4Y7NI

The structure insight into 5-carboxycytosine recognition by rna polymerase ii during transcription elongation.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
119
structure length
119
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis for 5-carboxycytosine recognition by RNA polymerase II elongation complex.
pubmed doi rcsb
molecule tags Transcription/dna/rna
total genus 11
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2015-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4y7nI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4y7nI02
1TFIA 1L1OC 4Y7NI 3H0GI 3LUSA 4NB9A 2KPIA 3GTOI 3HOVI 3S17I 2JR6A 5C4JI 4NOZA 3ESWA 4NBHA 2JA8I 3S14I 2HF1A 3HOUI 1QYPA 4BY1I 3RZOI 2E2JI 2VUMI 3GTPI 4A3BI 2JA7I 4BY7I 4X6AI 1TWGI 3S2DI 1R9TI 1ZB9A 1TWHI 1X3WA 3U50C 4NBAA 2AKLA 3S1QI 1PFTA 1USPB 3GTGI 3GTLI 1I6HI 2BJOA 3HOWI 3D6WA 3S1RI 1ML8A 4A3GI 4NB8A 1SFOI 2DE5A 2NVYI 3HOXI 4A3FI 4BBSI 5C4XI 4A3EI 4A3MI 1I50I 2F4MA 3Q87A 2JA6I 3VB9A 3HOYI 3S16I 1Y1WI 2YU9I 2DE6A 4NBEA 3RZDI 4A3DI 3I07A 2B63I 4A3II 4NBFA 3H3VJ 4NBDA 3FKII 4NBGA 1WW9A 3I4NI 5C44I 5IP7I 1X3ZA 2E2II 4QTTA 1TWAI 3GTKI 3GKQA 3PO2I 4NBBA 1ZB8A 1WCMI 2NVQI 2JS4A 1N2FA 3CQZI 2JA5I 2E2HI 2RBLA 3GTMS 3S15I 2P3YA 5IP9I 3M4OI 3M3YI 1Y1VS 1TWCI 3K7AI 4Y52I 5FLMI 4NBCA 4A3CI 2K5RA 4QTUA 2NVTI 3VMGA 1RO4A 4MH4A 1DL6A 1VLAA 4XX2A 3GTQI 3HOZI 1K83I 3GCFA 3GTJI 3PO3S 1LQLA 3GTMI 5C3EI 1Y1VI 2PK7A 2NVXI 4A93I 1NUIA 3S1MI 4BBRI 1TWFI 3S1NI 1RLYA 1USPA 2F4OA 2R93I 1I3QI 4A3JI 4A3LI 4A3KI 3I4MI 3VMHA 2R7ZI 4BXXI 2J6AA 2R92I 3EERA 3PO3I 2JNYA 2DE7A 5CM2M 3S2HI 3VMIA 1YUAA
chains in the Genus database with same CATH superfamily
3G4S1 3CCRZ 3H0GI 1N8R2 1Q861 4MD8A 5A2Qf 1Z03A 4NBHA 2JA8I 1VQM1 1VQ71 2JIQA 3HOUI 3CCEZ 3J7A4 2JA7I 1YHQZ 4BY7I 4X6AI 1ZB9A 3U50C 2AKLA 2PM9A 1USPB 2VPZA 2V3VA 3NH5A 2JIOA 3MZLB 2QRCB 3D6WA 1SFOI 2NVYI 4A3FI 4A3MI 3VB9A 3NH4A 3CD6Z 1VQ91 1Z01A 4RVHA 1RO0A 2DE6A 4RVFA 1M1K2 3CMEZ 4A3DI 1KC82 3I07A 3BG1B 4A3II 5D1OA 5A2Qb 2IZ3A 4S1TA 3CCQZ 3CCS1 1WW9A 1VQ41 3IR7A 5C44I 1NJI2 1QVGY 2E2II 1TWAI 1Q7Y2 1KD12 3PO2I 1ZB8A 4E2WA 1VQNZ 3CQZI 3CC41 3D2LA 2JIMA 2E2HI 2GTIA 4DGLA 3CCMZ 2RBLA 5IP9I 2VPXA 3CCL1 4Y52I 1M1K1 4NBCA 2WAQA 1KC81 4A3CI 5IT9b 1DL6A 4RVDA 1VLAA 3HOZI 1K83I 3GCFA 3EEDA 1NJI1 5T64A 3T4NB 4E32A 5C3EI 1RQFA 1Y1VI 2NVXI 1Q7Y1 2RPRA 1KD11 2JUBA 3S1NI 1YI21 2QR1B 2WB1A 3CC71 4MXUA 3PO3I 5CM2M 1VQ81 2LIYA 3VMIA 1VQPZ 3KIHA 4TNUA 2OTL1 2KPIA 2VPYA 5C4JI 3F3PC 3ESWA 4HGZA 4E30A 4EWCA 1SIWA 1VQ6Z 1YJW1 3CPWZ 1M901 2QEX1 2VUMI 1KQSY 1X0TA 3CCV1 4MD9A 1TWGI 2V8IA 4NBAA 5LL6f 1VQ5Z 2M48A 4MD7A 3GTGI 2VF1A 1JWHC 3MZKB 3G4SZ 1S721 1Q812 3S1RI 2JIPA 4A3GI 4NB8A 2OTJ1 3HOXI 1I50I 3HOYI 3S16I 1VQMZ 2QA41 1ZH1A 1VQ7Z 2NAPA 3IF8A 4NBFA 3FKII 4NBGA 5D1PA 3CCJZ 4E2ZA 2P28A 5IP7I 4QTTA 2ZAEB 3CCUZ 3FQQA 1JJ2Y 3IX0A 1Q811 1S7MA 2JS4A 5IT9f 1YHQ1 2JA5I 2P3YA 1Y1VS 1RO2A 1QXFA 2Q51A 3IFUA 3CC2Z 2E9HA 1YIJ1 1KQSZ 3VMGA 1RO4A 3P5JB 2IV2X 4MH4A 1VQK1 3CCSZ 3GTQI 1Z02A 3PO3S 3CPWY 5D1OB 4RS4A 4MONA 2PK7A 2QKDA 3S1MI 1P9NA 1YJ91 4A3JI 3I56Z 2RT9A 2O4HA 3CC4Z 3CCQ1 4BXXI 2KI7B 3CMA1 3D9XA 2JNYA 1TFIA 4Y7NI 1NP6A 1VQOZ 4NB9A 3S17I 3GTOI 1Y8CA 2VUGA 3HOVI 1WJ2A 2JR6A 4DQYB 5FLXf 3CCM1 2GU2A 2RIQA 3HKZA 4E2YA 2QLVB 3NFZA 2HF1A 1M902 1QYPA 3RZOI 1JJ2Z 1QVFY 4RV9A 2H85A 4A3BI 5AN9F 4RVGA 1TWHI 1X3WA 3S1QI 2QRDB 5T6BA 1VQL1 4MRIA 1I6HI 4CL1A 1VQ8Z 2OTLZ 2LEXA 2DE5A 2GTHA 4BBSI 5C4XI 4A3EI 2F4MA 1Q16A 2JA6I 1WZNA 1WIIA 1Y1WI 2YU9I 4NBEA 1YJN1 3I551 2Y0SA 2JIRA 3RZDI 2OZKA 3G6E1 1VQP1 2LFUA 2QEXZ 5FLXb 3CXCZ 3G711 1QF8A 2IZ4A 2W04A 4NFRA 1X3ZA 1VQ61 3GTKI 3GKQA 4NBBA 4AYBA 2W03A 2M6NA 2K3RA 1YIT1 1S72Z 2NVQI 2OTJZ 2QREB 3S15I 1W2BZ 1VQ51 3M4OI 3VTNA 2QA4Z 1K8A2 3K7AI 3CCR1 5FLMI 3J80b 1QVFZ 2K5RA 3NH8A 2NVTI 2G2KA 1YUKA 2V8JA 3GTJI 3GTMI 4E31A 3JAMf 3CCE1 2RHBA 1USPA 2F4OA 1I3QI 4A3LI 4A3KI 3I4MI 2R7ZI 3CCJ1 1VQ9Z 3EERA 1K8A1 2AYDA 1YUAA 3CCU1 1L1OC 1YIJZ 3LUSA 2HU9A 3NDJA 3OW2Z 1N8R1 1VQ4Z 1K732 4NOZA 2OOYB 1VQKZ 3CD61 3S14I 4E33A 4HGYA 3CME1 3CC21 4BY1I 2V8KA 2E2JI 3GTPI 3CXCY 1Q822 1YJ9Z 3S2DI 1K9M2 1R9TI 4HH4A 3NDIA 3JAMb 3CMAZ 1PFTA 3GTLI 2BJOA 3CCLZ 3HOWI 1VQN1 1RNIA 1ML8A 2I3CA 3KIFA 1K731 3FQMA 3I561 1W2BY 3Q87A 3BG0B 2PMZA 4NH1C 2O53A 1VQO1 1YI2Z 2B63I 1Q821 4NBDA 3H3VJ 3J81f 1KRLA 4DK1A 1K9M1 3I4NI 3CC7Z 1VQLZ 2EGTA 3J80f 1WCMI 1N2FA 3TDHB 2R6MA 5T67A 3GTMS 2JMOA 3QWUA 3M3YI 1AA6A 1YJWZ 1TWCI 3MONA 3OW2Y 1YJNZ 3I55Z 3G6EZ 4QTUA 3CCVZ 1Q862 3F3FC 4XX2A 3G71Z 1FDIA 1LQLA 4E2XA 4A93I 1NUIA 1QVGZ 2OOXB 2YADA 4BBRI 1TWFI 1RLYA 2R93I 2E7ZA 3J81b 1YITZ 2Q4ZA 3VMHA 2J6AA 1FDOA 2VPWA 3TE5B 2R92I 2DE7A 2V45A 3S2HI
chains in the Genus database with same CATH topology
3G4S1 3CCRZ 3H0GI 1N8R2 1Q861 4MD8A 5A2Qf 1Z03A 4NBHA 2JA8I 1VQM1 1VQ71 3HOUI 3CCEZ 3J7A4 2JA7I 1YHQZ 4BY7I 4X6AI 1ZB9A 3U50C 2AKLA 2PM9A 1USPB 3NH5A 3MZLB 2QRCB 3D6WA 1SFOI 2NVYI 4A3FI 4A3MI 3VB9A 3NH4A 3CD6Z 1VQ91 1Z01A 4RVHA 1RO0A 2DE6A 4RVFA 1M1K2 3CMEZ 4A3DI 1KC82 3I07A 3BG1B 4A3II 5D1OA 5A2Qb 2IZ3A 4S1TA 3CCQZ 3CCS1 1WW9A 1VQ41 5C44I 1NJI2 1QVGY 2E2II 1TWAI 1Q7Y2 1KD12 3PO2I 1ZB8A 4E2WA 1VQNZ 3CQZI 3CC41 2E2HI 2GTIA 4DGLA 3CCMZ 2RBLA 5IP9I 3CCL1 4Y52I 1M1K1 4NBCA 2WAQA 1KC81 4A3CI 5IT9b 1DL6A 4RVDA 1VLAA 3HOZI 1K83I 3GCFA 3EEDA 1NJI1 5T64A 3T4NB 4E32A 5C3EI 1RQFA 1Y1VI 2NVXI 1Q7Y1 2RPRA 1KD11 2JUBA 3S1NI 1YI21 2QR1B 2WB1A 3CC71 4MXUA 3PO3I 5CM2M 1VQ81 2LIYA 3VMIA 1VQPZ 3KIHA 4TNUA 2OTL1 2KPIA 5C4JI 3F3PC 3ESWA 4HGZA 4E30A 4EWCA 1VQ6Z 1YJW1 3CPWZ 1M901 2QEX1 2VUMI 1KQSY 1X0TA 3CCV1 4MD9A 1TWGI 2V8IA 4NBAA 5LL6f 1VQ5Z 2M48A 4MD7A 3GTGI 2VF1A 1JWHC 3MZKB 3G4SZ 1S721 1Q812 3S1RI 4A3GI 4NB8A 2OTJ1 3HOXI 1I50I 3HOYI 3S16I 1VQMZ 2QA41 1ZH1A 1VQ7Z 3IF8A 4NBFA 3FKII 4NBGA 5D1PA 3CCJZ 4E2ZA 2P28A 5IP7I 4QTTA 2ZAEB 3CCUZ 3FQQA 1JJ2Y 3IX0A 1Q811 1S7MA 2JS4A 5IT9f 1YHQ1 2JA5I 2P3YA 1Y1VS 1RO2A 2Q51A 3IFUA 3CC2Z 2E9HA 1YIJ1 1KQSZ 3VMGA 1RO4A 3P5JB 4MH4A 1VQK1 3CCSZ 3GTQI 1Z02A 3PO3S 3CPWY 5D1OB 4RS4A 4MONA 2PK7A 2QKDA 3S1MI 1P9NA 1YJ91 4A3JI 3I56Z 2RT9A 2O4HA 3CC4Z 3CCQ1 4BXXI 2KI7B 3CMA1 3D9XA 2JNYA 1TFIA 4Y7NI 1NP6A 1VQOZ 4NB9A 3S17I 3GTOI 2VUGA 3HOVI 2JR6A 4DQYB 5FLXf 3CCM1 2GU2A 2RIQA 3HKZA 4E2YA 2QLVB 3NFZA 2HF1A 1M902 1QYPA 3RZOI 1JJ2Z 1QVFY 4RV9A 2H85A 4A3BI 5AN9F 4RVGA 1TWHI 1X3WA 3S1QI 2QRDB 5T6BA 1VQL1 4MRIA 1I6HI 4CL1A 1VQ8Z 2OTLZ 2DE5A 2GTHA 4BBSI 5C4XI 4A3EI 2F4MA 2JA6I 1WIIA 1Y1WI 2YU9I 4NBEA 1YJN1 3I551 2Y0SA 3RZDI 1VQP1 2OZKA 3G6E1 2LFUA 2QEXZ 5FLXb 3CXCZ 3G711 1QF8A 2IZ4A 2W04A 4NFRA 1X3ZA 1VQ61 3GTKI 3GKQA 4NBBA 4AYBA 2W03A 2M6NA 2K3RA 1YIT1 1S72Z 2NVQI 2OTJZ 2QREB 3S15I 1W2BZ 1VQ51 3M4OI 3VTNA 2QA4Z 1K8A2 3K7AI 3CCR1 5FLMI 3J80b 1QVFZ 2K5RA 3NH8A 2NVTI 2G2KA 1YUKA 2V8JA 3GTJI 3GTMI 4E31A 3JAMf 3CCE1 2RHBA 1USPA 2F4OA 1I3QI 4A3LI 4A3KI 3I4MI 2R7ZI 3CCJ1 1VQ9Z 3EERA 1K8A1 1YUAA 3CCU1 1L1OC 1YIJZ 3LUSA 2HU9A 3NDJA 3OW2Z 1N8R1 1VQ4Z 1K732 4NOZA 2OOYB 1VQKZ 3CD61 3S14I 4E33A 4HGYA 3CME1 3CC21 4BY1I 2V8KA 2E2JI 3GTPI 3CXCY 1Q822 1YJ9Z 3S2DI 1K9M2 1R9TI 4HH4A 3NDIA 3JAMb 3CMAZ 1PFTA 3GTLI 2BJOA 3CCLZ 3HOWI 1VQN1 1RNIA 1ML8A 2I3CA 3KIFA 1K731 3FQMA 3I561 1W2BY 3Q87A 3BG0B 2PMZA 4NH1C 2O53A 1VQO1 1YI2Z 2B63I 1Q821 4NBDA 3H3VJ 3J81f 1KRLA 4DK1A 1K9M1 3I4NI 3CC7Z 1VQLZ 2EGTA 3J80f 1WCMI 1N2FA 3TDHB 2R6MA 5T67A 3GTMS 2JMOA 3QWUA 3M3YI 1YJWZ 1TWCI 3MONA 3OW2Y 1YJNZ 3I55Z 3G6EZ 4QTUA 3CCVZ 1Q862 3F3FC 4XX2A 3G71Z 1LQLA 4E2XA 4A93I 1NUIA 1QVGZ 2OOXB 2YADA 4BBRI 1TWFI 1RLYA 2R93I 3J81b 1YITZ 2Q4ZA 3VMHA 2J6AA 3TE5B 2R92I 2DE7A 3S2HI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TFI A;  1L1O C;  4Y7N I;  3H0G I;  3LUS A;  4NB9 A;  2KPI A;  3GTO I;  3HOV I;  3S17 I;  2JR6 A;  5C4J I;  4NOZ A;  3ESW A;  4NBH A;  2JA8 I;  3S14 I;  2HF1 A;  3HOU I;  1QYP A;  4BY1 I;  3RZO I;  2E2J I;  2VUM I;  3GTP I;  4A3B I;  2JA7 I;  4BY7 I;  4X6A I;  1TWG I;  3S2D I;  1R9T I;  1ZB9 A;  1TWH I;  1X3W A;  3U50 C;  4NBA A;  2AKL A;  3S1Q I;  1PFT A;  1USP B;  3GTG I;  3GTL I;  1I6H I;  2BJO A;  3HOW I;  3D6W A;  3S1R I;  1ML8 A;  4A3G I;  4NB8 A;  1SFO I;  2DE5 A;  2NVY I;  3HOX I;  4A3F I;  4BBS I;  5C4X I;  4A3E I;  4A3M I;  1I50 I;  2F4M A;  3Q87 A;  2JA6 I;  3VB9 A;  3HOY I;  3S16 I;  1Y1W I;  2YU9 I;  2DE6 A;  4NBE A;  3RZD I;  4A3D I;  3I07 A;  2B63 I;  4A3I I;  4NBF A;  3H3V J;  4NBD A;  3FKI I;  4NBG A;  1WW9 A;  3I4N I;  5C44 I;  5IP7 I;  1X3Z A;  2E2I I;  4QTT A;  1TWA I;  3GTK I;  3GKQ A;  3PO2 I;  4NBB A;  1ZB8 A;  1WCM I;  2NVQ I;  2JS4 A;  1N2F A;  3CQZ I;  2JA5 I;  2E2H I;  2RBL A;  3GTM S;  3S15 I;  2P3Y A;  5IP9 I;  3M4O I;  3M3Y I;  1Y1V S;  1TWC I;  3K7A I;  4Y52 I;  5FLM I;  4NBC A;  4A3C I;  2K5R A;  4QTU A;  2NVT I;  3VMG A;  1RO4 A;  4MH4 A;  1DL6 A;  1VLA A;  4XX2 A;  3GTQ I;  3HOZ I;  1K83 I;  3GCF A;  3GTJ I;  3PO3 S;  1LQL A;  3GTM I;  5C3E I;  1Y1V I;  2PK7 A;  2NVX I;  4A93 I;  1NUI A;  3S1M I;  4BBR I;  1TWF I;  3S1N I;  1RLY A;  1USP A;  2F4O A;  2R93 I;  1I3Q I;  4A3J I;  4A3L I;  4A3K I;  3I4M I;  3VMH A;  2R7Z I;  4BXX I;  2J6A A;  2R92 I;  3EER A;  3PO3 I;  2JNY A;  2DE7 A;  5CM2 M;  3S2H I;  3VMI A;  1YUA A; 
#chains in the Genus database with same CATH topology
 3G4S 1;  3CCR Z;  3H0G I;  1N8R 2;  1Q86 1;  4MD8 A;  5A2Q f;  1Z03 A;  4NBH A;  2JA8 I;  1VQM 1;  1VQ7 1;  2JIQ A;  3HOU I;  3CCE Z;  3J7A 4;  2JA7 I;  1YHQ Z;  4BY7 I;  4X6A I;  1ZB9 A;  3U50 C;  2AKL A;  2PM9 A;  1USP B;  2VPZ A;  2V3V A;  3NH5 A;  2JIO A;  3MZL B;  2QRC B;  3D6W A;  1SFO I;  2NVY I;  4A3F I;  4A3M I;  3VB9 A;  3NH4 A;  3CD6 Z;  1VQ9 1;  1Z01 A;  4RVH A;  1RO0 A;  2DE6 A;  4RVF A;  1M1K 2;  3CME Z;  4A3D I;  1KC8 2;  3I07 A;  3BG1 B;  4A3I I;  5D1O A;  5A2Q b;  2IZ3 A;  4S1T A;  3CCQ Z;  3CCS 1;  1WW9 A;  1VQ4 1;  3IR7 A;  5C44 I;  1NJI 2;  1QVG Y;  2E2I I;  1TWA I;  1Q7Y 2;  1KD1 2;  3PO2 I;  1ZB8 A;  4E2W A;  1VQN Z;  3CQZ I;  3CC4 1;  3D2L A;  2JIM A;  2E2H I;  2GTI A;  4DGL A;  3CCM Z;  2RBL A;  5IP9 I;  2VPX A;  3CCL 1;  4Y52 I;  1M1K 1;  4NBC A;  2WAQ A;  1KC8 1;  4A3C I;  5IT9 b;  1DL6 A;  4RVD A;  1VLA A;  3HOZ I;  1K83 I;  3GCF A;  3EED A;  1NJI 1;  5T64 A;  3T4N B;  4E32 A;  5C3E I;  1RQF A;  1Y1V I;  2NVX I;  1Q7Y 1;  2RPR A;  1KD1 1;  2JUB A;  3S1N I;  1YI2 1;  2QR1 B;  2WB1 A;  3CC7 1;  4MXU A;  3PO3 I;  5CM2 M;  1VQ8 1;  2LIY A;  3VMI A;  1VQP Z;  3KIH A;  4TNU A;  2OTL 1;  2KPI A;  2VPY A;  5C4J I;  3F3P C;  3ESW A;  4HGZ A;  4E30 A;  4EWC A;  1SIW A;  1VQ6 Z;  1YJW 1;  3CPW Z;  1M90 1;  2QEX 1;  2VUM I;  1KQS Y;  1X0T A;  3CCV 1;  4MD9 A;  1TWG I;  2V8I A;  4NBA A;  5LL6 f;  1VQ5 Z;  2M48 A;  4MD7 A;  3GTG I;  2VF1 A;  1JWH C;  3MZK B;  3G4S Z;  1S72 1;  1Q81 2;  3S1R I;  2JIP A;  4A3G I;  4NB8 A;  2OTJ 1;  3HOX I;  1I50 I;  3HOY I;  3S16 I;  1VQM Z;  2QA4 1;  1ZH1 A;  1VQ7 Z;  2NAP A;  3IF8 A;  4NBF A;  3FKI I;  4NBG A;  5D1P A;  3CCJ Z;  4E2Z A;  2P28 A;  5IP7 I;  4QTT A;  2ZAE B;  3CCU Z;  3FQQ A;  1JJ2 Y;  3IX0 A;  1Q81 1;  1S7M A;  2JS4 A;  5IT9 f;  1YHQ 1;  2JA5 I;  2P3Y A;  1Y1V S;  1RO2 A;  1QXF A;  2Q51 A;  3IFU A;  3CC2 Z;  2E9H A;  1YIJ 1;  1KQS Z;  3VMG A;  1RO4 A;  3P5J B;  2IV2 X;  4MH4 A;  1VQK 1;  3CCS Z;  3GTQ I;  1Z02 A;  3PO3 S;  3CPW Y;  5D1O B;  4RS4 A;  4MON A;  2PK7 A;  2QKD A;  3S1M I;  1P9N A;  1YJ9 1;  4A3J I;  3I56 Z;  2RT9 A;  2O4H A;  3CC4 Z;  3CCQ 1;  4BXX I;  2KI7 B;  3CMA 1;  3D9X A;  2JNY A;  1TFI A;  4Y7N I;  1NP6 A;  1VQO Z;  4NB9 A;  3S17 I;  3GTO I;  1Y8C A;  2VUG A;  3HOV I;  1WJ2 A;  2JR6 A;  4DQY B;  5FLX f;  3CCM 1;  2GU2 A;  2RIQ A;  3HKZ A;  4E2Y A;  2QLV B;  3NFZ A;  2HF1 A;  1M90 2;  1QYP A;  3RZO I;  1JJ2 Z;  1QVF Y;  4RV9 A;  2H85 A;  4A3B I;  5AN9 F;  4RVG A;  1TWH I;  1X3W A;  3S1Q I;  2QRD B;  5T6B A;  1VQL 1;  4MRI A;  1I6H I;  4CL1 A;  1VQ8 Z;  2OTL Z;  2LEX A;  2DE5 A;  2GTH A;  4BBS I;  5C4X I;  4A3E I;  2F4M A;  1Q16 A;  2JA6 I;  1WZN A;  1WII A;  1Y1W I;  2YU9 I;  4NBE A;  1YJN 1;  3I55 1;  2Y0S A;  2JIR A;  3RZD I;  2OZK A;  3G6E 1;  1VQP 1;  2LFU A;  2QEX Z;  5FLX b;  3CXC Z;  3G71 1;  1QF8 A;  2IZ4 A;  2W04 A;  4NFR A;  1X3Z A;  1VQ6 1;  3GTK I;  3GKQ A;  4NBB A;  4AYB A;  2W03 A;  2M6N A;  2K3R A;  1YIT 1;  1S72 Z;  2NVQ I;  2OTJ Z;  2QRE B;  3S15 I;  1W2B Z;  1VQ5 1;  3M4O I;  3VTN A;  2QA4 Z;  1K8A 2;  3K7A I;  3CCR 1;  5FLM I;  3J80 b;  1QVF Z;  2K5R A;  3NH8 A;  2NVT I;  2G2K A;  1YUK A;  2V8J A;  3GTJ I;  3GTM I;  4E31 A;  3JAM f;  3CCE 1;  2RHB A;  1USP A;  2F4O A;  1I3Q I;  4A3L I;  4A3K I;  3I4M I;  2R7Z I;  3CCJ 1;  1VQ9 Z;  3EER A;  1K8A 1;  2AYD A;  1YUA A;  3CCU 1;  1L1O C;  1YIJ Z;  3LUS A;  2HU9 A;  3NDJ A;  3OW2 Z;  1N8R 1;  1VQ4 Z;  1K73 2;  4NOZ A;  2OOY B;  1VQK Z;  3CD6 1;  3S14 I;  4E33 A;  4HGY A;  3CME 1;  3CC2 1;  4BY1 I;  2V8K A;  2E2J I;  3GTP I;  3CXC Y;  1Q82 2;  1YJ9 Z;  3S2D I;  1K9M 2;  1R9T I;  4HH4 A;  3NDI A;  3JAM b;  3CMA Z;  1PFT A;  3GTL I;  2BJO A;  3CCL Z;  3HOW I;  1VQN 1;  1RNI A;  1ML8 A;  2I3C A;  3KIF A;  1K73 1;  3FQM A;  3I56 1;  1W2B Y;  3Q87 A;  3BG0 B;  2PMZ A;  4NH1 C;  2O53 A;  1VQO 1;  1YI2 Z;  2B63 I;  1Q82 1;  4NBD A;  3H3V J;  3J81 f;  1KRL A;  4DK1 A;  1K9M 1;  3I4N I;  3CC7 Z;  1VQL Z;  2EGT A;  3J80 f;  1WCM I;  1N2F A;  3TDH B;  2R6M A;  5T67 A;  3GTM S;  2JMO A;  3QWU A;  3M3Y I;  1AA6 A;  1YJW Z;  1TWC I;  3MON A;  3OW2 Y;  1YJN Z;  3I55 Z;  3G6E Z;  4QTU A;  3CCV Z;  1Q86 2;  3F3F C;  4XX2 A;  3G71 Z;  1FDI A;  1LQL A;  4E2X A;  4A93 I;  1NUI A;  1QVG Z;  2OOX B;  2YAD A;  4BBR I;  1TWF I;  1RLY A;  2R93 I;  2E7Z A;  3J81 b;  1YIT Z;  2Q4Z A;  3VMH A;  2J6A A;  1FDO A;  2VPW A;  3TE5 B;  2R92 I;  2DE7 A;  2V45 A;  3S2H I; 
#chains in the Genus database with same CATH homology
 3G4S 1;  3CCR Z;  3H0G I;  1N8R 2;  1Q86 1;  4MD8 A;  5A2Q f;  1Z03 A;  4NBH A;  2JA8 I;  1VQM 1;  1VQ7 1;  3HOU I;  3CCE Z;  3J7A 4;  2JA7 I;  1YHQ Z;  4BY7 I;  4X6A I;  1ZB9 A;  3U50 C;  2AKL A;  2PM9 A;  1USP B;  3NH5 A;  3MZL B;  2QRC B;  3D6W A;  1SFO I;  2NVY I;  4A3F I;  4A3M I;  3VB9 A;  3NH4 A;  3CD6 Z;  1VQ9 1;  1Z01 A;  4RVH A;  1RO0 A;  2DE6 A;  4RVF A;  1M1K 2;  3CME Z;  4A3D I;  1KC8 2;  3I07 A;  3BG1 B;  4A3I I;  5D1O A;  5A2Q b;  2IZ3 A;  4S1T A;  3CCQ Z;  3CCS 1;  1WW9 A;  1VQ4 1;  5C44 I;  1NJI 2;  1QVG Y;  2E2I I;  1TWA I;  1Q7Y 2;  1KD1 2;  3PO2 I;  1ZB8 A;  4E2W A;  1VQN Z;  3CQZ I;  3CC4 1;  2E2H I;  2GTI A;  4DGL A;  3CCM Z;  2RBL A;  5IP9 I;  3CCL 1;  4Y52 I;  1M1K 1;  4NBC A;  2WAQ A;  1KC8 1;  4A3C I;  5IT9 b;  1DL6 A;  4RVD A;  1VLA A;  3HOZ I;  1K83 I;  3GCF A;  3EED A;  1NJI 1;  5T64 A;  3T4N B;  4E32 A;  5C3E I;  1RQF A;  1Y1V I;  2NVX I;  1Q7Y 1;  2RPR A;  1KD1 1;  2JUB A;  3S1N I;  1YI2 1;  2QR1 B;  2WB1 A;  3CC7 1;  4MXU A;  3PO3 I;  5CM2 M;  1VQ8 1;  2LIY A;  3VMI A;  1VQP Z;  3KIH A;  4TNU A;  2OTL 1;  2KPI A;  5C4J I;  3F3P C;  3ESW A;  4HGZ A;  4E30 A;  4EWC A;  1VQ6 Z;  1YJW 1;  3CPW Z;  1M90 1;  2QEX 1;  2VUM I;  1KQS Y;  1X0T A;  3CCV 1;  4MD9 A;  1TWG I;  2V8I A;  4NBA A;  5LL6 f;  1VQ5 Z;  2M48 A;  4MD7 A;  3GTG I;  2VF1 A;  1JWH C;  3MZK B;  3G4S Z;  1S72 1;  1Q81 2;  3S1R I;  4A3G I;  4NB8 A;  2OTJ 1;  3HOX I;  1I50 I;  3HOY I;  3S16 I;  1VQM Z;  2QA4 1;  1ZH1 A;  1VQ7 Z;  3IF8 A;  4NBF A;  3FKI I;  4NBG A;  5D1P A;  3CCJ Z;  4E2Z A;  2P28 A;  5IP7 I;  4QTT A;  2ZAE B;  3CCU Z;  3FQQ A;  1JJ2 Y;  3IX0 A;  1Q81 1;  1S7M A;  2JS4 A;  5IT9 f;  1YHQ 1;  2JA5 I;  2P3Y A;  1Y1V S;  1RO2 A;  2Q51 A;  3IFU A;  3CC2 Z;  2E9H A;  1YIJ 1;  1KQS Z;  3VMG A;  1RO4 A;  3P5J B;  4MH4 A;  1VQK 1;  3CCS Z;  3GTQ I;  1Z02 A;  3PO3 S;  3CPW Y;  5D1O B;  4RS4 A;  4MON A;  2PK7 A;  2QKD A;  3S1M I;  1P9N A;  1YJ9 1;  4A3J I;  3I56 Z;  2RT9 A;  2O4H A;  3CC4 Z;  3CCQ 1;  4BXX I;  2KI7 B;  3CMA 1;  3D9X A;  2JNY A;  1TFI A;  4Y7N I;  1NP6 A;  1VQO Z;  4NB9 A;  3S17 I;  3GTO I;  2VUG A;  3HOV I;  2JR6 A;  4DQY B;  5FLX f;  3CCM 1;  2GU2 A;  2RIQ A;  3HKZ A;  4E2Y A;  2QLV B;  3NFZ A;  2HF1 A;  1M90 2;  1QYP A;  3RZO I;  1JJ2 Z;  1QVF Y;  4RV9 A;  2H85 A;  4A3B I;  5AN9 F;  4RVG A;  1TWH I;  1X3W A;  3S1Q I;  2QRD B;  5T6B A;  1VQL 1;  4MRI A;  1I6H I;  4CL1 A;  1VQ8 Z;  2OTL Z;  2DE5 A;  2GTH A;  4BBS I;  5C4X I;  4A3E I;  2F4M A;  2JA6 I;  1WII A;  1Y1W I;  2YU9 I;  4NBE A;  1YJN 1;  3I55 1;  2Y0S A;  3RZD I;  1VQP 1;  2OZK A;  3G6E 1;  2LFU A;  2QEX Z;  5FLX b;  3CXC Z;  3G71 1;  1QF8 A;  2IZ4 A;  2W04 A;  4NFR A;  1X3Z A;  1VQ6 1;  3GTK I;  3GKQ A;  4NBB A;  4AYB A;  2W03 A;  2M6N A;  2K3R A;  1YIT 1;  1S72 Z;  2NVQ I;  2OTJ Z;  2QRE B;  3S15 I;  1W2B Z;  1VQ5 1;  3M4O I;  3VTN A;  2QA4 Z;  1K8A 2;  3K7A I;  3CCR 1;  5FLM I;  3J80 b;  1QVF Z;  2K5R A;  3NH8 A;  2NVT I;  2G2K A;  1YUK A;  2V8J A;  3GTJ I;  3GTM I;  4E31 A;  3JAM f;  3CCE 1;  2RHB A;  1USP A;  2F4O A;  1I3Q I;  4A3L I;  4A3K I;  3I4M I;  2R7Z I;  3CCJ 1;  1VQ9 Z;  3EER A;  1K8A 1;  1YUA A;  3CCU 1;  1L1O C;  1YIJ Z;  3LUS A;  2HU9 A;  3NDJ A;  3OW2 Z;  1N8R 1;  1VQ4 Z;  1K73 2;  4NOZ A;  2OOY B;  1VQK Z;  3CD6 1;  3S14 I;  4E33 A;  4HGY A;  3CME 1;  3CC2 1;  4BY1 I;  2V8K A;  2E2J I;  3GTP I;  3CXC Y;  1Q82 2;  1YJ9 Z;  3S2D I;  1K9M 2;  1R9T I;  4HH4 A;  3NDI A;  3JAM b;  3CMA Z;  1PFT A;  3GTL I;  2BJO A;  3CCL Z;  3HOW I;  1VQN 1;  1RNI A;  1ML8 A;  2I3C A;  3KIF A;  1K73 1;  3FQM A;  3I56 1;  1W2B Y;  3Q87 A;  3BG0 B;  2PMZ A;  4NH1 C;  2O53 A;  1VQO 1;  1YI2 Z;  2B63 I;  1Q82 1;  4NBD A;  3H3V J;  3J81 f;  1KRL A;  4DK1 A;  1K9M 1;  3I4N I;  3CC7 Z;  1VQL Z;  2EGT A;  3J80 f;  1WCM I;  1N2F A;  3TDH B;  2R6M A;  5T67 A;  3GTM S;  2JMO A;  3QWU A;  3M3Y I;  1YJW Z;  1TWC I;  3MON A;  3OW2 Y;  1YJN Z;  3I55 Z;  3G6E Z;  4QTU A;  3CCV Z;  1Q86 2;  3F3F C;  4XX2 A;  3G71 Z;  1LQL A;  4E2X A;  4A93 I;  1NUI A;  1QVG Z;  2OOX B;  2YAD A;  4BBR I;  1TWF I;  1RLY A;  2R93 I;  3J81 b;  1YIT Z;  2Q4Z A;  3VMH A;  2J6A A;  3TE5 B;  2R92 I;  2DE7 A;  3S2H I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...