 A;  3GTM S;  1Q86 2;  3CC7 Z;  1FDO A;  2W04 A;  1RO0 A;  4RVF A;  4E33 A;  1WCM I;  4NBC A;  4A3C I;  2G2K A;  2E7Z A;  5FLX b;  4E2Z A;  1K8A 1;  2ZAE B;  1S7M A;  4DGL A;  3S15 I;  1Z02 A;  3G71 1;  1Z01 A;  3PO3 S;  2DE5 A;  2F4O A;  2F4M A;  4A3L I;  3IFU A;  3HOZ I;  1Z03 A;  1I6H I;  1VLA A;  4A3J I;  1NJI 1;  3VB9 A;  3BG0 B;  3S16 I;  1TWF I;  2P28 A;  1ML8 A;  1YJ9 Z;  3IR7 A;  2PMZ A;  2VPY A;  3G4S 1;  5T6B A;  1RQF A;  1FDI A;  3CCU Z;  2QRC B;  4A93 I;  1NP6 A;  2QRD B;  4QTU A;  1VQ8 1;  1L1O C;  4E2W A;  3H0G I;  1Q82 2;  1K83 I;  1YJN Z;  3S17 I;  2RIQ A;  2IZ3 A;  2H85 A;  2E2I I;  2R93 I;  2K3R A;  3ESW A;  2VF1 A;  1N8R 1;  4A3B I;  2JIO A;  5T64 A;  2R92 I;  2QEX Z;  3CCM 1;  3CCL Z;  2I3C A;  4MD7 A;  4A3I I;  2JA8 I;  2PM9 A;  4TNU A;  1YIT 1;  3VMI A;  3S1M I;  4RVH A;  2RPR A;  1RO2 A;  3HOY I;  3CME Z;  2K5R A;  4Y7N I;  3NDJ A;  3D9X A;  2OOY B;  2GU2 A;  4BBS I;  3CC4 Z;  1VQ5 Z;  4NBH A;  1I3Q I;  4E31 A;  3VTN A;  1YI2 Z;  3GTK I;  3G6E Z;  1VQ7 Z;  3CCS Z;  2AYD A;  3RZO I;  1N2F A;  5C4J I;  1K73 2;  2QEX 1;  2NAP A;  3NDI A;  3CMA 1;  1SFO I;  3H3V J;  4X6A I;  3EED A;  1KRL A;  2HF1 A;  3CXC Z;  4NBB A;  2JS4 A;  3CME 1;  3NH5 A;  2W03 A;  1Q7Y 1;  1KQS Z;  3GKQ A;  3CCV Z;  1USP A;  1NJI 2;  3J7A 4;  2YAD A;  2JIQ A;  2VPZ A;  1VQ5 1;  3CCR 1;  2VPX A;  1JJ2 Z;  3CCE Z;  5D1O A;  1YI2 1;  1WII A;  3G6E 1;  1WZN A;  4MH4 A;  3OW2 Z;  2GTI A;  3J80 b;  1LQL A;  3GTQ I;  1VQO 1;  3CXC Y;  3CQZ I;  1JWH C;  2NVX I;  1VQM 1;  1I50 I;  4NB8 A;  1KQS Y;  2J6A A;  3IF8 A;  2DE6 A;  3P5J B;  3GTP I;  4E2Y A;  1VQL Z;  3JAM b;  5CM2 M;  3CCV 1;  1K9M 1;  1JJ2 Y;  3EER A;  2E2J I;  3K7A I;  4A3F I;  3GCF A;  1VQN Z;  4BBR I;  1N8R 2;  3GTG I;  1YJW 1;  3I07 A;  3HKZ A;  2VUM I;  5T67 A;  4NBA A;  1VQ6 1;  3OW2 Y;  1TWG I;  4BXX I;  3S1R I;  3CCJ Z;  3CC7 1;  4NBD A;  2GTH A;  1QXF A;  3J80 f;  1S72 Z;  1YUK A;  2EGT A;  3HOU I;  1Q16 A;  2LFU A;  1KC8 1;  1WJ2 A;  2JIM A;  2QR1 B;  4HGZ A;  3S14 I;  1VQL 1;  4NH1 C;  3JAM f;  2QLV B;  1TWA I;  5C3E I;  1M90 1;  2NVY I;  2JA5 I;  1R9T I;  2YU9 I;  4NBE A;  1M1K 1;  2AKL A;  2IZ4 A;  2NVQ I;  1YUA A;  3S2H I;  1Q86 1;  2P3Y A;  2R6M A;  2HU9 A;  1VQP Z;  4XX2 A;  1YJ9 1;  3CD6 Z;  2JIP A;  1Q81 1;  1Y1V S;  4NOZ A;  1Q7Y 2;  5IT9 f;  3S1N I;  2PK7 A;  3J81 b;  3I4M I;  4BY1 I;  3CCU 1;  2QA4 Z;  2NVT I;  3FKI I;  2LEX A;  3S1Q I;  1QYP A;  1DL6 A;  3F3F C;  1YJN 1;  4Y52 I;  4QTT A;  4MRI A;  2RHB A;  3M4O I;  5C4X I;  3NFZ A;  2V8I A;  3QWU A;  2JNY A;  4A3M I;  1K8A 2;  2OTL Z;  2Q4Z A;  2WAQ A;  1YHQ Z;  2JA7 I;  3IX0 A;  2BJO A;  3CCL 1;  4MON A;  3J81 f;  2V3V A;  3TE5 B;  1Y1W I;  1K9M 2;  1TWC I;  2M48 A;  5A2Q f;  2QA4 1;  1X3Z A;  4RS4 A;  5AN9 F;  3NH4 A;  3RZD I;  5LL6 f;  4E32 A;  3CC4 1;  1W2B Z;  3CPW Z;  2JR6 A;  1USP B;  1RNI A;  1VQ7 1;  2RBL A;  3CC2 Z;  2OTL 1;  3CCS 1;  3F3P C;  3G71 Z;  4BY7 I;  1SIW A;  1M90 2;  1ZB9 A;  1ZB8 A;  2DE7 A;  3MZL B;  4E30 A;  1W2B Y;  3CPW Y;  3FQQ A;  4S1T A;  2M6N A;  1YIJ Z;  1PFT A;  3CCE 1;  2OTJ Z;  2V8J A;  1Q81 2;  3CC2 1;  3G4S Z;  3HOV I;  2RT9 A;  1KD1 1;  2O4H A;  2Y0S A;  1K73 1;  2JA6 I;  2QRE B;  4CL1 A;  4A3E I;  3VMG A;  1VQ8 Z;  5IT9 b;  3D6W A;  4RVG A;  4MXU A;  3NH8 A;  4A3K I;  4NFR A;  4RVD A;  3TDH B;  3CCQ Z;  4E2X A;  1VQN 1;  3GTM I;  3BG1 B;  3KIH A;  1YIJ 1;  2OTJ 1;  3CCJ 1;  5FLX f;  3CCM Z;  1RO4 A;  4DK1 A;  1S72 1;  1ZH1 A;  1YIT Z;  3U50 C;  3PO2 I;  1QVG Z;  2OZK A;  3PO3 I;  1QF8 A;  3T4N B;  3I55 Z;  2E2H I;  3D2L A;  3CCQ 1;  5A2Q b;  1X3W A;  1P9N A;  2JUB A;  4AYB A;  4HGY A;  2WB1 A;  4A3D I;  1VQ9 Z;  2V8K A;  3GTJ I;  2IV2 X;  4NB9 A;  2OOX B;  3LUS A;  1QVG Y;  4DQY B;  3CMA Z;  1TFI A;  2E9H A;  1VQP 1;  2KPI A;  2Q51 A;  4MD9 A;  4EWC A;  5C44 I;  4NBF A;  4RV9 A;  3CD6 1;  4HH4 A;  2VPW A;  3Q87 A;  3M3Y I;  1NUI A;  4NBG A;  3I56 Z;  1VQK Z;  3HOW I;  3MON A;  1Y8C A;  2O53 A;  2B63 I;  3I55 1;  3I4N I;  3MZK B;  3S2D I;  1VQ4 Z;  2VUG A;  2JIR A;  3CCR Z;  1VQ9 1;  5D1P A;  3VMH A;  3HOX I;  4A3G I;  1Q82 1;  4MD8 A;  2QKD A;  1QVF Z;  1KD1 2;  1RLY A;  1VQO Z;  2LIY A;  1VQM Z; 
#chains in the Genus database with same CATH homology
 1TWH I;  1Y1V I;  3FQM A;  5FLM I;  5IP9 I;  1KC8 2;  2R7Z I;  1YHQ 1;  1VQK 1;  3I56 1;  2KI7 B;  3KIF A;  5D1O B;  3GTL I;  5IP7 I;  3GTO I;  1X0T A;  2JMO A;  1VQ4 1;  1YJW Z;  1M1K 2;  1QVF Y;  1VQ6 Z;  1WW9 A;  3GTM S;  1Q86 2;  3CC7 Z;  2W04 A;  1RO0 A;  4RVF A;  4E33 A;  1WCM I;  4NBC A;  4A3C I;  2G2K A;  5FLX b;  4E2Z A;  1K8A 1;  2ZAE B;  1S7M A;  4DGL A;  3S15 I;  1Z02 A;  3G71 1;  1Z01 A;  3PO3 S;  2DE5 A;  2F4O A;  2F4M A;  4A3L I;  3IFU A;  3HOZ I;  1Z03 A;  1I6H I;  1VLA A;  4A3J I;  1NJI 1;  3VB9 A;  3BG0 B;  3S16 I;  1TWF I;  2P28 A;  1ML8 A;  1YJ9 Z;  2PMZ A;  3G4S 1;  5T6B A;  1RQF A;  3CCU Z;  2QRC B;  4A93 I;  1NP6 A;  2QRD B;  4QTU A;  1VQ8 1;  1L1O C;  4E2W A;  3H0G I;  1Q82 2;  1K83 I;  1YJN Z;  3S17 I;  2RIQ A;  2IZ3 A;  2H85 A;  2E2I I;  2R93 I;  2K3R A;  3ESW A;  2VF1 A;  1N8R 1;  4A3B I;  5T64 A;  2R92 I;  2QEX Z;  3CCM 1;  3CCL Z;  2I3C A;  4MD7 A;  4A3I I;  2JA8 I;  2PM9 A;  4TNU A;  1YIT 1;  3VMI A;  3S1M I;  4RVH A;  2RPR A;  1RO2 A;  3HOY I;  3CME Z;  2K5R A;  4Y7N I;  3NDJ A;  3D9X A;  2OOY B;  2GU2 A;  4BBS I;  3CC4 Z;  1VQ5 Z;  4NBH A;  1I3Q I;  4E31 A;  3VTN A;  1YI2 Z;  3GTK I;  3G6E Z;  1VQ7 Z;  3CCS Z;  3RZO I;  1N2F A;  5C4J I;  1K73 2;  2QEX 1;  3NDI A;  3CMA 1;  1SFO I;  3H3V J;  4X6A I;  3EED A;  1KRL A;  2HF1 A;  3CXC Z;  4NBB A;  2JS4 A;  3CME 1;  3NH5 A;  2W03 A;  1Q7Y 1;  1KQS Z;  3GKQ A;  3CCV Z;  1USP A;  1NJI 2;  3J7A 4;  2YAD A;  1VQ5 1;  3CCR 1;  1JJ2 Z;  3CCE Z;  5D1O A;  1YI2 1;  1WII A;  3G6E 1;  4MH4 A;  3OW2 Z;  2GTI A;  3J80 b;  1LQL A;  3GTQ I;  1VQO 1;  3CXC Y;  3CQZ I;  1JWH C;  2NVX I;  1VQM 1;  1I50 I;  4NB8 A;  1KQS Y;  2J6A A;  3IF8 A;  2DE6 A;  3P5J B;  3GTP I;  4E2Y A;  1VQL Z;  3JAM b;  5CM2 M;  3CCV 1;  1K9M 1;  1JJ2 Y;  3EER A;  2E2J I;  3K7A I;  4A3F I;  3GCF A;  1VQN Z;  4BBR I;  1N8R 2;  3GTG I;  1YJW 1;  3I07 A;  3HKZ A;  2VUM I;  5T67 A;  4NBA A;  1VQ6 1;  3OW2 Y;  1TWG I;  4BXX I;  3S1R I;  3CCJ Z;  3CC7 1;  4NBD A;  2GTH A;  3J80 f;  1S72 Z;  1YUK A;  2EGT A;  3HOU I;  2LFU A;  1KC8 1;  2QR1 B;  4HGZ A;  3S14 I;  1VQL 1;  4NH1 C;  3JAM f;  2QLV B;  1TWA I;  5C3E I;  1M90 1;  2NVY I;  2JA5 I;  1R9T I;  2YU9 I;  4NBE A;  1M1K 1;  2AKL A;  2IZ4 A;  2NVQ I;  1YUA A;  3S2H I;  1Q86 1;  2P3Y A;  2R6M A;  2HU9 A;  1VQP Z;  4XX2 A;  1YJ9 1;  3CD6 Z;  1Q81 1;  1Y1V S;  4NOZ A;  1Q7Y 2;  5IT9 f;  3S1N I;  2PK7 A;  3J81 b;  3I4M I;  4BY1 I;  3CCU 1;  2QA4 Z;  2NVT I;  3FKI I;  3S1Q I;  1QYP A;  1DL6 A;  3F3F C;  1YJN 1;  4Y52 I;  4QTT A;  4MRI A;  2RHB A;  3M4O I;  5C4X I;  3NFZ A;  2V8I A;  3QWU A;  2JNY A;  4A3M I;  1K8A 2;  2OTL Z;  2Q4Z A;  2WAQ A;  1YHQ Z;  2JA7 I;  3IX0 A;  2BJO A;  3CCL 1;  4MON A;  3J81 f;  3TE5 B;  1Y1W I;  1K9M 2;  1TWC I;  2M48 A;  5A2Q f;  2QA4 1;  1X3Z A;  4RS4 A;  5AN9 F;  3NH4 A;  3RZD I;  5LL6 f;  4E32 A;  3CC4 1;  1W2B Z;  3CPW Z;  2JR6 A;  1USP B;  1RNI A;  1VQ7 1;  2RBL A;  3CC2 Z;  2OTL 1;  3CCS 1;  3F3P C;  3G71 Z;  4BY7 I;  1M90 2;  1ZB9 A;  1ZB8 A;  2DE7 A;  3MZL B;  4E30 A;  1W2B Y;  3CPW Y;  3FQQ A;  4S1T A;  2M6N A;  1YIJ Z;  1PFT A;  3CCE 1;  2OTJ Z;  2V8J A;  1Q81 2;  3CC2 1;  3G4S Z;  3HOV I;  2RT9 A;  1KD1 1;  2O4H A;  2Y0S A;  1K73 1;  2JA6 I;  2QRE B;  4CL1 A;  4A3E I;  3VMG A;  1VQ8 Z;  5IT9 b;  3D6W A;  4RVG A;  4MXU A;  3NH8 A;  4A3K I;  4NFR A;  4RVD A;  3TDH B;  3CCQ Z;  4E2X A;  1VQN 1;  3GTM I;  3BG1 B;  3KIH A;  1YIJ 1;  2OTJ 1;  3CCJ 1;  5FLX f;  3CCM Z;  1RO4 A;  4DK1 A;  1S72 1;  1ZH1 A;  1YIT Z;  3U50 C;  3PO2 I;  1QVG Z;  2OZK A;  3PO3 I;  1QF8 A;  3T4N B;  3I55 Z;  2E2H I;  3CCQ 1;  5A2Q b;  1X3W A;  1P9N A;  2JUB A;  4AYB A;  4HGY A;  2WB1 A;  4A3D I;  1VQ9 Z;  2V8K A;  3GTJ I;  4NB9 A;  2OOX B;  3LUS A;  1QVG Y;  4DQY B;  3CMA Z;  1VQP 1;  1TFI A;  2E9H A;  2KPI A;  2Q51 A;  4MD9 A;  4EWC A;  5C44 I;  4NBF A;  4RV9 A;  3CD6 1;  4HH4 A;  3Q87 A;  3M3Y I;  1NUI A;  4NBG A;  3I56 Z;  1VQK Z;  3HOW I;  3MON A;  2O53 A;  2B63 I;  3I55 1;  3I4N I;  3MZK B;  3S2D I;  1VQ4 Z;  2VUG A;  3CCR Z;  1VQ9 1;  5D1P A;  3VMH A;  3HOX I;  4A3G I;  1Q82 1;  4MD8 A;  2QKD A;  1QVF Z;  1KD1 2;  1RLY A;  1VQO Z;  2LIY A;  1VQM Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...