4A3JI

Rna polymerase ii initial transcribing complex with a 2nt dna-rna hybrid and soaked with gmpcpp
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Initial RNA Polymerase II Transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 16
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3jI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3jI02
4Y7NI 2DE6A 4BY1I 4A3LI 3GTQI 1WW9A 5FLMI 3S1NI 4BY7I 1R9TI 3ESWA 4A3CI 3VB9A 2BJOA 2NVYI 4NBCA 1PFTA 1I6HI 1LQLA 2E2JI 1ML8A 2HF1A 3M4OI 3GTKI 4A93I 2E2HI 1NUIA 4QTUA 3D6WA 4NBGA 3GTMI 1TFIA 3S2DI 1QYPA 1YUAA 1ZB8A 1K83I 1RO4A 2JNYA 2VUMI 4NB8A 4A3II 3H0GI 3S1MI 1Y1VI 4QTTA 2JA8I 1DL6A 1TWHI 2J6AA 2JA6I 3GCFA 3S16I 4A3DI 2RBLA 4NB9A 3S2HI 3S15I 3RZOI 2F4MA 4NBEA 5IP9I 4A3EI 2R92I 1X3ZA 4BBRI 4NBHA 4A3GI 2R7ZI 3VMHA 3HOXI 3I07A 3S14I 3GTOI 3S1QI 3Q87A 3GTPI 5IP7I 5CM2M 1Y1VS 1I50I 2KPIA 4A3FI 1USPA 2JR6A 2R93I 4A3MI 3PO3I 1TWCI 1SFOI 3U50C 3EERA 3M3YI 4Y52I 2E2II 5C3EI 1TWGI 3HOYI 2DE5A 1X3WA 2NVQI 3CQZI 4A3KI 1I3QI 2K5RA 3GKQA 3GTJI 3S17I 2NVXI 4NOZA 2JS4A 1VLAA 4NBBA 1USPB 1N2FA 3S1RI 1Y1WI 4X6AI 3I4MI 5C4JI 2P3YA 1RLYA 2B63I 2NVTI 4NBAA 3H3VJ 1L1OC 4A3JI 3HOUI 2F4OA 3FKII 3HOWI 3GTLI 3HOZI 3GTGI 2PK7A 2DE7A 4BXXI 2AKLA 4NBFA 3VMIA 1TWFI 4MH4A 1WCMI 1ZB9A 5C4XI 4A3BI 4XX2A 3HOVI 3RZDI 3LUSA 1TWAI 3VMGA 2JA5I 3PO3S 4NBDA 2YU9I 5C44I 3I4NI 3GTMS 3K7AI 4BBSI 2JA7I 3PO2I
chains in the Genus database with same CATH superfamily
4A3LI 3NH5A 3NH4A 5FLMI 2H85A 3S1NI 3VB9A 4NBCA 3J80b 2RPRA 1RNIA 3CCS1 3J81b 4AYBA 3KIFA 1Q821 3NDIA 3J81f 3CC41 4NBGA 3GTMI 3TE5B 3G6EZ 3S2DI 2QA41 2R6MA 2K3RA 1K731 2VUMI 4NB8A 2M6NA 1AA6A 2HU9A 3CCVZ 2LEXA 3F3PC 1N8R2 3VTNA 1ZH1A 3CC4Z 3GCFA 4E31A 2JA6I 4A3DI 3CCMZ 3S15I 4RS4A 1X3ZA 4BBRI 5D1OA 4RVDA 1VQ51 3S14I 1RO2A 2LFUA 1VQ8Z 3TDHB 2JR6A 4DGLA 3CXCZ 3J80f 3MZKB 2VPYA 2DE5A 2PMZA 1X3WA 2JIOA 5T67A 1NJI1 2NVQI 4A3KI 1I3QI 3CMA1 1W2BY 3GTJI 2NVXI 1KQSZ 2JS4A 2M48A 1YJN1 3S1RI 2OOYB 3G71Z 2B63I 1FDIA 1S72Z 2NVTI 3H3VJ 5T64A 1L1OC 3CC2Z 3FQMA 3GTLI 3HOZI 1VQO1 1WIIA 2DE7A 1K9M1 1VQPZ 3CCE1 1VQ41 2WAQA 3HOVI 3NFZA 1VQKZ 1KD12 1RO0A 3QWUA 2RHBA 4NBDA 2E7ZA 2V3VA 2YU9I 2LIYA 1N8R1 4RVFA 4MONA 2VPZA 1X0TA 1YJWZ 2HF1A 1K732 1WW9A 5T6BA 3BG0B 3CCJZ 1YHQ1 1R9TI 3D2LA 4A3CI 2BJOA 1YJNZ 3MZLB 1PFTA 2QREB 3I55Z 4TNUA 2JIPA 1KC81 3CD6Z 4E2XA 1YUKA 2QLVB 5LL6f 2W04A 3CCLZ 3F3FC 1TFIA 1QYPA 1YUAA 1YJ91 3CCR1 3CPWY 1K83I 2JIQA 2V8KA 2VPWA 4A3II 2OOXB 3S1MI 4QTTA 2OTLZ 3IF8A 2JA8I 1Q7Y2 3D9XA 1TWHI 2ZAEB 1M902 1M1K1 1VQNZ 3S16I 2RBLA 4NB9A 4RVGA 3S2HI 2Y0SA 2F4MA 2RT9A 4RV9A 4A3GI 3CCM1 3VMHA 2E9HA 2Q51A 3GTPI 5IP7I 2QEX1 3CC7Z 2QA4Z 3HKZA 4Y52I 2GTHA 3U50C 3JAMb 1KQSY 4NFRA 4E2WA 3I56Z 4HGZA 1QVFZ 2K5RA 3CD61 2OTJZ 1NJI2 1VLAA 4NBBA 1USPB 3I4MI 2P3YA 1WJ2A 5FLXf 5IT9b 2V45A 4A3JI 3HOUI 2YADA 2F4OA 1Q811 1VQM1 5IT9f 3IR7A 5A2Qb 1Q16A 4BXXI 2AKLA 2KI7B 1TWFI 5C4XI 4DQYB 2I3CA 3LUSA 2QR1B 3CMAZ 1VQL1 1Q862 3PO3S 1NP6A 1M901 5D1OB 1JWHC 3G4S1 1Q7Y1 5C44I 2NAPA 1K8A1 1Z01A 2JA7I 4MXUA 2DE6A 3GTQI 4MD9A 1YIJZ 2P28A 1VQ5Z 3ESWA 2NVYI 2IZ3A 1LQLA 1I6HI 2OTJ1 1VQ6Z 3M4OI 1YI2Z 3CCQZ 3GTKI 4A93I 1NUIA 4E33A 1KC82 1K8A2 4QTUA 3D6WA 3J7A4 1Z02A 1RO4A 1Q861 3EEDA 1Y1VI 2G2KA 2GU2A 3CCL1 1KD11 4NBEA 4A3EI 2R92I 3RZOI 1VQN1 4NBHA 2V8JA 2PM9A 2R7ZI 1RQFA 4MD7A 3HOXI 3I07A 4MD8A 3S1QI 3Q87A 3CCV1 4HH4A 5CM2M 4NH1C 1Y1VS 1I50I 2KPIA 1USPA 4A3MI 3PO3I 3EERA 3M3YI 2E2II 3CCRZ 5C3EI 4S1TA 1YJ9Z 1TWGI 3HOYI 3CQZI 3GKQA 1VQLZ 1YI21 3S17I 3CCU1 3CCJ1 3P5JB 2JIMA 1N2FA 3OW2Z 4X6AI 5C4JI 1VQP1 1QVFY 1RLYA 1YJW1 4NBAA 1P9NA 4RVHA 1WZNA 1VQ71 3IX0A 2O53A 2AYDA 4E32A 3CCQ1 1JJ2Y 3T4NB 1VQ61 2IZ4A 3NH8A 3VMIA 4MH4A 1WCMI 2JIRA 1ZB9A 4A3BI 4XX2A 2O4HA 2JMOA 2WB1A 2IV2X 3CCUZ 3RZDI 1TWAI 3VMGA 4MRIA 1VQ7Z 3I561 4HGYA 3BG1B 1W2BZ 1QVGY 3K7AI 2GTIA 3PO2I 4Y7NI 1JJ2Z 1VQ91 4BY1I 3NDJA 1VQ81 1VQ4Z 4BY7I 2E2JI 1Q822 1ML8A 2OZKA 3CXCY 2E2HI 2QRCB 2VUGA 3MONA 1ZB8A 1S7MA 2QKDA 2OTL1 2QEXZ 2JNYA 3G711 1QXFA 3CC71 3H0GI 3CMEZ 1DL6A 3G6E1 2J6AA 5A2Qf 1Y8CA 2EGTA 5IP9I 5D1PA 1K9M2 2JUBA 2V8IA 3CME1 3GTOI 1YIJ1 4A3FI 2Q4ZA 2R93I 1TWCI 1Q812 1SFOI 1QF8A 5AN9F 4E2YA 4CL1A 3JAMf 3CCSZ 4E30A 4NOZA 1VQK1 5FLXb 3FQQA 1Y1WI 3CCEZ 1YHQZ 1KRLA 1SIWA 1YIT1 1VQMZ 3FKII 3G4SZ 3OW2Y 3HOWI 2VF1A 4E2ZA 2QRDB 3GTGI 2PK7A 4NBFA 3I551 2W03A 1Z03A 3KIHA 4DK1A 1VQ9Z 2VPXA 3IFUA 2RIQA 2JA5I 3CC21 1M1K2 1VQOZ 1YITZ 3I4NI 3CPWZ 4EWCA 1S721 3GTMS 1FDOA 4BBSI 1QVGZ
chains in the Genus database with same CATH topology
4A3LI 3NH5A 3NH4A 5FLMI 2H85A 3S1NI 3VB9A 4NBCA 3J80b 2RPRA 1RNIA 3CCS1 3J81b 4AYBA 3KIFA 1Q821 3NDIA 3J81f 3CC41 4NBGA 3GTMI 3TE5B 3G6EZ 3S2DI 2QA41 2R6MA 2K3RA 1K731 2VUMI 4NB8A 2M6NA 2HU9A 3CCVZ 3F3PC 1N8R2 3VTNA 1ZH1A 3CC4Z 3GCFA 4E31A 2JA6I 4A3DI 3CCMZ 3S15I 4RS4A 1X3ZA 4BBRI 5D1OA 4RVDA 1VQ51 3S14I 1RO2A 2LFUA 1VQ8Z 3TDHB 2JR6A 4DGLA 3CXCZ 3J80f 3MZKB 2DE5A 2PMZA 1X3WA 2NVQI 5T67A 1NJI1 4A3KI 1I3QI 3CMA1 1W2BY 3GTJI 2NVXI 1KQSZ 2JS4A 2M48A 1YJN1 3S1RI 2OOYB 3G71Z 2B63I 1S72Z 2NVTI 3H3VJ 5T64A 1L1OC 3CC2Z 3FQMA 3GTLI 3HOZI 1VQO1 1WIIA 2DE7A 1K9M1 1VQPZ 3CCE1 1VQ41 2WAQA 3HOVI 3NFZA 1VQKZ 1KD12 1RO0A 3QWUA 2RHBA 4NBDA 2YU9I 2LIYA 1N8R1 4RVFA 4MONA 1X0TA 1YJWZ 2HF1A 1K732 1WW9A 5T6BA 3BG0B 3CCJZ 1YHQ1 1R9TI 4A3CI 2BJOA 1YJNZ 3MZLB 1PFTA 2QREB 3I55Z 4TNUA 1KC81 3CD6Z 4E2XA 1YUKA 2QLVB 5LL6f 2W04A 3CCLZ 3F3FC 1TFIA 1QYPA 1YUAA 3CCR1 1YJ91 3CPWY 1K83I 2V8KA 4A3II 2OOXB 3S1MI 4QTTA 2OTLZ 3IF8A 2JA8I 1Q7Y2 3D9XA 1TWHI 2ZAEB 1M902 1M1K1 1VQNZ 3S16I 2RBLA 4NB9A 4RVGA 3S2HI 2Y0SA 2F4MA 2RT9A 4RV9A 4A3GI 3CCM1 3VMHA 2E9HA 2Q51A 3GTPI 5IP7I 2QEX1 3CC7Z 2QA4Z 3HKZA 4Y52I 2GTHA 3U50C 3JAMb 1KQSY 4NFRA 4E2WA 3I56Z 4HGZA 1QVFZ 2K5RA 3CD61 2OTJZ 1NJI2 1VLAA 4NBBA 1USPB 3I4MI 2P3YA 5FLXf 5IT9b 4A3JI 3HOUI 2YADA 2F4OA 1Q811 1VQM1 5IT9f 5A2Qb 4BXXI 2AKLA 2KI7B 1TWFI 5C4XI 4DQYB 2I3CA 3LUSA 2QR1B 3CMAZ 1VQL1 1Q862 3PO3S 1NP6A 1M901 5D1OB 1JWHC 3G4S1 1Q7Y1 5C44I 1K8A1 1Z01A 2JA7I 4MXUA 2DE6A 3GTQI 4MD9A 1YIJZ 2P28A 1VQ5Z 3ESWA 2NVYI 2IZ3A 1LQLA 1I6HI 2OTJ1 1VQ6Z 3M4OI 1YI2Z 3CCQZ 3GTKI 4A93I 1NUIA 4E33A 1KC82 1K8A2 4QTUA 3D6WA 3J7A4 1Z02A 1RO4A 1Q861 3EEDA 1Y1VI 2G2KA 2GU2A 3CCL1 1KD11 4NBEA 4A3EI 2R92I 3RZOI 1VQN1 4NBHA 2V8JA 2PM9A 2R7ZI 1RQFA 4MD7A 3HOXI 3I07A 4MD8A 3S1QI 3Q87A 3CCV1 4HH4A 5CM2M 4NH1C 1Y1VS 1I50I 2KPIA 1USPA 4A3MI 3PO3I 3EERA 3M3YI 2E2II 3CCRZ 5C3EI 4S1TA 1YJ9Z 1TWGI 3HOYI 3CQZI 3GKQA 1VQLZ 1YI21 3S17I 3CCU1 3CCJ1 3P5JB 1N2FA 3OW2Z 4X6AI 5C4JI 1VQP1 1QVFY 1RLYA 1YJW1 4NBAA 1P9NA 4RVHA 1VQ71 3IX0A 2O53A 4E32A 3CCQ1 1JJ2Y 3T4NB 1VQ61 2IZ4A 3NH8A 3VMIA 4MH4A 1WCMI 1ZB9A 4A3BI 4XX2A 2O4HA 2JMOA 2WB1A 3CCUZ 3RZDI 1TWAI 3VMGA 4MRIA 1VQ7Z 3I561 4HGYA 3BG1B 1W2BZ 1QVGY 3K7AI 2GTIA 3PO2I 4Y7NI 1JJ2Z 1VQ91 4BY1I 3NDJA 1VQ81 1VQ4Z 4BY7I 2E2JI 1Q822 1ML8A 2OZKA 3CXCY 2E2HI 2QRCB 2VUGA 3MONA 1ZB8A 1S7MA 2QKDA 2OTL1 2QEXZ 2JNYA 3G711 3CC71 3H0GI 3CMEZ 1DL6A 3G6E1 2J6AA 5A2Qf 2EGTA 5IP9I 5D1PA 1K9M2 2JUBA 2V8IA 3CME1 3GTOI 1YIJ1 4A3FI 2Q4ZA 2R93I 1TWCI 1Q812 1SFOI 1QF8A 5AN9F 4E2YA 4CL1A 3JAMf 3CCSZ 4E30A 4NOZA 1VQK1 5FLXb 3FQQA 1Y1WI 3CCEZ 1YHQZ 1KRLA 1YIT1 1VQMZ 3FKII 3G4SZ 3OW2Y 3HOWI 2VF1A 4E2ZA 2QRDB 3GTGI 2PK7A 4NBFA 3I551 2W03A 1Z03A 3KIHA 4DK1A 1VQ9Z 3IFUA 2RIQA 2JA5I 3CC21 1M1K2 1VQOZ 1YITZ 3I4NI 3CPWZ 4EWCA 1S721 3GTMS 4BBSI 1QVGZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y7N I;  2DE6 A;  4BY1 I;  4A3L I;  3GTQ I;  1WW9 A;  5FLM I;  3S1N I;  4BY7 I;  1R9T I;  3ESW A;  4A3C I;  3VB9 A;  2BJO A;  2NVY I;  4NBC A;  1PFT A;  1I6H I;  1LQL A;  2E2J I;  1ML8 A;  2HF1 A;  3M4O I;  3GTK I;  4A93 I;  2E2H I;  1NUI A;  4QTU A;  3D6W A;  4NBG A;  3GTM I;  1TFI A;  3S2D I;  1QYP A;  1YUA A;  1ZB8 A;  1K83 I;  1RO4 A;  2JNY A;  2VUM I;  4NB8 A;  4A3I I;  3H0G I;  3S1M I;  1Y1V I;  4QTT A;  2JA8 I;  1DL6 A;  1TWH I;  2J6A A;  2JA6 I;  3GCF A;  3S16 I;  4A3D I;  2RBL A;  4NB9 A;  3S2H I;  3S15 I;  3RZO I;  2F4M A;  4NBE A;  5IP9 I;  4A3E I;  2R92 I;  1X3Z A;  4BBR I;  4NBH A;  4A3G I;  2R7Z I;  3VMH A;  3HOX I;  3I07 A;  3S14 I;  3GTO I;  3S1Q I;  3Q87 A;  3GTP I;  5IP7 I;  5CM2 M;  1Y1V S;  1I50 I;  2KPI A;  4A3F I;  1USP A;  2JR6 A;  2R93 I;  4A3M I;  3PO3 I;  1TWC I;  1SFO I;  3U50 C;  3EER A;  3M3Y I;  4Y52 I;  2E2I I;  5C3E I;  1TWG I;  3HOY I;  2DE5 A;  1X3W A;  2NVQ I;  3CQZ I;  4A3K I;  1I3Q I;  2K5R A;  3GKQ A;  3GTJ I;  3S17 I;  2NVX I;  4NOZ A;  2JS4 A;  1VLA A;  4NBB A;  1USP B;  1N2F A;  3S1R I;  1Y1W I;  4X6A I;  3I4M I;  5C4J I;  2P3Y A;  1RLY A;  2B63 I;  2NVT I;  4NBA A;  3H3V J;  1L1O C;  4A3J I;  3HOU I;  2F4O A;  3FKI I;  3HOW I;  3GTL I;  3HOZ I;  3GTG I;  2PK7 A;  2DE7 A;  4BXX I;  2AKL A;  4NBF A;  3VMI A;  1TWF I;  4MH4 A;  1WCM I;  1ZB9 A;  5C4X I;  4A3B I;  4XX2 A;  3HOV I;  3RZD I;  3LUS A;  1TWA I;  3VMG A;  2JA5 I;  3PO3 S;  4NBD A;  2YU9 I;  5C44 I;  3I4N I;  3GTM S;  3K7A I;  4BBS I;  2JA7 I;  3PO2 I; 
#chains in the Genus database with same CATH topology
 4A3L I;  3NH5 A;  3NH4 A;  5FLM I;  2H85 A;  3S1N I;  3VB9 A;  4NBC A;  3J80 b;  2RPR A;  1RNI A;  3CCS 1;  3J81 b;  4AYB A;  3KIF A;  1Q82 1;  3NDI A;  3J81 f;  3CC4 1;  4NBG A;  3GTM I;  3TE5 B;  3G6E Z;  3S2D I;  2QA4 1;  2R6M A;  2K3R A;  1K73 1;  2VUM I;  4NB8 A;  2M6N A;  1AA6 A;  2HU9 A;  3CCV Z;  2LEX A;  3F3P C;  1N8R 2;  3VTN A;  1ZH1 A;  3CC4 Z;  3GCF A;  4E31 A;  2JA6 I;  4A3D I;  3CCM Z;  3S15 I;  4RS4 A;  1X3Z A;  4BBR I;  5D1O A;  4RVD A;  1VQ5 1;  3S14 I;  1RO2 A;  2LFU A;  1VQ8 Z;  3TDH B;  2JR6 A;  4DGL A;  3CXC Z;  3J80 f;  3MZK B;  2VPY A;  2DE5 A;  2PMZ A;  1X3W A;  2JIO A;  5T67 A;  1NJI 1;  2NVQ I;  4A3K I;  1I3Q I;  3CMA 1;  1W2B Y;  3GTJ I;  2NVX I;  1KQS Z;  2JS4 A;  2M48 A;  1YJN 1;  3S1R I;  2OOY B;  3G71 Z;  2B63 I;  1FDI A;  1S72 Z;  2NVT I;  3H3V J;  5T64 A;  1L1O C;  3CC2 Z;  3FQM A;  3GTL I;  3HOZ I;  1VQO 1;  1WII A;  2DE7 A;  1K9M 1;  1VQP Z;  3CCE 1;  1VQ4 1;  2WAQ A;  3HOV I;  3NFZ A;  1VQK Z;  1KD1 2;  1RO0 A;  3QWU A;  2RHB A;  4NBD A;  2E7Z A;  2V3V A;  2YU9 I;  2LIY A;  1N8R 1;  4RVF A;  4MON A;  2VPZ A;  1X0T A;  1YJW Z;  2HF1 A;  1K73 2;  1WW9 A;  5T6B A;  3BG0 B;  3CCJ Z;  1YHQ 1;  1R9T I;  3D2L A;  4A3C I;  2BJO A;  1YJN Z;  3MZL B;  1PFT A;  2QRE B;  3I55 Z;  4TNU A;  2JIP A;  1KC8 1;  3CD6 Z;  4E2X A;  1YUK A;  2QLV B;  5LL6 f;  2W04 A;  3CCL Z;  3F3F C;  1TFI A;  1QYP A;  1YUA A;  1YJ9 1;  3CCR 1;  3CPW Y;  1K83 I;  2JIQ A;  2V8K A;  2VPW A;  4A3I I;  2OOX B;  3S1M I;  4QTT A;  2OTL Z;  3IF8 A;  2JA8 I;  1Q7Y 2;  3D9X A;  1TWH I;  2ZAE B;  1M90 2;  1M1K 1;  1VQN Z;  3S16 I;  2RBL A;  4NB9 A;  4RVG A;  3S2H I;  2Y0S A;  2F4M A;  2RT9 A;  4RV9 A;  4A3G I;  3CCM 1;  3VMH A;  2E9H A;  2Q51 A;  3GTP I;  5IP7 I;  2QEX 1;  3CC7 Z;  2QA4 Z;  3HKZ A;  4Y52 I;  2GTH A;  3U50 C;  3JAM b;  1KQS Y;  4NFR A;  4E2W A;  3I56 Z;  4HGZ A;  1QVF Z;  2K5R A;  3CD6 1;  2OTJ Z;  1NJI 2;  1VLA A;  4NBB A;  1USP B;  3I4M I;  2P3Y A;  1WJ2 A;  5FLX f;  5IT9 b;  2V45 A;  4A3J I;  3HOU I;  2YAD A;  2F4O A;  1Q81 1;  1VQM 1;  5IT9 f;  3IR7 A;  5A2Q b;  1Q16 A;  4BXX I;  2AKL A;  2KI7 B;  1TWF I;  5C4X I;  4DQY B;  2I3C A;  3LUS A;  2QR1 B;  3CMA Z;  1VQL 1;  1Q86 2;  3PO3 S;  1NP6 A;  1M90 1;  5D1O B;  1JWH C;  3G4S 1;  1Q7Y 1;  5C44 I;  2NAP A;  1K8A 1;  1Z01 A;  2JA7 I;  4MXU A;  2DE6 A;  3GTQ I;  4MD9 A;  1YIJ Z;  2P28 A;  1VQ5 Z;  3ESW A;  2NVY I;  2IZ3 A;  1LQL A;  1I6H I;  2OTJ 1;  1VQ6 Z;  3M4O I;  1YI2 Z;  3CCQ Z;  3GTK I;  4A93 I;  1NUI A;  4E33 A;  1KC8 2;  1K8A 2;  4QTU A;  3D6W A;  3J7A 4;  1Z02 A;  1RO4 A;  1Q86 1;  3EED A;  1Y1V I;  2G2K A;  2GU2 A;  3CCL 1;  1KD1 1;  4NBE A;  4A3E I;  2R92 I;  3RZO I;  1VQN 1;  4NBH A;  2V8J A;  2PM9 A;  2R7Z I;  1RQF A;  4MD7 A;  3HOX I;  3I07 A;  4MD8 A;  3S1Q I;  3Q87 A;  3CCV 1;  4HH4 A;  5CM2 M;  4NH1 C;  1Y1V S;  1I50 I;  2KPI A;  1USP A;  4A3M I;  3PO3 I;  3EER A;  3M3Y I;  2E2I I;  3CCR Z;  5C3E I;  4S1T A;  1YJ9 Z;  1TWG I;  3HOY I;  3CQZ I;  3GKQ A;  1VQL Z;  1YI2 1;  3S17 I;  3CCU 1;  3CCJ 1;  3P5J B;  2JIM A;  1N2F A;  3OW2 Z;  4X6A I;  5C4J I;  1VQP 1;  1QVF Y;  1RLY A;  1YJW 1;  4NBA A;  1P9N A;  4RVH A;  1WZN A;  1VQ7 1;  3IX0 A;  2O53 A;  2AYD A;  4E32 A;  3CCQ 1;  1JJ2 Y;  3T4N B;  1VQ6 1;  2IZ4 A;  3NH8 A;  3VMI A;  4MH4 A;  1WCM I;  2JIR A;  1ZB9 A;  4A3B I;  4XX2 A;  2O4H A;  2JMO A;  2WB1 A;  2IV2 X;  3CCU Z;  3RZD I;  1TWA I;  3VMG A;  4MRI A;  1VQ7 Z;  3I56 1;  4HGY A;  3BG1 B;  1W2B Z;  1QVG Y;  3K7A I;  2GTI A;  3PO2 I;  4Y7N I;  1JJ2 Z;  1VQ9 1;  4BY1 I;  3NDJ A;  1VQ8 1;  1VQ4 Z;  4BY7 I;  2E2J I;  1Q82 2;  1ML8 A;  2OZK A;  3CXC Y;  2E2H I;  2QRC B;  2VUG A;  3MON A;  1ZB8 A;  1S7M A;  2QKD A;  2OTL 1;  2QEX Z;  2JNY A;  3G71 1;  1QXF A;  3CC7 1;  3H0G I;  3CME Z;  1DL6 A;  3G6E 1;  2J6A A;  5A2Q f;  1Y8C A;  2EGT A;  5IP9 I;  5D1P A;  1K9M 2;  2JUB A;  2V8I A;  3CME 1;  3GTO I;  1YIJ 1;  4A3F I;  2Q4Z A;  2R93 I;  1TWC I;  1Q81 2;  1SFO I;  1QF8 A;  5AN9 F;  4E2Y A;  4CL1 A;  3JAM f;  3CCS Z;  4E30 A;  4NOZ A;  1VQK 1;  5FLX b;  3FQQ A;  1Y1W I;  3CCE Z;  1YHQ Z;  1KRL A;  1SIW A;  1YIT 1;  1VQM Z;  3FKI I;  3G4S Z;  3OW2 Y;  3HOW I;  2VF1 A;  4E2Z A;  2QRD B;  3GTG I;  2PK7 A;  4NBF A;  3I55 1;  2W03 A;  1Z03 A;  3KIH A;  4DK1 A;  1VQ9 Z;  2VPX A;  3IFU A;  2RIQ A;  2JA5 I;  3CC2 1;  1M1K 2;  1VQO Z;  1YIT Z;  3I4N I;  3CPW Z;  4EWC A;  1S72 1;  3GTM S;  1FDO A;  4BBS I;  1QVG Z; 
#chains in the Genus database with same CATH homology
 4A3L I;  3NH5 A;  3NH4 A;  5FLM I;  2H85 A;  3S1N I;  3VB9 A;  4NBC A;  3J80 b;  2RPR A;  1RNI A;  3CCS 1;  3J81 b;  4AYB A;  3KIF A;  1Q82 1;  3NDI A;  3J81 f;  3CC4 1;  4NBG A;  3GTM I;  3TE5 B;  3G6E Z;  3S2D I;  2QA4 1;  2R6M A;  2K3R A;  1K73 1;  2VUM I;  4NB8 A;  2M6N A;  2HU9 A;  3CCV Z;  3F3P C;  1N8R 2;  3VTN A;  1ZH1 A;  3CC4 Z;  3GCF A;  4E31 A;  2JA6 I;  4A3D I;  3CCM Z;  3S15 I;  4RS4 A;  1X3Z A;  4BBR I;  5D1O A;  4RVD A;  1VQ5 1;  3S14 I;  1RO2 A;  2LFU A;  1VQ8 Z;  3TDH B;  2JR6 A;  4DGL A;  3CXC Z;  3J80 f;  3MZK B;  2DE5 A;  2PMZ A;  1X3W A;  2NVQ I;  5T67 A;  1NJI 1;  4A3K I;  1I3Q I;  3CMA 1;  1W2B Y;  3GTJ I;  2NVX I;  1KQS Z;  2JS4 A;  2M48 A;  1YJN 1;  3S1R I;  2OOY B;  3G71 Z;  2B63 I;  1S72 Z;  2NVT I;  3H3V J;  5T64 A;  1L1O C;  3CC2 Z;  3FQM A;  3GTL I;  3HOZ I;  1VQO 1;  1WII A;  2DE7 A;  1K9M 1;  1VQP Z;  3CCE 1;  1VQ4 1;  2WAQ A;  3HOV I;  3NFZ A;  1VQK Z;  1KD1 2;  1RO0 A;  3QWU A;  2RHB A;  4NBD A;  2YU9 I;  2LIY A;  1N8R 1;  4RVF A;  4MON A;  1X0T A;  1YJW Z;  2HF1 A;  1K73 2;  1WW9 A;  5T6B A;  3BG0 B;  3CCJ Z;  1YHQ 1;  1R9T I;  4A3C I;  2BJO A;  1YJN Z;  3MZL B;  1PFT A;  2QRE B;  3I55 Z;  4TNU A;  1KC8 1;  3CD6 Z;  4E2X A;  1YUK A;  2QLV B;  5LL6 f;  2W04 A;  3CCL Z;  3F3F C;  1TFI A;  1QYP A;  1YUA A;  3CCR 1;  1YJ9 1;  3CPW Y;  1K83 I;  2V8K A;  4A3I I;  2OOX B;  3S1M I;  4QTT A;  2OTL Z;  3IF8 A;  2JA8 I;  1Q7Y 2;  3D9X A;  1TWH I;  2ZAE B;  1M90 2;  1M1K 1;  1VQN Z;  3S16 I;  2RBL A;  4NB9 A;  4RVG A;  3S2H I;  2Y0S A;  2F4M A;  2RT9 A;  4RV9 A;  4A3G I;  3CCM 1;  3VMH A;  2E9H A;  2Q51 A;  3GTP I;  5IP7 I;  2QEX 1;  3CC7 Z;  2QA4 Z;  3HKZ A;  4Y52 I;  2GTH A;  3U50 C;  3JAM b;  1KQS Y;  4NFR A;  4E2W A;  3I56 Z;  4HGZ A;  1QVF Z;  2K5R A;  3CD6 1;  2OTJ Z;  1NJI 2;  1VLA A;  4NBB A;  1USP B;  3I4M I;  2P3Y A;  5FLX f;  5IT9 b;  4A3J I;  3HOU I;  2YAD A;  2F4O A;  1Q81 1;  1VQM 1;  5IT9 f;  5A2Q b;  4BXX I;  2AKL A;  2KI7 B;  1TWF I;  5C4X I;  4DQY B;  2I3C A;  3LUS A;  2QR1 B;  3CMA Z;  1VQL 1;  1Q86 2;  3PO3 S;  1NP6 A;  1M90 1;  5D1O B;  1JWH C;  3G4S 1;  1Q7Y 1;  5C44 I;  1K8A 1;  1Z01 A;  2JA7 I;  4MXU A;  2DE6 A;  3GTQ I;  4MD9 A;  1YIJ Z;  2P28 A;  1VQ5 Z;  3ESW A;  2NVY I;  2IZ3 A;  1LQL A;  1I6H I;  2OTJ 1;  1VQ6 Z;  3M4O I;  1YI2 Z;  3CCQ Z;  3GTK I;  4A93 I;  1NUI A;  4E33 A;  1KC8 2;  1K8A 2;  4QTU A;  3D6W A;  3J7A 4;  1Z02 A;  1RO4 A;  1Q86 1;  3EED A;  1Y1V I;  2G2K A;  2GU2 A;  3CCL 1;  1KD1 1;  4NBE A;  4A3E I;  2R92 I;  3RZO I;  1VQN 1;  4NBH A;  2V8J A;  2PM9 A;  2R7Z I;  1RQF A;  4MD7 A;  3HOX I;  3I07 A;  4MD8 A;  3S1Q I;  3Q87 A;  3CCV 1;  4HH4 A;  5CM2 M;  4NH1 C;  1Y1V S;  1I50 I;  2KPI A;  1USP A;  4A3M I;  3PO3 I;  3EER A;  3M3Y I;  2E2I I;  3CCR Z;  5C3E I;  4S1T A;  1YJ9 Z;  1TWG I;  3HOY I;  3CQZ I;  3GKQ A;  1VQL Z;  1YI2 1;  3S17 I;  3CCU 1;  3CCJ 1;  3P5J B;  1N2F A;  3OW2 Z;  4X6A I;  5C4J I;  1VQP 1;  1QVF Y;  1RLY A;  1YJW 1;  4NBA A;  1P9N A;  4RVH A;  1VQ7 1;  3IX0 A;  2O53 A;  4E32 A;  3CCQ 1;  1JJ2 Y;  3T4N B;  1VQ6 1;  2IZ4 A;  3NH8 A;  3VMI A;  4MH4 A;  1WCM I;  1ZB9 A;  4A3B I;  4XX2 A;  2O4H A;  2JMO A;  2WB1 A;  3CCU Z;  3RZD I;  1TWA I;  3VMG A;  4MRI A;  1VQ7 Z;  3I56 1;  4HGY A;  3BG1 B;  1W2B Z;  1QVG Y;  3K7A I;  2GTI A;  3PO2 I;  4Y7N I;  1JJ2 Z;  1VQ9 1;  4BY1 I;  3NDJ A;  1VQ8 1;  1VQ4 Z;  4BY7 I;  2E2J I;  1Q82 2;  1ML8 A;  2OZK A;  3CXC Y;  2E2H I;  2QRC B;  2VUG A;  3MON A;  1ZB8 A;  1S7M A;  2QKD A;  2OTL 1;  2QEX Z;  2JNY A;  3G71 1;  3CC7 1;  3H0G I;  3CME Z;  1DL6 A;  3G6E 1;  2J6A A;  5A2Q f;  2EGT A;  5IP9 I;  5D1P A;  1K9M 2;  2JUB A;  2V8I A;  3CME 1;  3GTO I;  1YIJ 1;  4A3F I;  2Q4Z A;  2R93 I;  1TWC I;  1Q81 2;  1SFO I;  1QF8 A;  5AN9 F;  4E2Y A;  4CL1 A;  3JAM f;  3CCS Z;  4E30 A;  4NOZ A;  1VQK 1;  5FLX b;  3FQQ A;  1Y1W I;  3CCE Z;  1YHQ Z;  1KRL A;  1YIT 1;  1VQM Z;  3FKI I;  3G4S Z;  3OW2 Y;  3HOW I;  2VF1 A;  4E2Z A;  2QRD B;  3GTG I;  2PK7 A;  4NBF A;  3I55 1;  2W03 A;  1Z03 A;  3KIH A;  4DK1 A;  1VQ9 Z;  3IFU A;  2RIQ A;  2JA5 I;  3CC2 1;  1M1K 2;  1VQO Z;  1YIT Z;  3I4N I;  3CPW Z;  4EWC A;  1S72 1;  3GTM S;  4BBS I;  1QVG Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...