4A3JI

Rna polymerase ii initial transcribing complex with a 2nt dna-rna hybrid and soaked with gmpcpp
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural Basis of Initial RNA Polymerase II Transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 16
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3jI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3jI02
3GTLI 4NBEA 1L1OC 2JS4A 3GTPI 4A3FI 3S1MI 1K83I 1QYPA 1Y1VS 5FLMI 3PO2I 3CQZI 2VUMI 4A3KI 3I4NI 3S1RI 3HOUI 2PK7A 2AKLA 4A3GI 3GTJI 3H0GI 3RZDI 2JA5I 1I3QI 2E2HI 1LQLA 4XX2A 4NBAA 4BBRI 2BJOA 4BY1I 1TWGI 4NBFA 3I4MI 4NBCA 2JA8I 3M4OI 3Q87A 5CM2M 4A3LI 5C3EI 4NBHA 2B63I 2NVXI 3FKII 3HOVI 1Y1WI 1TWCI 3GKQA 1TWHI 2YU9I 1DL6A 1WW9A 2R93I 2NVQI 1ZB9A 4BXXI 4QTTA 4NB8A 3M3YI 1X3WA 3S2HI 3H3VJ 1R9TI 2KPIA 3VB9A 3HOYI 2RBLA 1I50I 3GTMI 4Y52I 2DE7A 5IP9I 1ML8A 2DE5A 1YUAA 1PFTA 3GTQI 2JR6A 2DE6A 1USPB 3K7AI 4QTUA 5IP7I 2F4OA 2P3YA 3VMHA 1NUIA 1ZB8A 1TWAI 3I07A 4NBBA 3HOWI 3LUSA 2R7ZI 3GCFA 1SFOI 3S17I 2NVYI 2NVTI 3PO3I 4A93I 2K5RA 4A3CI 1Y1VI 5C4XI 3U50C 2JNYA 4A3JI 5C44I 4Y7NI 4A3EI 4BY7I 3D6WA 3S16I 3S15I 3S1NI 2JA6I 3S2DI 3S14I 2E2JI 2E2II 3GTKI 3VMIA 3PO3S 1WCMI 3ESWA 1X3ZA 1RO4A 3RZOI 1RLYA 4NBGA 3GTMS 4A3DI 4BBSI 1N2FA 4NOZA 2F4MA 2JA7I 4NBDA 3GTGI 4MH4A 4A3BI 5C4JI 3EERA 2J6AA 3HOZI 4A3MI 2HF1A 4A3II 3VMGA 4X6AI 1TWFI 1VLAA 2R92I 3S1QI 1TFIA 1USPA 1I6HI 3HOXI 4NB9A 3GTOI
chains in the Genus database with same CATH superfamily
4NBEA 2RT9A 3BG1B 3GTPI 3G711 1QYPA 1Y1VS 3PO2I 1VQP1 2VPXA 1YHQZ 3CC41 3HOUI 3GTJI 3CC21 1YJNZ 1QVGY 1FDOA 2IZ3A 2JMOA 4BY1I 3CMAZ 4NBFA 2JA8I 4RVHA 5D1OB 2B63I 2IZ4A 1W2BZ 3CCSZ 3GKQA 1QF8A 1K9M1 3CCVZ 3OW2Z 3NH8A 2M48A 1VQ71 3S2HI 2M6NA 1RO0A 3CCJ1 3GTMI 2DE7A 2VPZA 2DE5A 2WAQA 4EWCA 3CD6Z 1USPB 2QREB 1JWHC 3CCQ1 4MXUA 2K3RA 2P3YA 1YITZ 2QA4Z 1NUIA 2VPYA 4NBBA 1VQ9Z 1KRLA 1VQK1 1Z03A 5C4XI 2JIPA 1RQFA 5C44I 4Y7NI 4BY7I 4DK1A 5D1OA 3G71Z 1VQPZ 3GTKI 3PO3S 1Z02A 2OZKA 2EGTA 1Q16A 1RLYA 2V3VA 4NBGA 3CC4Z 3GTMS 2G2KA 4BBSI 2VPWA 4NOZA 2F4MA 2P28A 3CC2Z 3GTGI 1YIJ1 3KIFA 5C4JI 1YJW1 4RVGA 4E31A 1TWFI 3CCUZ 2WB1A 4E30A 1TFIA 1USPA 1Q821 3GTOI 2JS4A 4A3FI 5FLMI 2V8IA 3CQZI 2VUMI 5IT9b 5IT9f 3S1RI 1VQ7Z 2LFUA 1YI21 1K9M2 4A3GI 1VQM1 4DQYB 3CCJZ 1FDIA 1LQLA 4BBRI 2QEX1 2BJOA 1WIIA 3JAMb 3CCQZ 1K8A1 2NAPA 3QWUA 1VQ81 1VQ61 4A3LI 4NBHA 3BG0B 3CC71 3HOVI 3CCRZ 3T4NB 4NH1C 2YU9I 1DL6A 3MZLB 3MONA 5AN9F 2GTHA 2LEXA 3HKZA 1ZB9A 4BXXI 3EEDA 1VQKZ 1VQLZ 4NB8A 3NDJA 1X0TA 5LL6f 5T67A 3I551 3G6EZ 2JIQA 3HOYI 2RBLA 1I50I 1VQN1 4Y52I 1ML8A 2R6MA 3GTQI 2DE6A 5T64A 2QLVB 4QTUA 4E2WA 4HH4A 1YIJZ 2KI7B 3VMHA 1ZB8A 3I07A 1YJ91 3HOWI 1Q7Y2 2GU2A 3LUSA 3CCL1 2NVYI 3CME1 2E9HA 1M902 3PO3I 4A3CI 1SIWA 2JNYA 4A3EI 2OTL1 2Q51A 3D6WA 2JA6I 2E2JI 1Q822 1WCMI 1YUKA 3ESWA 4CL1A 4E2XA 3P5JB 1Q811 1YI2Z 2QR1B 5FLXf 1N2FA 3J80b 3J80f 2JA7I 4MH4A 2OTJ1 3HOZI 4A3MI 2QEXZ 2HF1A 4A3II 3I561 1Y8CA 4AYBA 2YADA 4S1TA 2R92I 1I6HI 3HOXI 1N8R2 1M1K2 4NB9A 3CC7Z 3GTLI 1L1OC 1K8A2 1QXFA 1S721 3S1MI 1K83I 1QVGZ 1RO2A 1Q7Y1 1Q862 2AKLA 4NFRA 3H0GI 1M901 3RZDI 2Q4ZA 1VQNZ 2E2HI 4HGYA 4XX2A 1KQSY 1TWGI 2IV2X 3I4MI 4NBCA 3NDIA 1VQ41 3NFZA 2OOYB 3FKII 1Y1WI 1TWCI 1VQO1 3CCM1 2H85A 1YJ9Z 3IR7A 2W04A 2I3CA 3CCLZ 2NVQI 1VQ51 3CMEZ 2V8JA 1NJI2 4MD9A 3CPWY 3M3YI 3H3VJ 1R9TI 2OTLZ 3G4S1 3VB9A 4RVDA 1N8R1 3FQMA 5IP9I 1M1K1 1YUAA 1PFTA 3K7AI 4RVFA 3CD61 3CCE1 3MZKB 2PMZA 2OTJZ 4DGLA 1YIT1 1Q861 1TWAI 1Q812 2QA41 2R7ZI 2JIOA 1SFOI 3S17I 2NVTI 4A93I 3IX0A 1JJ2Y 2PM9A 2HU9A 3TDHB 3S14I 1S72Z 4RS4A 3VMIA 1KQSZ 4A3DI 4MD8A 1K731 1YJWZ 4NBDA 2LIYA 4A3BI 4MD7A 2JUBA 1NJI1 3VMGA 3D9XA 3CXCY 2RHBA 3CCU1 1VQ4Z 1VQOZ 3CCMZ 2OOXB 3CPWZ 1KD12 4E2ZA 1VQ5Z 4MRIA 4A3KI 5FLXb 3I4NI 2QRDB 1VQMZ 2PK7A 3IFUA 3G4SZ 5D1PA 1KC82 3IF8A 1QVFY 2JIRA 2O4HA 3F3FC 2JA5I 1I3QI 4NBAA 4HGZA 3F3PC 1VQ8Z 2O53A 2VUGA 1VQ6Z 3M4OI 3Q87A 3CCEZ 5CM2M 5C3EI 2NVXI 2V45A 1P9NA 1TWHI 1WZNA 1JJ2Z 1WW9A 3CCR1 2R93I 4E33A 1YHQ1 4QTTA 1ZH1A 1Z01A 4RV9A 3I55Z 1X3WA 1VQL1 2KPIA 1YJN1 2RIQA 1S7MA 3G6E1 2RPRA 3CMA1 4MONA 2JR6A 1AA6A 2W03A 5IP7I 1KD11 2F4OA 1NP6A 2JIMA 3CCS1 2VF1A 4TNUA 5T6BA 3CXCZ 1K732 5A2Qb 5A2Qf 2GTIA 1KC81 2E7ZA 3GCFA 1W2BY 3CCV1 3NH5A 3NH4A 2K5RA 1Y1VI 3J81b 3U50C 3KIHA 3J81f 3D2LA 4E2YA 4A3JI 3S16I 3S15I 3S1NI 3S2DI 3OW2Y 2ZAEB 2E2II 1RNIA 3TE5B 2QKDA 1QVFZ 1X3ZA 1RO4A 1WJ2A 2QRCB 2AYDA 3RZOI 4E32A 3J7A4 2V8KA 2Y0SA 3EERA 2J6AA 3I56Z 1VQ91 4X6AI 3VTNA 1VLAA 3S1QI 3JAMf 3FQQA
chains in the Genus database with same CATH topology
4NBEA 2RT9A 3BG1B 3GTPI 3G711 1QYPA 1Y1VS 3PO2I 1VQP1 1YHQZ 3CC41 3HOUI 3GTJI 3CC21 1YJNZ 1QVGY 2IZ3A 2JMOA 4BY1I 3CMAZ 4NBFA 2JA8I 4RVHA 5D1OB 2B63I 2IZ4A 1W2BZ 3CCSZ 3GKQA 1QF8A 1K9M1 3CCVZ 3OW2Z 3NH8A 2M48A 1VQ71 3S2HI 2M6NA 1RO0A 3CCJ1 3GTMI 2DE7A 2DE5A 2WAQA 4EWCA 3CD6Z 1USPB 2QREB 1JWHC 3CCQ1 4MXUA 2K3RA 2P3YA 1YITZ 2QA4Z 1NUIA 4NBBA 1VQ9Z 1KRLA 1VQK1 1Z03A 5C4XI 1RQFA 5C44I 4Y7NI 4BY7I 4DK1A 5D1OA 3G71Z 1VQPZ 3GTKI 3PO3S 1Z02A 2OZKA 2EGTA 1RLYA 3CC4Z 4NBGA 3GTMS 2G2KA 4BBSI 4NOZA 2F4MA 2P28A 3CC2Z 3GTGI 1YIJ1 3KIFA 5C4JI 1YJW1 4RVGA 4E31A 1TWFI 3CCUZ 2WB1A 4E30A 1TFIA 1USPA 1Q821 3GTOI 2JS4A 4A3FI 5FLMI 2V8IA 3CQZI 2VUMI 5IT9b 5IT9f 3S1RI 1VQ7Z 2LFUA 1YI21 1K9M2 4A3GI 1VQM1 4DQYB 3CCJZ 1LQLA 4BBRI 2QEX1 2BJOA 1WIIA 3JAMb 3CCQZ 1K8A1 3QWUA 1VQ81 1VQ61 4A3LI 4NBHA 3BG0B 3CC71 3HOVI 3CCRZ 3T4NB 4NH1C 2YU9I 1DL6A 3MZLB 3MONA 5AN9F 2GTHA 3HKZA 1ZB9A 4BXXI 3EEDA 1VQKZ 1VQLZ 4NB8A 3NDJA 1X0TA 5LL6f 5T67A 3I551 3G6EZ 3HOYI 2RBLA 1I50I 1VQN1 4Y52I 1ML8A 2R6MA 3GTQI 2DE6A 5T64A 2QLVB 4QTUA 4E2WA 4HH4A 1YIJZ 2KI7B 3VMHA 1ZB8A 3I07A 1YJ91 3HOWI 1Q7Y2 2GU2A 3LUSA 3CCL1 2NVYI 3CME1 2E9HA 1M902 3PO3I 4A3CI 2JNYA 4A3EI 2OTL1 2Q51A 3D6WA 2JA6I 2E2JI 1Q822 1WCMI 1YUKA 3ESWA 4CL1A 4E2XA 3P5JB 1Q811 1YI2Z 2QR1B 5FLXf 1N2FA 3J80b 3J80f 2JA7I 4MH4A 2OTJ1 3HOZI 4A3MI 2QEXZ 2HF1A 4A3II 3I561 4AYBA 2YADA 4S1TA 2R92I 1I6HI 3HOXI 1N8R2 1M1K2 4NB9A 3CC7Z 3GTLI 1L1OC 1K8A2 1S721 3S1MI 1K83I 1QVGZ 1RO2A 1Q7Y1 1Q862 2AKLA 4NFRA 3H0GI 1M901 3RZDI 2Q4ZA 1VQNZ 2E2HI 4HGYA 4XX2A 1KQSY 1TWGI 3I4MI 4NBCA 3NDIA 1VQ41 3NFZA 2OOYB 3FKII 1Y1WI 1TWCI 1VQO1 3CCM1 2H85A 1YJ9Z 2W04A 2I3CA 3CCLZ 2NVQI 1VQ51 3CMEZ 2V8JA 1NJI2 4MD9A 3CPWY 3M3YI 3H3VJ 1R9TI 2OTLZ 3G4S1 3VB9A 4RVDA 1N8R1 3FQMA 5IP9I 1M1K1 1YUAA 1PFTA 3K7AI 4RVFA 3CD61 3CCE1 3MZKB 2PMZA 2OTJZ 4DGLA 1YIT1 1Q861 1TWAI 1Q812 2QA41 2R7ZI 1SFOI 3S17I 2NVTI 4A93I 3IX0A 1JJ2Y 2PM9A 2HU9A 3TDHB 3S14I 1S72Z 4RS4A 3VMIA 1KQSZ 4A3DI 4MD8A 1K731 1YJWZ 4NBDA 2LIYA 4A3BI 4MD7A 2JUBA 1NJI1 3VMGA 3D9XA 3CXCY 2RHBA 3CCU1 1VQ4Z 1VQOZ 3CCMZ 2OOXB 3CPWZ 1KD12 4E2ZA 1VQ5Z 4MRIA 4A3KI 5FLXb 3I4NI 2QRDB 1VQMZ 2PK7A 3IFUA 3G4SZ 5D1PA 1KC82 3IF8A 1QVFY 2O4HA 3F3FC 2JA5I 1I3QI 4NBAA 4HGZA 3F3PC 1VQ8Z 2O53A 2VUGA 1VQ6Z 3M4OI 3Q87A 3CCEZ 5CM2M 5C3EI 2NVXI 1P9NA 1TWHI 1JJ2Z 1WW9A 3CCR1 2R93I 4E33A 1YHQ1 4QTTA 1ZH1A 1Z01A 4RV9A 3I55Z 1X3WA 1VQL1 2KPIA 1YJN1 2RIQA 1S7MA 2RPRA 3G6E1 3CMA1 4MONA 2JR6A 2W03A 5IP7I 1KD11 2F4OA 1NP6A 3CCS1 2VF1A 4TNUA 5T6BA 3CXCZ 1K732 5A2Qb 5A2Qf 2GTIA 1KC81 3GCFA 1W2BY 3CCV1 3NH5A 3NH4A 2K5RA 1Y1VI 3J81b 3U50C 3KIHA 3J81f 4A3JI 4E2YA 3S16I 3S15I 3S1NI 3S2DI 3OW2Y 2ZAEB 2E2II 1RNIA 3TE5B 2QKDA 1QVFZ 1X3ZA 1RO4A 2QRCB 3RZOI 4E32A 3J7A4 2V8KA 2Y0SA 3EERA 2J6AA 3I56Z 1VQ91 4X6AI 3VTNA 1VLAA 3S1QI 3JAMf 3FQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTL I;  4NBE A;  1L1O C;  2JS4 A;  3GTP I;  4A3F I;  3S1M I;  1K83 I;  1QYP A;  1Y1V S;  5FLM I;  3PO2 I;  3CQZ I;  2VUM I;  4A3K I;  3I4N I;  3S1R I;  3HOU I;  2PK7 A;  2AKL A;  4A3G I;  3GTJ I;  3H0G I;  3RZD I;  2JA5 I;  1I3Q I;  2E2H I;  1LQL A;  4XX2 A;  4NBA A;  4BBR I;  2BJO A;  4BY1 I;  1TWG I;  4NBF A;  3I4M I;  4NBC A;  2JA8 I;  3M4O I;  3Q87 A;  5CM2 M;  4A3L I;  5C3E I;  4NBH A;  2B63 I;  2NVX I;  3FKI I;  3HOV I;  1Y1W I;  1TWC I;  3GKQ A;  1TWH I;  2YU9 I;  1DL6 A;  1WW9 A;  2R93 I;  2NVQ I;  1ZB9 A;  4BXX I;  4QTT A;  4NB8 A;  3M3Y I;  1X3W A;  3S2H I;  3H3V J;  1R9T I;  2KPI A;  3VB9 A;  3HOY I;  2RBL A;  1I50 I;  3GTM I;  4Y52 I;  2DE7 A;  5IP9 I;  1ML8 A;  2DE5 A;  1YUA A;  1PFT A;  3GTQ I;  2JR6 A;  2DE6 A;  1USP B;  3K7A I;  4QTU A;  5IP7 I;  2F4O A;  2P3Y A;  3VMH A;  1NUI A;  1ZB8 A;  1TWA I;  3I07 A;  4NBB A;  3HOW I;  3LUS A;  2R7Z I;  3GCF A;  1SFO I;  3S17 I;  2NVY I;  2NVT I;  3PO3 I;  4A93 I;  2K5R A;  4A3C I;  1Y1V I;  5C4X I;  3U50 C;  2JNY A;  4A3J I;  5C44 I;  4Y7N I;  4A3E I;  4BY7 I;  3D6W A;  3S16 I;  3S15 I;  3S1N I;  2JA6 I;  3S2D I;  3S14 I;  2E2J I;  2E2I I;  3GTK I;  3VMI A;  3PO3 S;  1WCM I;  3ESW A;  1X3Z A;  1RO4 A;  3RZO I;  1RLY A;  4NBG A;  3GTM S;  4A3D I;  4BBS I;  1N2F A;  4NOZ A;  2F4M A;  2JA7 I;  4NBD A;  3GTG I;  4MH4 A;  4A3B I;  5C4J I;  3EER A;  2J6A A;  3HOZ I;  4A3M I;  2HF1 A;  4A3I I;  3VMG A;  4X6A I;  1TWF I;  1VLA A;  2R92 I;  3S1Q I;  1TFI A;  1USP A;  1I6H I;  3HOX I;  4NB9 A;  3GTO I; 
#chains in the Genus database with same CATH topology
 4NBE A;  2RT9 A;  3BG1 B;  3GTP I;  3G71 1;  1QYP A;  1Y1V S;  3PO2 I;  1VQP 1;  2VPX A;  1YHQ Z;  3CC4 1;  3HOU I;  3GTJ I;  3CC2 1;  1YJN Z;  1QVG Y;  1FDO A;  2IZ3 A;  2JMO A;  4BY1 I;  3CMA Z;  4NBF A;  2JA8 I;  4RVH A;  5D1O B;  2B63 I;  2IZ4 A;  1W2B Z;  3CCS Z;  3GKQ A;  1QF8 A;  1K9M 1;  3CCV Z;  3OW2 Z;  3NH8 A;  2M48 A;  1VQ7 1;  3S2H I;  2M6N A;  1RO0 A;  3CCJ 1;  3GTM I;  2DE7 A;  2VPZ A;  2DE5 A;  2WAQ A;  4EWC A;  3CD6 Z;  1USP B;  2QRE B;  1JWH C;  3CCQ 1;  4MXU A;  2K3R A;  2P3Y A;  1YIT Z;  2QA4 Z;  1NUI A;  2VPY A;  4NBB A;  1VQ9 Z;  1KRL A;  1VQK 1;  1Z03 A;  5C4X I;  2JIP A;  1RQF A;  5C44 I;  4Y7N I;  4BY7 I;  4DK1 A;  5D1O A;  3G71 Z;  1VQP Z;  3GTK I;  3PO3 S;  1Z02 A;  2OZK A;  2EGT A;  1Q16 A;  1RLY A;  2V3V A;  4NBG A;  3CC4 Z;  3GTM S;  2G2K A;  4BBS I;  2VPW A;  4NOZ A;  2F4M A;  2P28 A;  3CC2 Z;  3GTG I;  1YIJ 1;  3KIF A;  5C4J I;  1YJW 1;  4RVG A;  4E31 A;  1TWF I;  3CCU Z;  2WB1 A;  4E30 A;  1TFI A;  1USP A;  1Q82 1;  3GTO I;  2JS4 A;  4A3F I;  5FLM I;  2V8I A;  3CQZ I;  2VUM I;  5IT9 b;  5IT9 f;  3S1R I;  1VQ7 Z;  2LFU A;  1YI2 1;  1K9M 2;  4A3G I;  1VQM 1;  4DQY B;  3CCJ Z;  1FDI A;  1LQL A;  4BBR I;  2QEX 1;  2BJO A;  1WII A;  3JAM b;  3CCQ Z;  1K8A 1;  2NAP A;  3QWU A;  1VQ8 1;  1VQ6 1;  4A3L I;  4NBH A;  3BG0 B;  3CC7 1;  3HOV I;  3CCR Z;  3T4N B;  4NH1 C;  2YU9 I;  1DL6 A;  3MZL B;  3MON A;  5AN9 F;  2GTH A;  2LEX A;  3HKZ A;  1ZB9 A;  4BXX I;  3EED A;  1VQK Z;  1VQL Z;  4NB8 A;  3NDJ A;  1X0T A;  5LL6 f;  5T67 A;  3I55 1;  3G6E Z;  2JIQ A;  3HOY I;  2RBL A;  1I50 I;  1VQN 1;  4Y52 I;  1ML8 A;  2R6M A;  3GTQ I;  2DE6 A;  5T64 A;  2QLV B;  4QTU A;  4E2W A;  4HH4 A;  1YIJ Z;  2KI7 B;  3VMH A;  1ZB8 A;  3I07 A;  1YJ9 1;  3HOW I;  1Q7Y 2;  2GU2 A;  3LUS A;  3CCL 1;  2NVY I;  3CME 1;  2E9H A;  1M90 2;  3PO3 I;  4A3C I;  1SIW A;  2JNY A;  4A3E I;  2OTL 1;  2Q51 A;  3D6W A;  2JA6 I;  2E2J I;  1Q82 2;  1WCM I;  1YUK A;  3ESW A;  4CL1 A;  4E2X A;  3P5J B;  1Q81 1;  1YI2 Z;  2QR1 B;  5FLX f;  1N2F A;  3J80 b;  3J80 f;  2JA7 I;  4MH4 A;  2OTJ 1;  3HOZ I;  4A3M I;  2QEX Z;  2HF1 A;  4A3I I;  3I56 1;  1Y8C A;  4AYB A;  2YAD A;  4S1T A;  2R92 I;  1I6H I;  3HOX I;  1N8R 2;  1M1K 2;  4NB9 A;  3CC7 Z;  3GTL I;  1L1O C;  1K8A 2;  1QXF A;  1S72 1;  3S1M I;  1K83 I;  1QVG Z;  1RO2 A;  1Q7Y 1;  1Q86 2;  2AKL A;  4NFR A;  3H0G I;  1M90 1;  3RZD I;  2Q4Z A;  1VQN Z;  2E2H I;  4HGY A;  4XX2 A;  1KQS Y;  1TWG I;  2IV2 X;  3I4M I;  4NBC A;  3NDI A;  1VQ4 1;  3NFZ A;  2OOY B;  3FKI I;  1Y1W I;  1TWC I;  1VQO 1;  3CCM 1;  2H85 A;  1YJ9 Z;  3IR7 A;  2W04 A;  2I3C A;  3CCL Z;  2NVQ I;  1VQ5 1;  3CME Z;  2V8J A;  1NJI 2;  4MD9 A;  3CPW Y;  3M3Y I;  3H3V J;  1R9T I;  2OTL Z;  3G4S 1;  3VB9 A;  4RVD A;  1N8R 1;  3FQM A;  5IP9 I;  1M1K 1;  1YUA A;  1PFT A;  3K7A I;  4RVF A;  3CD6 1;  3CCE 1;  3MZK B;  2PMZ A;  2OTJ Z;  4DGL A;  1YIT 1;  1Q86 1;  1TWA I;  1Q81 2;  2QA4 1;  2R7Z I;  2JIO A;  1SFO I;  3S17 I;  2NVT I;  4A93 I;  3IX0 A;  1JJ2 Y;  2PM9 A;  2HU9 A;  3TDH B;  3S14 I;  1S72 Z;  4RS4 A;  3VMI A;  1KQS Z;  4A3D I;  4MD8 A;  1K73 1;  1YJW Z;  4NBD A;  2LIY A;  4A3B I;  4MD7 A;  2JUB A;  1NJI 1;  3VMG A;  3D9X A;  3CXC Y;  2RHB A;  3CCU 1;  1VQ4 Z;  1VQO Z;  3CCM Z;  2OOX B;  3CPW Z;  1KD1 2;  4E2Z A;  1VQ5 Z;  4MRI A;  4A3K I;  5FLX b;  3I4N I;  2QRD B;  1VQM Z;  2PK7 A;  3IFU A;  3G4S Z;  5D1P A;  1KC8 2;  3IF8 A;  1QVF Y;  2JIR A;  2O4H A;  3F3F C;  2JA5 I;  1I3Q I;  4NBA A;  4HGZ A;  3F3P C;  1VQ8 Z;  2O53 A;  2VUG A;  1VQ6 Z;  3M4O I;  3Q87 A;  3CCE Z;  5CM2 M;  5C3E I;  2NVX I;  2V45 A;  1P9N A;  1TWH I;  1WZN A;  1JJ2 Z;  1WW9 A;  3CCR 1;  2R93 I;  4E33 A;  1YHQ 1;  4QTT A;  1ZH1 A;  1Z01 A;  4RV9 A;  3I55 Z;  1X3W A;  1VQL 1;  2KPI A;  1YJN 1;  2RIQ A;  1S7M A;  3G6E 1;  2RPR A;  3CMA 1;  4MON A;  2JR6 A;  1AA6 A;  2W03 A;  5IP7 I;  1KD1 1;  2F4O A;  1NP6 A;  2JIM A;  3CCS 1;  2VF1 A;  4TNU A;  5T6B A;  3CXC Z;  1K73 2;  5A2Q b;  5A2Q f;  2GTI A;  1KC8 1;  2E7Z A;  3GCF A;  1W2B Y;  3CCV 1;  3NH5 A;  3NH4 A;  2K5R A;  1Y1V I;  3J81 b;  3U50 C;  3KIH A;  3J81 f;  3D2L A;  4E2Y A;  4A3J I;  3S16 I;  3S15 I;  3S1N I;  3S2D I;  3OW2 Y;  2ZAE B;  2E2I I;  1RNI A;  3TE5 B;  2QKD A;  1QVF Z;  1X3Z A;  1RO4 A;  1WJ2 A;  2QRC B;  2AYD A;  3RZO I;  4E32 A;  3J7A 4;  2V8K A;  2Y0S A;  3EER A;  2J6A A;  3I56 Z;  1VQ9 1;  4X6A I;  3VTN A;  1VLA A;  3S1Q I;  3JAM f;  3FQQ A; 
#chains in the Genus database with same CATH homology
 4NBE A;  2RT9 A;  3BG1 B;  3GTP I;  3G71 1;  1QYP A;  1Y1V S;  3PO2 I;  1VQP 1;  1YHQ Z;  3CC4 1;  3HOU I;  3GTJ I;  3CC2 1;  1YJN Z;  1QVG Y;  2IZ3 A;  2JMO A;  4BY1 I;  3CMA Z;  4NBF A;  2JA8 I;  4RVH A;  5D1O B;  2B63 I;  2IZ4 A;  1W2B Z;  3CCS Z;  3GKQ A;  1QF8 A;  1K9M 1;  3CCV Z;  3OW2 Z;  3NH8 A;  2M48 A;  1VQ7 1;  3S2H I;  2M6N A;  1RO0 A;  3CCJ 1;  3GTM I;  2DE7 A;  2DE5 A;  2WAQ A;  4EWC A;  3CD6 Z;  1USP B;  2QRE B;  1JWH C;  3CCQ 1;  4MXU A;  2K3R A;  2P3Y A;  1YIT Z;  2QA4 Z;  1NUI A;  4NBB A;  1VQ9 Z;  1KRL A;  1VQK 1;  1Z03 A;  5C4X I;  1RQF A;  5C44 I;  4Y7N I;  4BY7 I;  4DK1 A;  5D1O A;  3G71 Z;  1VQP Z;  3GTK I;  3PO3 S;  1Z02 A;  2OZK A;  2EGT A;  1RLY A;  3CC4 Z;  4NBG A;  3GTM S;  2G2K A;  4BBS I;  4NOZ A;  2F4M A;  2P28 A;  3CC2 Z;  3GTG I;  1YIJ 1;  3KIF A;  5C4J I;  1YJW 1;  4RVG A;  4E31 A;  1TWF I;  3CCU Z;  2WB1 A;  4E30 A;  1TFI A;  1USP A;  1Q82 1;  3GTO I;  2JS4 A;  4A3F I;  5FLM I;  2V8I A;  3CQZ I;  2VUM I;  5IT9 b;  5IT9 f;  3S1R I;  1VQ7 Z;  2LFU A;  1YI2 1;  1K9M 2;  4A3G I;  1VQM 1;  4DQY B;  3CCJ Z;  1LQL A;  4BBR I;  2QEX 1;  2BJO A;  1WII A;  3JAM b;  3CCQ Z;  1K8A 1;  3QWU A;  1VQ8 1;  1VQ6 1;  4A3L I;  4NBH A;  3BG0 B;  3CC7 1;  3HOV I;  3CCR Z;  3T4N B;  4NH1 C;  2YU9 I;  1DL6 A;  3MZL B;  3MON A;  5AN9 F;  2GTH A;  3HKZ A;  1ZB9 A;  4BXX I;  3EED A;  1VQK Z;  1VQL Z;  4NB8 A;  3NDJ A;  1X0T A;  5LL6 f;  5T67 A;  3I55 1;  3G6E Z;  3HOY I;  2RBL A;  1I50 I;  1VQN 1;  4Y52 I;  1ML8 A;  2R6M A;  3GTQ I;  2DE6 A;  5T64 A;  2QLV B;  4QTU A;  4E2W A;  4HH4 A;  1YIJ Z;  2KI7 B;  3VMH A;  1ZB8 A;  3I07 A;  1YJ9 1;  3HOW I;  1Q7Y 2;  2GU2 A;  3LUS A;  3CCL 1;  2NVY I;  3CME 1;  2E9H A;  1M90 2;  3PO3 I;  4A3C I;  2JNY A;  4A3E I;  2OTL 1;  2Q51 A;  3D6W A;  2JA6 I;  2E2J I;  1Q82 2;  1WCM I;  1YUK A;  3ESW A;  4CL1 A;  4E2X A;  3P5J B;  1Q81 1;  1YI2 Z;  2QR1 B;  5FLX f;  1N2F A;  3J80 b;  3J80 f;  2JA7 I;  4MH4 A;  2OTJ 1;  3HOZ I;  4A3M I;  2QEX Z;  2HF1 A;  4A3I I;  3I56 1;  4AYB A;  2YAD A;  4S1T A;  2R92 I;  1I6H I;  3HOX I;  1N8R 2;  1M1K 2;  4NB9 A;  3CC7 Z;  3GTL I;  1L1O C;  1K8A 2;  1S72 1;  3S1M I;  1K83 I;  1QVG Z;  1RO2 A;  1Q7Y 1;  1Q86 2;  2AKL A;  4NFR A;  3H0G I;  1M90 1;  3RZD I;  2Q4Z A;  1VQN Z;  2E2H I;  4HGY A;  4XX2 A;  1KQS Y;  1TWG I;  3I4M I;  4NBC A;  3NDI A;  1VQ4 1;  3NFZ A;  2OOY B;  3FKI I;  1Y1W I;  1TWC I;  1VQO 1;  3CCM 1;  2H85 A;  1YJ9 Z;  2W04 A;  2I3C A;  3CCL Z;  2NVQ I;  1VQ5 1;  3CME Z;  2V8J A;  1NJI 2;  4MD9 A;  3CPW Y;  3M3Y I;  3H3V J;  1R9T I;  2OTL Z;  3G4S 1;  3VB9 A;  4RVD A;  1N8R 1;  3FQM A;  5IP9 I;  1M1K 1;  1YUA A;  1PFT A;  3K7A I;  4RVF A;  3CD6 1;  3CCE 1;  3MZK B;  2PMZ A;  2OTJ Z;  4DGL A;  1YIT 1;  1Q86 1;  1TWA I;  1Q81 2;  2QA4 1;  2R7Z I;  1SFO I;  3S17 I;  2NVT I;  4A93 I;  3IX0 A;  1JJ2 Y;  2PM9 A;  2HU9 A;  3TDH B;  3S14 I;  1S72 Z;  4RS4 A;  3VMI A;  1KQS Z;  4A3D I;  4MD8 A;  1K73 1;  1YJW Z;  4NBD A;  2LIY A;  4A3B I;  4MD7 A;  2JUB A;  1NJI 1;  3VMG A;  3D9X A;  3CXC Y;  2RHB A;  3CCU 1;  1VQ4 Z;  1VQO Z;  3CCM Z;  2OOX B;  3CPW Z;  1KD1 2;  4E2Z A;  1VQ5 Z;  4MRI A;  4A3K I;  5FLX b;  3I4N I;  2QRD B;  1VQM Z;  2PK7 A;  3IFU A;  3G4S Z;  5D1P A;  1KC8 2;  3IF8 A;  1QVF Y;  2O4H A;  3F3F C;  2JA5 I;  1I3Q I;  4NBA A;  4HGZ A;  3F3P C;  1VQ8 Z;  2O53 A;  2VUG A;  1VQ6 Z;  3M4O I;  3Q87 A;  3CCE Z;  5CM2 M;  5C3E I;  2NVX I;  1P9N A;  1TWH I;  1JJ2 Z;  1WW9 A;  3CCR 1;  2R93 I;  4E33 A;  1YHQ 1;  4QTT A;  1ZH1 A;  1Z01 A;  4RV9 A;  3I55 Z;  1X3W A;  1VQL 1;  2KPI A;  1YJN 1;  2RIQ A;  1S7M A;  2RPR A;  3G6E 1;  3CMA 1;  4MON A;  2JR6 A;  2W03 A;  5IP7 I;  1KD1 1;  2F4O A;  1NP6 A;  3CCS 1;  2VF1 A;  4TNU A;  5T6B A;  3CXC Z;  1K73 2;  5A2Q b;  5A2Q f;  2GTI A;  1KC8 1;  3GCF A;  1W2B Y;  3CCV 1;  3NH5 A;  3NH4 A;  2K5R A;  1Y1V I;  3J81 b;  3U50 C;  3KIH A;  3J81 f;  4A3J I;  4E2Y A;  3S16 I;  3S15 I;  3S1N I;  3S2D I;  3OW2 Y;  2ZAE B;  2E2I I;  1RNI A;  3TE5 B;  2QKD A;  1QVF Z;  1X3Z A;  1RO4 A;  2QRC B;  3RZO I;  4E32 A;  3J7A 4;  2V8K A;  2Y0S A;  3EER A;  2J6A A;  3I56 Z;  1VQ9 1;  4X6A I;  3VTN A;  1VLA A;  3S1Q I;  3JAM f;  3FQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...