4Y7NI

The structure insight into 5-carboxycytosine recognition by rna polymerase ii during transcription elongation.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis for 5-carboxycytosine recognition by RNA polymerase II elongation complex.
pubmed doi rcsb
molecule tags Transcription/dna/rna
total genus 11
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2015-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4y7nI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4y7nI02
1TWGI 4NBHA 1TWFI 2NVYI 2R92I 2PK7A 1RO4A 4NB8A 4A3II 1LQLA 2JA6I 3S2HI 1WW9A 1TFIA 1Y1WI 3S16I 3GTKI 3HOUI 3HOWI 5IP9I 3S1QI 3GTLI 3GTQI 4A3CI 1NUIA 4A93I 4BBSI 1I50I 3S17I 5IP7I 4NB9A 1PFTA 2JS4A 1Y1VS 2JR6A 3RZDI 2E2JI 3H0GI 4A3MI 2NVXI 1SFOI 5C4XI 4BY1I 3GCFA 2E2HI 2E2II 1R9TI 3VMGA 4X6AI 3FKII 3GTMS 1X3ZA 4NBDA 5C44I 3I07A 1ML8A 1I6HI 1USPB 2F4OA 4Y7NI 4A3FI 1VLAA 3VB9A 3GTOI 1ZB8A 4QTTA 3VMHA 2HF1A 3K7AI 3S1RI 1WCMI 2J6AA 1DL6A 3M4OI 2YU9I 2F4MA 3LUSA 1K83I 2AKLA 5C4JI 4A3GI 3RZOI 4A3LI 2VUMI 3S14I 3PO3I 1USPA 1TWHI 3CQZI 4XX2A 3I4MI 5FLMI 3S2DI 4A3EI 3Q87A 3VMIA 3GKQA 4A3BI 2DE6A 3HOYI 2R7ZI 5CM2M 4NBCA 4NBAA 3GTJI 3H3VJ 3GTPI 4NBBA 2DE7A 4A3JI 2R93I 2K5RA 2BJOA 5C3EI 2JNYA 3S1NI 1TWAI 4BBRI 2DE5A 2P3YA 3HOVI 1QYPA 4NBFA 2JA5I 3I4NI 3GTMI 1X3WA 3U50C 4A3KI 3S1MI 1N2FA 1RLYA 4NOZA 2NVTI 2JA7I 3PO2I 3S15I 1ZB9A 4BXXI 2NVQI 4NBGA 2RBLA 3ESWA 3D6WA 4Y52I 1YUAA 4A3DI 1TWCI 2B63I 2JA8I 4MH4A 2KPIA 4QTUA 3HOXI 1I3QI 1Y1VI 3HOZI 4NBEA 4BY7I 1L1OC 3PO3S 3M3YI 3EERA 3GTGI
chains in the Genus database with same CATH superfamily
1VQLZ 5T6BA 1TWFI 3P5JB 2R92I 3I561 4A3II 4RVFA 2JIMA 3IFUA 2JA6I 4AYBA 3S2HI 1TFIA 1YHQ1 3CCQ1 1Y1WI 3T4NB 1Q7Y1 4E33A 1W2BY 3GTQI 1QVFY 4BBSI 2QR1B 3S17I 5IP7I 4NB9A 1YJ91 1VQOZ 5T67A 4A3MI 3IR7A 2QEX1 2WAQA 4BY1I 3FQMA 2VF1A 4X6AI 3FKII 1X3ZA 4NBDA 1RQFA 3MONA 4RS4A 1VQMZ 1ML8A 4S1TA 3F3PC 3CC2Z 3CC71 4A3FI 3CCE1 1ZB8A 1VQ4Z 3K7AI 1N8R1 3S1RI 1K8A1 1VQ6Z 1Z01A 2OTLZ 4A3GI 2VPZA 4MD9A 5A2Qf 5FLXb 1K731 3F3FC 1YI2Z 1Z03A 4DK1A 2M6NA 2Y0SA 2ZAEB 3G6EZ 3CQZI 1KC82 3JAMf 2G2KA 1YUKA 2VPXA 1RO0A 1YITZ 1S72Z 4MD8A 3VMIA 3CCLZ 4E2WA 4A3BI 1Y8CA 1KRLA 1QVGZ 2DE6A 3HOYI 5CM2M 4NBCA 1SIWA 3J80f 1YJNZ 1K9M2 2E7ZA 2R93I 2M48A 5C3EI 1M901 3CCUZ 2P3YA 4NBFA 2JA5I 3CCMZ 4HGZA 3CPWY 3J81b 1W2BZ 2GTIA 1VQ91 3IF8A 3S1MI 4NOZA 2NVTI 1VQ7Z 2NVQI 3CCL1 4NH1C 1YUAA 1VQ5Z 1NJI2 4E2YA 2Q51A 4MD7A 4MH4A 1Y1VI 3CCJ1 3PO3S 3EERA 3NFZA 1JWHC 2NVYI 3I56Z 4NB8A 1LQLA 1YHQZ 1QXFA 3CCQZ 3KIFA 1X0TA 3S16I 3GTKI 5IP9I 2P28A 1NUIA 4E2XA 2VPWA 1VQN1 2VUGA 1VQ81 1I50I 1YJ9Z 2RHBA 2QREB 2JS4A 2QRCB 2JR6A 3RZDI 2QEXZ 2YADA 2NVXI 1SFOI 2JIRA 1R9TI 5C44I 1I6HI 3CC7Z 4Y7NI 3CCEZ 1NJI1 1YIJ1 3GTOI 2GU2A 2K3RA 3CPWZ 2HU9A 3M4OI 2YU9I 1M1K2 2JUBA 2OOXB 1USPA 2W03A 2NAPA 4XX2A 4A3EI 2JIOA 3Q87A 3TDHB 3GKQA 4RVHA 1Q822 4RV9A 4NBAA 3GTJI 2DE7A 4DQYB 4A3JI 2BJOA 1TWAI 3G711 4BBRI 3CME1 3J80b 3I4NI 1NP6A 5AN9F 1X3WA 2V3VA 1VQ9Z 2RIQA 2WB1A 4RVDA 1N2FA 3PO2I 4NBGA 2I3CA 5D1OB 2RBLA 1KD12 3D6WA 4A3DI 2H85A 3OW2Y 1WZNA 4QTUA 1I3QI 3CCJZ 4NBEA 3G4S1 1VQP1 3BG0B 2IZ4A 4NBHA 2JIQA 2QLVB 2IZ3A 2PK7A 3J7A4 1QVFZ 1WW9A 3MZKB 3HOWI 1VQNZ 3CCR1 4HGYA 1VQ8Z 4A3CI 3NH5A 1PFTA 1Y1VS 3I551 2QA41 2E2JI 1P9NA 4MXUA 1KC81 1Q862 3GCFA 2E2HI 2E2II 3GTMS 3TE5B 1KD11 2AYDA 3QWUA 2F4OA 1YIJZ 1VLAA 3VB9A 1K9M1 3CC41 2V8IA 1Q7Y2 2J6AA 1DL6A 1JJ2Y 2OTJ1 1K83I 3RZOI 2O4HA 2VUMI 3FQQA 3S14I 3PO3I 1YJW1 2OOYB 4RVGA 3I4MI 3OW2Z 1ZH1A 2V45A 4E30A 2R7ZI 1AA6A 3CXCY 1RO2A 2PMZA 2QRDB 3GTPI 2PM9A 1QVGY 1N8R2 1K8A2 2K5RA 5IT9f 4DGLA 3G71Z 3CMEZ 4E2ZA 3HOVI 2DE5A 2LEXA 3MZLB 1QYPA 1K732 5D1OA 4A3KI 3S15I 1KQSY 3CMA1 1ZB9A 2E9HA 2V8JA 4HH4A 2JMOA 2IV2X 5A2Qb 3ESWA 1Z02A 5D1PA 1S7MA 1VQK1 3CD61 5LL6f 2QKDA 4E31A 3JAMb 2JA8I 2JIPA 2V8KA 3HOXI 3HOZI 4BY7I 3G4SZ 1VQPZ 3HKZA 1L1OC 1M902 3GTGI 3CCV1 1TWGI 3CCS1 1VQL1 4CL1A 1RO4A 4MONA 2RPRA 2LIYA 1JJ2Z 2OZKA 4TNUA 3HOUI 3S1QI 3CCRZ 2Q4ZA 2KI7B 3GTLI 4A93I 1M1K1 4MRIA 3I55Z 2QA4Z 3NH4A 3H0GI 1VQO1 5C4XI 1RNIA 2EGTA 2O53A 3CXCZ 3VMGA 2GTHA 3NH8A 3I07A 1Q821 3D9XA 1VQM1 5FLXf 1USPB 2W04A 3CC21 3CC4Z 4QTTA 3VMHA 2HF1A 1VQ41 2LFUA 1WCMI 1Q812 2OTJZ 1VQ61 2F4MA 3LUSA 2AKLA 5C4JI 4A3LI 1Q16A 2OTL1 1YJWZ 1KQSZ 1YI21 1TWHI 3G6E1 3KIHA 5FLMI 3S2DI 1YIT1 1S721 3NDJA 3NDIA 3VTNA 3J81f 3H3VJ 4NBBA 2VPYA 1YJN1 4NFRA 3EEDA 3BG1B 1FDOA 2JNYA 3S1NI 3D2LA 2RT9A 3CCU1 4E32A 3GTMI 3CCM1 3U50C 4EWCA 1WJ2A 3CMAZ 3IX0A 1RLYA 2R6MA 2JA7I 5IT9b 4BXXI 1VQ71 1WIIA 1Q811 1VQKZ 3CD6Z 4Y52I 1TWCI 1QF8A 1VQ51 2B63I 5T64A 2KPIA 1Q861 1FDIA 3M3YI 3CCVZ 3CCSZ
chains in the Genus database with same CATH topology
1VQLZ 5T6BA 1TWFI 3P5JB 2R92I 3I561 4A3II 4RVFA 3IFUA 2JA6I 4AYBA 3S2HI 1TFIA 1YHQ1 3CCQ1 1Y1WI 3T4NB 1Q7Y1 4E33A 1W2BY 3GTQI 1QVFY 4BBSI 2QR1B 3S17I 5IP7I 4NB9A 1YJ91 1VQOZ 5T67A 4A3MI 2QEX1 2WAQA 4BY1I 3FQMA 2VF1A 4X6AI 3FKII 1X3ZA 4NBDA 1RQFA 3MONA 4RS4A 1VQMZ 1ML8A 4S1TA 3F3PC 3CC2Z 3CC71 4A3FI 3CCE1 1ZB8A 1VQ4Z 3K7AI 1N8R1 3S1RI 1K8A1 1VQ6Z 1Z01A 2OTLZ 4A3GI 4MD9A 5A2Qf 5FLXb 1K731 3F3FC 1YI2Z 1Z03A 4DK1A 2M6NA 2Y0SA 2ZAEB 3G6EZ 3CQZI 1KC82 3JAMf 2G2KA 1YUKA 1RO0A 1YITZ 1S72Z 4MD8A 3VMIA 3CCLZ 4E2WA 4A3BI 1KRLA 1QVGZ 2DE6A 3HOYI 5CM2M 4NBCA 3J80f 1YJNZ 1K9M2 2R93I 2M48A 5C3EI 1M901 3CCUZ 2P3YA 4NBFA 2JA5I 3CCMZ 4HGZA 3CPWY 3J81b 1W2BZ 2GTIA 1VQ91 3IF8A 3S1MI 4NOZA 2NVTI 1VQ7Z 2NVQI 3CCL1 4NH1C 1YUAA 1VQ5Z 1NJI2 4E2YA 2Q51A 4MD7A 4MH4A 1Y1VI 3CCJ1 3PO3S 3EERA 3NFZA 1JWHC 2NVYI 3I56Z 4NB8A 1LQLA 1YHQZ 3CCQZ 3KIFA 1X0TA 3S16I 3GTKI 5IP9I 2P28A 1NUIA 4E2XA 1VQN1 2VUGA 1VQ81 1I50I 1YJ9Z 2RHBA 2QREB 2JS4A 2QRCB 2JR6A 3RZDI 2QEXZ 2YADA 2NVXI 1SFOI 1R9TI 5C44I 1I6HI 3CC7Z 4Y7NI 3CCEZ 1NJI1 1YIJ1 3GTOI 2GU2A 2K3RA 3CPWZ 2HU9A 3M4OI 2YU9I 1M1K2 2JUBA 2OOXB 1USPA 2W03A 4XX2A 4A3EI 3Q87A 3TDHB 3GKQA 4RVHA 1Q822 4RV9A 4NBAA 3GTJI 2DE7A 4DQYB 4A3JI 2BJOA 1TWAI 3G711 4BBRI 3CME1 3J80b 3I4NI 1NP6A 5AN9F 1X3WA 1VQ9Z 2RIQA 2WB1A 4RVDA 1N2FA 3PO2I 4NBGA 2I3CA 5D1OB 2RBLA 1KD12 3D6WA 4A3DI 2H85A 3OW2Y 4QTUA 1I3QI 3CCJZ 4NBEA 3G4S1 1VQP1 3BG0B 2IZ4A 4NBHA 2QLVB 2IZ3A 2PK7A 3J7A4 1QVFZ 1WW9A 3MZKB 3HOWI 1VQNZ 3CCR1 4HGYA 1VQ8Z 4A3CI 3NH5A 1PFTA 1Y1VS 3I551 2QA41 2E2JI 1P9NA 4MXUA 1KC81 1Q862 3GCFA 2E2HI 2E2II 3GTMS 3TE5B 1KD11 3QWUA 2F4OA 1YIJZ 1VLAA 3VB9A 1K9M1 3CC41 2V8IA 1Q7Y2 2J6AA 1DL6A 1JJ2Y 2OTJ1 1K83I 3RZOI 2O4HA 2VUMI 3FQQA 3S14I 3PO3I 1YJW1 2OOYB 4RVGA 3I4MI 3OW2Z 1ZH1A 4E30A 2R7ZI 3CXCY 1RO2A 2PMZA 2QRDB 3GTPI 2PM9A 1QVGY 1N8R2 1K8A2 2K5RA 5IT9f 4DGLA 3G71Z 3CMEZ 4E2ZA 3HOVI 2DE5A 3MZLB 1QYPA 1K732 5D1OA 4A3KI 3S15I 1KQSY 3CMA1 1ZB9A 2E9HA 2V8JA 4HH4A 2JMOA 5A2Qb 3ESWA 1Z02A 5D1PA 1S7MA 1VQK1 3CD61 5LL6f 2QKDA 4E31A 3JAMb 2JA8I 2V8KA 3HOXI 3HOZI 4BY7I 3G4SZ 1VQPZ 3HKZA 1L1OC 1M902 3GTGI 3CCV1 1TWGI 3CCS1 1VQL1 4CL1A 1RO4A 4MONA 2RPRA 2LIYA 1JJ2Z 2OZKA 4TNUA 3HOUI 3S1QI 3CCRZ 2Q4ZA 2KI7B 3GTLI 4A93I 1M1K1 4MRIA 3I55Z 2QA4Z 3NH4A 3H0GI 1VQO1 5C4XI 1RNIA 2EGTA 2O53A 3CXCZ 3VMGA 2GTHA 3NH8A 3I07A 1Q821 3D9XA 1VQM1 5FLXf 1USPB 2W04A 3CC21 3CC4Z 4QTTA 3VMHA 2HF1A 1VQ41 2LFUA 1WCMI 1Q812 2OTJZ 1VQ61 2F4MA 3LUSA 2AKLA 5C4JI 4A3LI 2OTL1 1YJWZ 1KQSZ 1YI21 1TWHI 3G6E1 3KIHA 5FLMI 3S2DI 1YIT1 1S721 3NDJA 3NDIA 3VTNA 3J81f 3H3VJ 4NBBA 1YJN1 4NFRA 3EEDA 3BG1B 2JNYA 3S1NI 2RT9A 3CCU1 4E32A 3GTMI 3CCM1 3U50C 4EWCA 3CMAZ 3IX0A 1RLYA 2R6MA 2JA7I 5IT9b 4BXXI 1VQ71 1WIIA 1Q811 1VQKZ 3CD6Z 4Y52I 1TWCI 1QF8A 1VQ51 2B63I 5T64A 2KPIA 1Q861 3M3YI 3CCVZ 3CCSZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWG I;  4NBH A;  1TWF I;  2NVY I;  2R92 I;  2PK7 A;  1RO4 A;  4NB8 A;  4A3I I;  1LQL A;  2JA6 I;  3S2H I;  1WW9 A;  1TFI A;  1Y1W I;  3S16 I;  3GTK I;  3HOU I;  3HOW I;  5IP9 I;  3S1Q I;  3GTL I;  3GTQ I;  4A3C I;  1NUI A;  4A93 I;  4BBS I;  1I50 I;  3S17 I;  5IP7 I;  4NB9 A;  1PFT A;  2JS4 A;  1Y1V S;  2JR6 A;  3RZD I;  2E2J I;  3H0G I;  4A3M I;  2NVX I;  1SFO I;  5C4X I;  4BY1 I;  3GCF A;  2E2H I;  2E2I I;  1R9T I;  3VMG A;  4X6A I;  3FKI I;  3GTM S;  1X3Z A;  4NBD A;  5C44 I;  3I07 A;  1ML8 A;  1I6H I;  1USP B;  2F4O A;  4Y7N I;  4A3F I;  1VLA A;  3VB9 A;  3GTO I;  1ZB8 A;  4QTT A;  3VMH A;  2HF1 A;  3K7A I;  3S1R I;  1WCM I;  2J6A A;  1DL6 A;  3M4O I;  2YU9 I;  2F4M A;  3LUS A;  1K83 I;  2AKL A;  5C4J I;  4A3G I;  3RZO I;  4A3L I;  2VUM I;  3S14 I;  3PO3 I;  1USP A;  1TWH I;  3CQZ I;  4XX2 A;  3I4M I;  5FLM I;  3S2D I;  4A3E I;  3Q87 A;  3VMI A;  3GKQ A;  4A3B I;  2DE6 A;  3HOY I;  2R7Z I;  5CM2 M;  4NBC A;  4NBA A;  3GTJ I;  3H3V J;  3GTP I;  4NBB A;  2DE7 A;  4A3J I;  2R93 I;  2K5R A;  2BJO A;  5C3E I;  2JNY A;  3S1N I;  1TWA I;  4BBR I;  2DE5 A;  2P3Y A;  3HOV I;  1QYP A;  4NBF A;  2JA5 I;  3I4N I;  3GTM I;  1X3W A;  3U50 C;  4A3K I;  3S1M I;  1N2F A;  1RLY A;  4NOZ A;  2NVT I;  2JA7 I;  3PO2 I;  3S15 I;  1ZB9 A;  4BXX I;  2NVQ I;  4NBG A;  2RBL A;  3ESW A;  3D6W A;  4Y52 I;  1YUA A;  4A3D I;  1TWC I;  2B63 I;  2JA8 I;  4MH4 A;  2KPI A;  4QTU A;  3HOX I;  1I3Q I;  1Y1V I;  3HOZ I;  4NBE A;  4BY7 I;  1L1O C;  3PO3 S;  3M3Y I;  3EER A;  3GTG I; 
#chains in the Genus database with same CATH topology
 1VQL Z;  5T6B A;  1TWF I;  3P5J B;  2R92 I;  3I56 1;  4A3I I;  4RVF A;  2JIM A;  3IFU A;  2JA6 I;  4AYB A;  3S2H I;  1TFI A;  1YHQ 1;  3CCQ 1;  1Y1W I;  3T4N B;  1Q7Y 1;  4E33 A;  1W2B Y;  3GTQ I;  1QVF Y;  4BBS I;  2QR1 B;  3S17 I;  5IP7 I;  4NB9 A;  1YJ9 1;  1VQO Z;  5T67 A;  4A3M I;  3IR7 A;  2QEX 1;  2WAQ A;  4BY1 I;  3FQM A;  2VF1 A;  4X6A I;  3FKI I;  1X3Z A;  4NBD A;  1RQF A;  3MON A;  4RS4 A;  1VQM Z;  1ML8 A;  4S1T A;  3F3P C;  3CC2 Z;  3CC7 1;  4A3F I;  3CCE 1;  1ZB8 A;  1VQ4 Z;  3K7A I;  1N8R 1;  3S1R I;  1K8A 1;  1VQ6 Z;  1Z01 A;  2OTL Z;  4A3G I;  2VPZ A;  4MD9 A;  5A2Q f;  5FLX b;  1K73 1;  3F3F C;  1YI2 Z;  1Z03 A;  4DK1 A;  2M6N A;  2Y0S A;  2ZAE B;  3G6E Z;  3CQZ I;  1KC8 2;  3JAM f;  2G2K A;  1YUK A;  2VPX A;  1RO0 A;  1YIT Z;  1S72 Z;  4MD8 A;  3VMI A;  3CCL Z;  4E2W A;  4A3B I;  1Y8C A;  1KRL A;  1QVG Z;  2DE6 A;  3HOY I;  5CM2 M;  4NBC A;  1SIW A;  3J80 f;  1YJN Z;  1K9M 2;  2E7Z A;  2R93 I;  2M48 A;  5C3E I;  1M90 1;  3CCU Z;  2P3Y A;  4NBF A;  2JA5 I;  3CCM Z;  4HGZ A;  3CPW Y;  3J81 b;  1W2B Z;  2GTI A;  1VQ9 1;  3IF8 A;  3S1M I;  4NOZ A;  2NVT I;  1VQ7 Z;  2NVQ I;  3CCL 1;  4NH1 C;  1YUA A;  1VQ5 Z;  1NJI 2;  4E2Y A;  2Q51 A;  4MD7 A;  4MH4 A;  1Y1V I;  3CCJ 1;  3PO3 S;  3EER A;  3NFZ A;  1JWH C;  2NVY I;  3I56 Z;  4NB8 A;  1LQL A;  1YHQ Z;  1QXF A;  3CCQ Z;  3KIF A;  1X0T A;  3S16 I;  3GTK I;  5IP9 I;  2P28 A;  1NUI A;  4E2X A;  2VPW A;  1VQN 1;  2VUG A;  1VQ8 1;  1I50 I;  1YJ9 Z;  2RHB A;  2QRE B;  2JS4 A;  2QRC B;  2JR6 A;  3RZD I;  2QEX Z;  2YAD A;  2NVX I;  1SFO I;  2JIR A;  1R9T I;  5C44 I;  1I6H I;  3CC7 Z;  4Y7N I;  3CCE Z;  1NJI 1;  1YIJ 1;  3GTO I;  2GU2 A;  2K3R A;  3CPW Z;  2HU9 A;  3M4O I;  2YU9 I;  1M1K 2;  2JUB A;  2OOX B;  1USP A;  2W03 A;  2NAP A;  4XX2 A;  4A3E I;  2JIO A;  3Q87 A;  3TDH B;  3GKQ A;  4RVH A;  1Q82 2;  4RV9 A;  4NBA A;  3GTJ I;  2DE7 A;  4DQY B;  4A3J I;  2BJO A;  1TWA I;  3G71 1;  4BBR I;  3CME 1;  3J80 b;  3I4N I;  1NP6 A;  5AN9 F;  1X3W A;  2V3V A;  1VQ9 Z;  2RIQ A;  2WB1 A;  4RVD A;  1N2F A;  3PO2 I;  4NBG A;  2I3C A;  5D1O B;  2RBL A;  1KD1 2;  3D6W A;  4A3D I;  2H85 A;  3OW2 Y;  1WZN A;  4QTU A;  1I3Q I;  3CCJ Z;  4NBE A;  3G4S 1;  1VQP 1;  3BG0 B;  2IZ4 A;  4NBH A;  2JIQ A;  2QLV B;  2IZ3 A;  2PK7 A;  3J7A 4;  1QVF Z;  1WW9 A;  3MZK B;  3HOW I;  1VQN Z;  3CCR 1;  4HGY A;  1VQ8 Z;  4A3C I;  3NH5 A;  1PFT A;  1Y1V S;  3I55 1;  2QA4 1;  2E2J I;  1P9N A;  4MXU A;  1KC8 1;  1Q86 2;  3GCF A;  2E2H I;  2E2I I;  3GTM S;  3TE5 B;  1KD1 1;  2AYD A;  3QWU A;  2F4O A;  1YIJ Z;  1VLA A;  3VB9 A;  1K9M 1;  3CC4 1;  2V8I A;  1Q7Y 2;  2J6A A;  1DL6 A;  1JJ2 Y;  2OTJ 1;  1K83 I;  3RZO I;  2O4H A;  2VUM I;  3FQQ A;  3S14 I;  3PO3 I;  1YJW 1;  2OOY B;  4RVG A;  3I4M I;  3OW2 Z;  1ZH1 A;  2V45 A;  4E30 A;  2R7Z I;  1AA6 A;  3CXC Y;  1RO2 A;  2PMZ A;  2QRD B;  3GTP I;  2PM9 A;  1QVG Y;  1N8R 2;  1K8A 2;  2K5R A;  5IT9 f;  4DGL A;  3G71 Z;  3CME Z;  4E2Z A;  3HOV I;  2DE5 A;  2LEX A;  3MZL B;  1QYP A;  1K73 2;  5D1O A;  4A3K I;  3S15 I;  1KQS Y;  3CMA 1;  1ZB9 A;  2E9H A;  2V8J A;  4HH4 A;  2JMO A;  2IV2 X;  5A2Q b;  3ESW A;  1Z02 A;  5D1P A;  1S7M A;  1VQK 1;  3CD6 1;  5LL6 f;  2QKD A;  4E31 A;  3JAM b;  2JA8 I;  2JIP A;  2V8K A;  3HOX I;  3HOZ I;  4BY7 I;  3G4S Z;  1VQP Z;  3HKZ A;  1L1O C;  1M90 2;  3GTG I;  3CCV 1;  1TWG I;  3CCS 1;  1VQL 1;  4CL1 A;  1RO4 A;  4MON A;  2RPR A;  2LIY A;  1JJ2 Z;  2OZK A;  4TNU A;  3HOU I;  3S1Q I;  3CCR Z;  2Q4Z A;  2KI7 B;  3GTL I;  4A93 I;  1M1K 1;  4MRI A;  3I55 Z;  2QA4 Z;  3NH4 A;  3H0G I;  1VQO 1;  5C4X I;  1RNI A;  2EGT A;  2O53 A;  3CXC Z;  3VMG A;  2GTH A;  3NH8 A;  3I07 A;  1Q82 1;  3D9X A;  1VQM 1;  5FLX f;  1USP B;  2W04 A;  3CC2 1;  3CC4 Z;  4QTT A;  3VMH A;  2HF1 A;  1VQ4 1;  2LFU A;  1WCM I;  1Q81 2;  2OTJ Z;  1VQ6 1;  2F4M A;  3LUS A;  2AKL A;  5C4J I;  4A3L I;  1Q16 A;  2OTL 1;  1YJW Z;  1KQS Z;  1YI2 1;  1TWH I;  3G6E 1;  3KIH A;  5FLM I;  3S2D I;  1YIT 1;  1S72 1;  3NDJ A;  3NDI A;  3VTN A;  3J81 f;  3H3V J;  4NBB A;  2VPY A;  1YJN 1;  4NFR A;  3EED A;  3BG1 B;  1FDO A;  2JNY A;  3S1N I;  3D2L A;  2RT9 A;  3CCU 1;  4E32 A;  3GTM I;  3CCM 1;  3U50 C;  4EWC A;  1WJ2 A;  3CMA Z;  3IX0 A;  1RLY A;  2R6M A;  2JA7 I;  5IT9 b;  4BXX I;  1VQ7 1;  1WII A;  1Q81 1;  1VQK Z;  3CD6 Z;  4Y52 I;  1TWC I;  1QF8 A;  1VQ5 1;  2B63 I;  5T64 A;  2KPI A;  1Q86 1;  1FDI A;  3M3Y I;  3CCV Z;  3CCS Z; 
#chains in the Genus database with same CATH homology
 1VQL Z;  5T6B A;  1TWF I;  3P5J B;  2R92 I;  3I56 1;  4A3I I;  4RVF A;  3IFU A;  2JA6 I;  4AYB A;  3S2H I;  1TFI A;  1YHQ 1;  3CCQ 1;  1Y1W I;  3T4N B;  1Q7Y 1;  4E33 A;  1W2B Y;  3GTQ I;  1QVF Y;  4BBS I;  2QR1 B;  3S17 I;  5IP7 I;  4NB9 A;  1YJ9 1;  1VQO Z;  5T67 A;  4A3M I;  2QEX 1;  2WAQ A;  4BY1 I;  3FQM A;  2VF1 A;  4X6A I;  3FKI I;  1X3Z A;  4NBD A;  1RQF A;  3MON A;  4RS4 A;  1VQM Z;  1ML8 A;  4S1T A;  3F3P C;  3CC2 Z;  3CC7 1;  4A3F I;  3CCE 1;  1ZB8 A;  1VQ4 Z;  3K7A I;  1N8R 1;  3S1R I;  1K8A 1;  1VQ6 Z;  1Z01 A;  2OTL Z;  4A3G I;  4MD9 A;  5A2Q f;  5FLX b;  1K73 1;  3F3F C;  1YI2 Z;  1Z03 A;  4DK1 A;  2M6N A;  2Y0S A;  2ZAE B;  3G6E Z;  3CQZ I;  1KC8 2;  3JAM f;  2G2K A;  1YUK A;  1RO0 A;  1YIT Z;  1S72 Z;  4MD8 A;  3VMI A;  3CCL Z;  4E2W A;  4A3B I;  1KRL A;  1QVG Z;  2DE6 A;  3HOY I;  5CM2 M;  4NBC A;  3J80 f;  1YJN Z;  1K9M 2;  2R93 I;  2M48 A;  5C3E I;  1M90 1;  3CCU Z;  2P3Y A;  4NBF A;  2JA5 I;  3CCM Z;  4HGZ A;  3CPW Y;  3J81 b;  1W2B Z;  2GTI A;  1VQ9 1;  3IF8 A;  3S1M I;  4NOZ A;  2NVT I;  1VQ7 Z;  2NVQ I;  3CCL 1;  4NH1 C;  1YUA A;  1VQ5 Z;  1NJI 2;  4E2Y A;  2Q51 A;  4MD7 A;  4MH4 A;  1Y1V I;  3CCJ 1;  3PO3 S;  3EER A;  3NFZ A;  1JWH C;  2NVY I;  3I56 Z;  4NB8 A;  1LQL A;  1YHQ Z;  3CCQ Z;  3KIF A;  1X0T A;  3S16 I;  3GTK I;  5IP9 I;  2P28 A;  1NUI A;  4E2X A;  1VQN 1;  2VUG A;  1VQ8 1;  1I50 I;  1YJ9 Z;  2RHB A;  2QRE B;  2JS4 A;  2QRC B;  2JR6 A;  3RZD I;  2QEX Z;  2YAD A;  2NVX I;  1SFO I;  1R9T I;  5C44 I;  1I6H I;  3CC7 Z;  4Y7N I;  3CCE Z;  1NJI 1;  1YIJ 1;  3GTO I;  2GU2 A;  2K3R A;  3CPW Z;  2HU9 A;  3M4O I;  2YU9 I;  1M1K 2;  2JUB A;  2OOX B;  1USP A;  2W03 A;  4XX2 A;  4A3E I;  3Q87 A;  3TDH B;  3GKQ A;  4RVH A;  1Q82 2;  4RV9 A;  4NBA A;  3GTJ I;  2DE7 A;  4DQY B;  4A3J I;  2BJO A;  1TWA I;  3G71 1;  4BBR I;  3CME 1;  3J80 b;  3I4N I;  1NP6 A;  5AN9 F;  1X3W A;  1VQ9 Z;  2RIQ A;  2WB1 A;  4RVD A;  1N2F A;  3PO2 I;  4NBG A;  2I3C A;  5D1O B;  2RBL A;  1KD1 2;  3D6W A;  4A3D I;  2H85 A;  3OW2 Y;  4QTU A;  1I3Q I;  3CCJ Z;  4NBE A;  3G4S 1;  1VQP 1;  3BG0 B;  2IZ4 A;  4NBH A;  2QLV B;  2IZ3 A;  2PK7 A;  3J7A 4;  1QVF Z;  1WW9 A;  3MZK B;  3HOW I;  1VQN Z;  3CCR 1;  4HGY A;  1VQ8 Z;  4A3C I;  3NH5 A;  1PFT A;  1Y1V S;  3I55 1;  2QA4 1;  2E2J I;  1P9N A;  4MXU A;  1KC8 1;  1Q86 2;  3GCF A;  2E2H I;  2E2I I;  3GTM S;  3TE5 B;  1KD1 1;  3QWU A;  2F4O A;  1YIJ Z;  1VLA A;  3VB9 A;  1K9M 1;  3CC4 1;  2V8I A;  1Q7Y 2;  2J6A A;  1DL6 A;  1JJ2 Y;  2OTJ 1;  1K83 I;  3RZO I;  2O4H A;  2VUM I;  3FQQ A;  3S14 I;  3PO3 I;  1YJW 1;  2OOY B;  4RVG A;  3I4M I;  3OW2 Z;  1ZH1 A;  4E30 A;  2R7Z I;  3CXC Y;  1RO2 A;  2PMZ A;  2QRD B;  3GTP I;  2PM9 A;  1QVG Y;  1N8R 2;  1K8A 2;  2K5R A;  5IT9 f;  4DGL A;  3G71 Z;  3CME Z;  4E2Z A;  3HOV I;  2DE5 A;  3MZL B;  1QYP A;  1K73 2;  5D1O A;  4A3K I;  3S15 I;  1KQS Y;  3CMA 1;  1ZB9 A;  2E9H A;  2V8J A;  4HH4 A;  2JMO A;  5A2Q b;  3ESW A;  1Z02 A;  5D1P A;  1S7M A;  1VQK 1;  3CD6 1;  5LL6 f;  2QKD A;  4E31 A;  3JAM b;  2JA8 I;  2V8K A;  3HOX I;  3HOZ I;  4BY7 I;  3G4S Z;  1VQP Z;  3HKZ A;  1L1O C;  1M90 2;  3GTG I;  3CCV 1;  1TWG I;  3CCS 1;  1VQL 1;  4CL1 A;  1RO4 A;  4MON A;  2RPR A;  2LIY A;  1JJ2 Z;  2OZK A;  4TNU A;  3HOU I;  3S1Q I;  3CCR Z;  2Q4Z A;  2KI7 B;  3GTL I;  4A93 I;  1M1K 1;  4MRI A;  3I55 Z;  2QA4 Z;  3NH4 A;  3H0G I;  1VQO 1;  5C4X I;  1RNI A;  2EGT A;  2O53 A;  3CXC Z;  3VMG A;  2GTH A;  3NH8 A;  3I07 A;  1Q82 1;  3D9X A;  1VQM 1;  5FLX f;  1USP B;  2W04 A;  3CC2 1;  3CC4 Z;  4QTT A;  3VMH A;  2HF1 A;  1VQ4 1;  2LFU A;  1WCM I;  1Q81 2;  2OTJ Z;  1VQ6 1;  2F4M A;  3LUS A;  2AKL A;  5C4J I;  4A3L I;  2OTL 1;  1YJW Z;  1KQS Z;  1YI2 1;  1TWH I;  3G6E 1;  3KIH A;  5FLM I;  3S2D I;  1YIT 1;  1S72 1;  3NDJ A;  3NDI A;  3VTN A;  3J81 f;  3H3V J;  4NBB A;  1YJN 1;  4NFR A;  3EED A;  3BG1 B;  2JNY A;  3S1N I;  2RT9 A;  3CCU 1;  4E32 A;  3GTM I;  3CCM 1;  3U50 C;  4EWC A;  3CMA Z;  3IX0 A;  1RLY A;  2R6M A;  2JA7 I;  5IT9 b;  4BXX I;  1VQ7 1;  1WII A;  1Q81 1;  1VQK Z;  3CD6 Z;  4Y52 I;  1TWC I;  1QF8 A;  1VQ5 1;  2B63 I;  5T64 A;  2KPI A;  1Q86 1;  3M3Y I;  3CCV Z;  3CCS Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...