4Y7NI

The structure insight into 5-carboxycytosine recognition by rna polymerase ii during transcription elongation.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis for 5-carboxycytosine recognition by RNA polymerase II elongation complex.
pubmed doi rcsb
molecule tags Transcription/dna/rna
total genus 11
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2015-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4y7nI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4y7nI02
4A3JI 1USPB 1K83I 3ESWA 3S2DI 1L1OC 2JR6A 4A93I 5FLMI 2NVXI 4NOZA 3I07A 2E2JI 1Y1WI 3GTJI 2PK7A 2R92I 3S17I 3Q87A 4A3GI 3VMGA 2JA6I 2E2II 3HOYI 1SFOI 4NBFA 3S1MI 1RLYA 3S15I 1Y1VS 2F4OA 3I4NI 4NB8A 4NBCA 3RZOI 5IP7I 2JA5I 3HOUI 1X3WA 4XX2A 3H3VJ 1ZB8A 2HF1A 1ZB9A 4A3BI 2NVYI 1NUIA 3U50C 2DE7A 1TWGI 3S16I 3CQZI 4NBAA 4A3MI 3GTQI 1TWHI 2RBLA 1USPA 1TFIA 4A3EI 4NB9A 3S2HI 4X6AI 1TWAI 3HOZI 3PO3I 2K5RA 1RO4A 1DL6A 1N2FA 3GTOI 1QYPA 3GKQA 3VMIA 1R9TI 4A3II 4MH4A 1ML8A 3HOXI 4NBGA 1YUAA 1Y1VI 4BY1I 1PFTA 3FKII 3GTMI 3D6WA 4BY7I 1TWFI 3GCFA 4Y7NI 3HOWI 4QTUA 4Y52I 4A3DI 5C44I 3GTKI 2R93I 3S1NI 3PO2I 2YU9I 1I6HI 5IP9I 3GTGI 3H0GI 2F4MA 2E2HI 4NBBA 2BJOA 3RZDI 2AKLA 1I50I 5C4JI 2KPIA 2VUMI 1WCMI 1LQLA 2JS4A 3GTPI 3VB9A 3I4MI 1TWCI 1VLAA 4BXXI 2P3YA 3M3YI 1WW9A 5C3EI 4BBRI 2JNYA 4NBHA 3EERA 4A3KI 2R7ZI 3VMHA 2JA8I 4A3CI 5C4XI 3PO3S 2DE5A 3LUSA 3S14I 4NBDA 4A3LI 1I3QI 4A3FI 5CM2M 3M4OI 3S1QI 3S1RI 3HOVI 3GTLI 4BBSI 3GTMS 3K7AI 4NBEA 4QTTA 2DE6A 2B63I 2JA7I 1X3ZA 2NVTI 2NVQI 2J6AA
chains in the Genus database with same CATH superfamily
3CCR1 4MD9A 3ESWA 2VPXA 1L1OC 2V8IA 4HGYA 1RO2A 3FQQA 4DGLA 2WAQA 1QXFA 4HGZA 1YJN1 1VQ6Z 3VMGA 1RO0A 2JA6I 3S1MI 1RLYA 4S1TA 1Y1VS 2F4OA 4NB8A 3T4NB 4NBCA 3CCVZ 2GTHA 4MD7A 3BG0B 2M6NA 1Z01A 1X3WA 2OZKA 1S7MA 5A2Qb 1M1K2 4E31A 1K731 3G6EZ 2RIQA 4RV9A 2OTL1 3NH5A 3J80b 1VQKZ 1QF8A 2V8JA 1NUIA 2LIYA 3CQZI 4A3MI 3CMAZ 1TWHI 3TE5B 1TFIA 4RVGA 5FLXb 3CC41 1Q821 1QYPA 3HOXI 4MONA 4NBGA 3MZLB 1VQLZ 1Z02A 1YJWZ 3D6WA 3D2LA 3MONA 4QTUA 2QRCB 3GTKI 2R93I 3NH8A 3CC2Z 2YU9I 3GTGI 2GTIA 3CCSZ 1K8A1 2M48A 3CD61 3CME1 3OW2Y 1I50I 2QA4Z 3J7A4 2Q51A 2JIRA 2VUMI 2JS4A 3I4MI 3KIFA 4DK1A 3IFUA 1WW9A 2W03A 2R7ZI 5LL6f 3CPWZ 1VQ61 4E2ZA 4A3CI 2DE5A 3CCMZ 2Y0SA 4E2XA 1QVFZ 4NBDA 3QWUA 2V8KA 3CCV1 5CM2M 3M4OI 4BBSI 3CCLZ 2QR1B 1JJ2Z 3G6E1 2HU9A 4NBEA 4QTTA 2LFUA 2B63I 1M1K1 2JMOA 2O4HA 1VQ9Z 4A3JI 2VPZA 1VQK1 2JR6A 3MZKB 2LEXA 2NVXI 1Q7Y2 4NOZA 1S72Z 3S17I 3Q87A 2VF1A 2NAPA 3CMA1 2W04A 3S15I 3HOUI 2RHBA 1NJI2 1VQL1 1Q16A 2R6MA 3G71Z 1YJW1 4EWCA 3NDIA 2HF1A 3CC21 2QKDA 3CCS1 3U50C 2DE7A 5FLXf 1Z03A 4NBAA 2QA41 2IZ4A 2RBLA 4CL1A 3S2HI 1VQ7Z 2K5RA 1YITZ 1RNIA 2E7ZA 3GTOI 3VMIA 1R9TI 3CCEZ 4A3II 4MH4A 4NH1C 3JAMf 3CCM1 3P5JB 1PFTA 4BY7I 4Y7NI 1QVGZ 4Y52I 4A3DI 3CCL1 4RVDA 1N8R2 4DQYB 4E32A 2E2HI 1P9NA 3CC7Z 1X0TA 2AKLA 1VQ91 5C4JI 2KPIA 1M902 4RVFA 1WCMI 1K9M2 1YIJZ 3VB9A 4TNUA 2P3YA 1S721 3EERA 4A3KI 1RQFA 5C4XI 2GU2A 1Q7Y1 3S14I 3JAMb 3CPWY 1I3QI 3CXCZ 4A3LI 2JIPA 3S1QI 3S1RI 3HOVI 3GTLI 1QVFY 2PMZA 3G711 1KD12 2G2KA 4E2YA 2H85A 3IF8A 1NJI1 1X3ZA 2J6AA 2KI7B 1JJ2Y 1K83I 3S2DI 3IX0A 1VQOZ 3CCQ1 4A93I 2RT9A 2OTJZ 3FQMA 3F3FC 2R92I 4AYBA 1Q862 2E2II 3HOYI 4E2WA 4NBFA 2IZ3A 3CCUZ 1VQ71 3G4SZ 1YIT1 2WB1A 5T6BA 5AN9F 3CCE1 3VTNA 1FDOA 1FDIA 2QLVB 1ZB8A 3NFZA 2QREB 1VQMZ 3D9XA 2NVYI 1Y8CA 3I56Z 1YI2Z 4MD8A 1N8R1 4E33A 2OOYB 3CC71 3S16I 1NP6A 1WJ2A 4E30A 3GTQI 3NH4A 4RVHA 1VQPZ 4NB9A 1YIJ1 1TWAI 3PO3I 1YJ91 1M901 1K9M1 2VUGA 3GKQA 1W2BZ 3J81b 2AYDA 1ML8A 4MRIA 1Y1VI 3GTMI 3FKII 3GCFA 3HOWI 2V3VA 5C44I 2IV2X 3CCQZ 5IP9I 1K8A2 3H0GI 3NDJA 1QVGY 2F4MA 4NBBA 2QEXZ 3RZDI 2VPYA 1KD11 2K3RA 1YUKA 4NFRA 1LQLA 1VQO1 1VQNZ 2OTJ1 4BBRI 2JIOA 4MXUA 3IR7A 1JWHC 3PO3S 5D1OB 5T64A 3CCU1 1KQSZ 3G4S1 1Q861 1VQ5Z 4A3FI 1KC82 2V45A 5T67A 3GTMS 5D1PA 3CXCY 4RS4A 1VQ8Z 3K7AI 1YHQZ 2JA7I 1VQM1 1USPB 1VQ4Z 2OOXB 1YJ9Z 3I561 1YI21 5FLMI 3I07A 2E9HA 2E2JI 1Y1WI 3GTJI 2PK7A 3CCJZ 4A3GI 2PM9A 1VQP1 1SFOI 3TDHB 1Q812 4HH4A 2JIQA 3I4NI 3RZOI 5IP7I 2JA5I 2ZAEB 3I55Z 4XX2A 5D1OA 3H3VJ 1WZNA 1ZH1A 3HKZA 3KIHA 2RPRA 2EGTA 3BG1B 1ZB9A 4A3BI 2YADA 3CCRZ 1TWGI 2QEX1 1YJNZ 1KRLA 1USPA 4A3EI 1VQN1 4X6AI 3J81f 3HOZI 2P28A 1RO4A 1DL6A 1N2FA 1K732 1YUAA 1VQ51 4BY1I 1W2BY 2OTLZ 1TWFI 1KC81 3S1NI 1VQ81 3OW2Z 3PO2I 1I6HI 5IT9f 1YHQ1 3F3PC 2VPWA 2BJOA 2QRDB 1VQ41 3EEDA 1Q822 3GTPI 1TWCI 1VLAA 4BXXI 3CC4Z 3M3YI 2JIMA 5C3EI 1SIWA 2JNYA 3CCJ1 4NBHA 2I3CA 3VMHA 2JA8I 3LUSA 1AA6A 2JUBA 1Q811 1KQSY 5A2Qf 3I551 2O53A 1WIIA 3J80f 5IT9b 2DE6A 3CD6Z 3CMEZ 2NVTI 2NVQI 2Q4ZA
chains in the Genus database with same CATH topology
3CCR1 4MD9A 3ESWA 1L1OC 2V8IA 4HGYA 1RO2A 3FQQA 4DGLA 2WAQA 4HGZA 1YJN1 1VQ6Z 3VMGA 1RO0A 2JA6I 3S1MI 1RLYA 4S1TA 1Y1VS 2F4OA 4NB8A 3T4NB 4NBCA 3CCVZ 2GTHA 4MD7A 3BG0B 2M6NA 1Z01A 1X3WA 2OZKA 1S7MA 5A2Qb 1M1K2 4E31A 1K731 3G6EZ 2RIQA 4RV9A 2OTL1 3NH5A 3J80b 1VQKZ 1QF8A 2V8JA 1NUIA 2LIYA 3CQZI 4A3MI 3CMAZ 1TWHI 3TE5B 1TFIA 4RVGA 5FLXb 3CC41 1Q821 1QYPA 3HOXI 4MONA 4NBGA 3MZLB 1VQLZ 1Z02A 1YJWZ 3D6WA 3MONA 4QTUA 2QRCB 3GTKI 2R93I 3NH8A 3CC2Z 2YU9I 3GTGI 2GTIA 3CCSZ 1K8A1 2M48A 3CD61 3CME1 3OW2Y 1I50I 2QA4Z 3J7A4 2Q51A 2VUMI 2JS4A 3I4MI 3KIFA 4DK1A 3IFUA 1WW9A 2W03A 2R7ZI 5LL6f 3CPWZ 1VQ61 4E2ZA 4A3CI 2DE5A 3CCMZ 2Y0SA 4E2XA 1QVFZ 4NBDA 3QWUA 2V8KA 3CCV1 5CM2M 3M4OI 4BBSI 3CCLZ 2QR1B 1JJ2Z 3G6E1 2HU9A 4NBEA 4QTTA 2LFUA 2B63I 1M1K1 2JMOA 2O4HA 1VQ9Z 4A3JI 1VQK1 2JR6A 3MZKB 2NVXI 1Q7Y2 4NOZA 1S72Z 3S17I 3Q87A 2VF1A 3CMA1 2W04A 3S15I 3HOUI 2RHBA 1NJI2 1VQL1 3G71Z 2R6MA 1YJW1 4EWCA 3NDIA 2HF1A 3CC21 2QKDA 3CCS1 3U50C 2DE7A 5FLXf 1Z03A 4NBAA 2QA41 2IZ4A 2RBLA 4CL1A 3S2HI 1VQ7Z 2K5RA 1YITZ 1RNIA 3GTOI 3VMIA 1R9TI 3CCEZ 4A3II 4MH4A 4NH1C 3JAMf 3CCM1 3P5JB 1PFTA 4BY7I 4Y7NI 1QVGZ 4Y52I 4A3DI 3CCL1 4RVDA 1N8R2 4DQYB 4E32A 2E2HI 1P9NA 3CC7Z 1X0TA 2AKLA 1VQ91 5C4JI 2KPIA 1M902 4RVFA 1WCMI 1K9M2 1YIJZ 3VB9A 4TNUA 2P3YA 1S721 3EERA 4A3KI 1RQFA 5C4XI 2GU2A 1Q7Y1 3S14I 3JAMb 3CPWY 1I3QI 3CXCZ 4A3LI 3S1QI 3S1RI 3HOVI 3GTLI 1QVFY 2PMZA 3G711 1KD12 2G2KA 4E2YA 2H85A 3IF8A 1NJI1 1X3ZA 2J6AA 2KI7B 1JJ2Y 1K83I 3S2DI 3IX0A 1VQOZ 3CCQ1 4A93I 2RT9A 2OTJZ 3FQMA 3F3FC 2R92I 4AYBA 1Q862 2E2II 3HOYI 4E2WA 4NBFA 2IZ3A 3CCUZ 1VQ71 3G4SZ 1YIT1 2WB1A 5T6BA 5AN9F 3CCE1 3VTNA 2QLVB 1ZB8A 3NFZA 2QREB 1VQMZ 3D9XA 2NVYI 3I56Z 1YI2Z 4MD8A 1N8R1 4E33A 2OOYB 3CC71 3S16I 1NP6A 4E30A 3GTQI 3NH4A 4RVHA 1VQPZ 4NB9A 1YIJ1 1TWAI 3PO3I 1YJ91 1M901 1K9M1 2VUGA 3GKQA 1W2BZ 3J81b 1ML8A 4MRIA 1Y1VI 3GTMI 3FKII 3GCFA 3HOWI 5C44I 3CCQZ 5IP9I 1K8A2 3H0GI 3NDJA 1QVGY 2F4MA 4NBBA 2QEXZ 3RZDI 1KD11 2K3RA 1YUKA 4NFRA 1LQLA 1VQO1 1VQNZ 2OTJ1 4BBRI 4MXUA 1JWHC 3PO3S 5D1OB 5T64A 3CCU1 1KQSZ 3G4S1 1Q861 1VQ5Z 4A3FI 1KC82 5T67A 3GTMS 5D1PA 3CXCY 4RS4A 1VQ8Z 3K7AI 1YHQZ 2JA7I 1VQM1 1USPB 1VQ4Z 2OOXB 1YJ9Z 3I561 1YI21 5FLMI 3I07A 2E9HA 2E2JI 1Y1WI 3GTJI 2PK7A 3CCJZ 4A3GI 2PM9A 1VQP1 1SFOI 3TDHB 1Q812 4HH4A 3I4NI 3RZOI 5IP7I 2JA5I 2ZAEB 3I55Z 4XX2A 5D1OA 3H3VJ 1ZH1A 3HKZA 3KIHA 2RPRA 2EGTA 3BG1B 1ZB9A 4A3BI 2YADA 3CCRZ 1TWGI 2QEX1 1YJNZ 1KRLA 1USPA 4A3EI 1VQN1 4X6AI 3J81f 3HOZI 2P28A 1RO4A 1DL6A 1N2FA 1K732 1YUAA 1VQ51 4BY1I 1W2BY 2OTLZ 1TWFI 1KC81 3S1NI 1VQ81 3OW2Z 3PO2I 1I6HI 5IT9f 1YHQ1 3F3PC 2BJOA 2QRDB 1VQ41 3EEDA 1Q822 3GTPI 1TWCI 1VLAA 4BXXI 3CC4Z 3M3YI 5C3EI 2JNYA 3CCJ1 4NBHA 2I3CA 3VMHA 2JA8I 3LUSA 2JUBA 1Q811 1KQSY 5A2Qf 3I551 2O53A 1WIIA 3J80f 5IT9b 2DE6A 3CD6Z 3CMEZ 2NVTI 2NVQI 2Q4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3J I;  1USP B;  1K83 I;  3ESW A;  3S2D I;  1L1O C;  2JR6 A;  4A93 I;  5FLM I;  2NVX I;  4NOZ A;  3I07 A;  2E2J I;  1Y1W I;  3GTJ I;  2PK7 A;  2R92 I;  3S17 I;  3Q87 A;  4A3G I;  3VMG A;  2JA6 I;  2E2I I;  3HOY I;  1SFO I;  4NBF A;  3S1M I;  1RLY A;  3S15 I;  1Y1V S;  2F4O A;  3I4N I;  4NB8 A;  4NBC A;  3RZO I;  5IP7 I;  2JA5 I;  3HOU I;  1X3W A;  4XX2 A;  3H3V J;  1ZB8 A;  2HF1 A;  1ZB9 A;  4A3B I;  2NVY I;  1NUI A;  3U50 C;  2DE7 A;  1TWG I;  3S16 I;  3CQZ I;  4NBA A;  4A3M I;  3GTQ I;  1TWH I;  2RBL A;  1USP A;  1TFI A;  4A3E I;  4NB9 A;  3S2H I;  4X6A I;  1TWA I;  3HOZ I;  3PO3 I;  2K5R A;  1RO4 A;  1DL6 A;  1N2F A;  3GTO I;  1QYP A;  3GKQ A;  3VMI A;  1R9T I;  4A3I I;  4MH4 A;  1ML8 A;  3HOX I;  4NBG A;  1YUA A;  1Y1V I;  4BY1 I;  1PFT A;  3FKI I;  3GTM I;  3D6W A;  4BY7 I;  1TWF I;  3GCF A;  4Y7N I;  3HOW I;  4QTU A;  4Y52 I;  4A3D I;  5C44 I;  3GTK I;  2R93 I;  3S1N I;  3PO2 I;  2YU9 I;  1I6H I;  5IP9 I;  3GTG I;  3H0G I;  2F4M A;  2E2H I;  4NBB A;  2BJO A;  3RZD I;  2AKL A;  1I50 I;  5C4J I;  2KPI A;  2VUM I;  1WCM I;  1LQL A;  2JS4 A;  3GTP I;  3VB9 A;  3I4M I;  1TWC I;  1VLA A;  4BXX I;  2P3Y A;  3M3Y I;  1WW9 A;  5C3E I;  4BBR I;  2JNY A;  4NBH A;  3EER A;  4A3K I;  2R7Z I;  3VMH A;  2JA8 I;  4A3C I;  5C4X I;  3PO3 S;  2DE5 A;  3LUS A;  3S14 I;  4NBD A;  4A3L I;  1I3Q I;  4A3F I;  5CM2 M;  3M4O I;  3S1Q I;  3S1R I;  3HOV I;  3GTL I;  4BBS I;  3GTM S;  3K7A I;  4NBE A;  4QTT A;  2DE6 A;  2B63 I;  2JA7 I;  1X3Z A;  2NVT I;  2NVQ I;  2J6A A; 
#chains in the Genus database with same CATH topology
 3CCR 1;  4MD9 A;  3ESW A;  2VPX A;  1L1O C;  2V8I A;  4HGY A;  1RO2 A;  3FQQ A;  4DGL A;  2WAQ A;  1QXF A;  4HGZ A;  1YJN 1;  1VQ6 Z;  3VMG A;  1RO0 A;  2JA6 I;  3S1M I;  1RLY A;  4S1T A;  1Y1V S;  2F4O A;  4NB8 A;  3T4N B;  4NBC A;  3CCV Z;  2GTH A;  4MD7 A;  3BG0 B;  2M6N A;  1Z01 A;  1X3W A;  2OZK A;  1S7M A;  5A2Q b;  1M1K 2;  4E31 A;  1K73 1;  3G6E Z;  2RIQ A;  4RV9 A;  2OTL 1;  3NH5 A;  3J80 b;  1VQK Z;  1QF8 A;  2V8J A;  1NUI A;  2LIY A;  3CQZ I;  4A3M I;  3CMA Z;  1TWH I;  3TE5 B;  1TFI A;  4RVG A;  5FLX b;  3CC4 1;  1Q82 1;  1QYP A;  3HOX I;  4MON A;  4NBG A;  3MZL B;  1VQL Z;  1Z02 A;  1YJW Z;  3D6W A;  3D2L A;  3MON A;  4QTU A;  2QRC B;  3GTK I;  2R93 I;  3NH8 A;  3CC2 Z;  2YU9 I;  3GTG I;  2GTI A;  3CCS Z;  1K8A 1;  2M48 A;  3CD6 1;  3CME 1;  3OW2 Y;  1I50 I;  2QA4 Z;  3J7A 4;  2Q51 A;  2JIR A;  2VUM I;  2JS4 A;  3I4M I;  3KIF A;  4DK1 A;  3IFU A;  1WW9 A;  2W03 A;  2R7Z I;  5LL6 f;  3CPW Z;  1VQ6 1;  4E2Z A;  4A3C I;  2DE5 A;  3CCM Z;  2Y0S A;  4E2X A;  1QVF Z;  4NBD A;  3QWU A;  2V8K A;  3CCV 1;  5CM2 M;  3M4O I;  4BBS I;  3CCL Z;  2QR1 B;  1JJ2 Z;  3G6E 1;  2HU9 A;  4NBE A;  4QTT A;  2LFU A;  2B63 I;  1M1K 1;  2JMO A;  2O4H A;  1VQ9 Z;  4A3J I;  2VPZ A;  1VQK 1;  2JR6 A;  3MZK B;  2LEX A;  2NVX I;  1Q7Y 2;  4NOZ A;  1S72 Z;  3S17 I;  3Q87 A;  2VF1 A;  2NAP A;  3CMA 1;  2W04 A;  3S15 I;  3HOU I;  2RHB A;  1NJI 2;  1VQL 1;  1Q16 A;  2R6M A;  3G71 Z;  1YJW 1;  4EWC A;  3NDI A;  2HF1 A;  3CC2 1;  2QKD A;  3CCS 1;  3U50 C;  2DE7 A;  5FLX f;  1Z03 A;  4NBA A;  2QA4 1;  2IZ4 A;  2RBL A;  4CL1 A;  3S2H I;  1VQ7 Z;  2K5R A;  1YIT Z;  1RNI A;  2E7Z A;  3GTO I;  3VMI A;  1R9T I;  3CCE Z;  4A3I I;  4MH4 A;  4NH1 C;  3JAM f;  3CCM 1;  3P5J B;  1PFT A;  4BY7 I;  4Y7N I;  1QVG Z;  4Y52 I;  4A3D I;  3CCL 1;  4RVD A;  1N8R 2;  4DQY B;  4E32 A;  2E2H I;  1P9N A;  3CC7 Z;  1X0T A;  2AKL A;  1VQ9 1;  5C4J I;  2KPI A;  1M90 2;  4RVF A;  1WCM I;  1K9M 2;  1YIJ Z;  3VB9 A;  4TNU A;  2P3Y A;  1S72 1;  3EER A;  4A3K I;  1RQF A;  5C4X I;  2GU2 A;  1Q7Y 1;  3S14 I;  3JAM b;  3CPW Y;  1I3Q I;  3CXC Z;  4A3L I;  2JIP A;  3S1Q I;  3S1R I;  3HOV I;  3GTL I;  1QVF Y;  2PMZ A;  3G71 1;  1KD1 2;  2G2K A;  4E2Y A;  2H85 A;  3IF8 A;  1NJI 1;  1X3Z A;  2J6A A;  2KI7 B;  1JJ2 Y;  1K83 I;  3S2D I;  3IX0 A;  1VQO Z;  3CCQ 1;  4A93 I;  2RT9 A;  2OTJ Z;  3FQM A;  3F3F C;  2R92 I;  4AYB A;  1Q86 2;  2E2I I;  3HOY I;  4E2W A;  4NBF A;  2IZ3 A;  3CCU Z;  1VQ7 1;  3G4S Z;  1YIT 1;  2WB1 A;  5T6B A;  5AN9 F;  3CCE 1;  3VTN A;  1FDO A;  1FDI A;  2QLV B;  1ZB8 A;  3NFZ A;  2QRE B;  1VQM Z;  3D9X A;  2NVY I;  1Y8C A;  3I56 Z;  1YI2 Z;  4MD8 A;  1N8R 1;  4E33 A;  2OOY B;  3CC7 1;  3S16 I;  1NP6 A;  1WJ2 A;  4E30 A;  3GTQ I;  3NH4 A;  4RVH A;  1VQP Z;  4NB9 A;  1YIJ 1;  1TWA I;  3PO3 I;  1YJ9 1;  1M90 1;  1K9M 1;  2VUG A;  3GKQ A;  1W2B Z;  3J81 b;  2AYD A;  1ML8 A;  4MRI A;  1Y1V I;  3GTM I;  3FKI I;  3GCF A;  3HOW I;  2V3V A;  5C44 I;  2IV2 X;  3CCQ Z;  5IP9 I;  1K8A 2;  3H0G I;  3NDJ A;  1QVG Y;  2F4M A;  4NBB A;  2QEX Z;  3RZD I;  2VPY A;  1KD1 1;  2K3R A;  1YUK A;  4NFR A;  1LQL A;  1VQO 1;  1VQN Z;  2OTJ 1;  4BBR I;  2JIO A;  4MXU A;  3IR7 A;  1JWH C;  3PO3 S;  5D1O B;  5T64 A;  3CCU 1;  1KQS Z;  3G4S 1;  1Q86 1;  1VQ5 Z;  4A3F I;  1KC8 2;  2V45 A;  5T67 A;  3GTM S;  5D1P A;  3CXC Y;  4RS4 A;  1VQ8 Z;  3K7A I;  1YHQ Z;  2JA7 I;  1VQM 1;  1USP B;  1VQ4 Z;  2OOX B;  1YJ9 Z;  3I56 1;  1YI2 1;  5FLM I;  3I07 A;  2E9H A;  2E2J I;  1Y1W I;  3GTJ I;  2PK7 A;  3CCJ Z;  4A3G I;  2PM9 A;  1VQP 1;  1SFO I;  3TDH B;  1Q81 2;  4HH4 A;  2JIQ A;  3I4N I;  3RZO I;  5IP7 I;  2JA5 I;  2ZAE B;  3I55 Z;  4XX2 A;  5D1O A;  3H3V J;  1WZN A;  1ZH1 A;  3HKZ A;  3KIH A;  2RPR A;  2EGT A;  3BG1 B;  1ZB9 A;  4A3B I;  2YAD A;  3CCR Z;  1TWG I;  2QEX 1;  1YJN Z;  1KRL A;  1USP A;  4A3E I;  1VQN 1;  4X6A I;  3J81 f;  3HOZ I;  2P28 A;  1RO4 A;  1DL6 A;  1N2F A;  1K73 2;  1YUA A;  1VQ5 1;  4BY1 I;  1W2B Y;  2OTL Z;  1TWF I;  1KC8 1;  3S1N I;  1VQ8 1;  3OW2 Z;  3PO2 I;  1I6H I;  5IT9 f;  1YHQ 1;  3F3P C;  2VPW A;  2BJO A;  2QRD B;  1VQ4 1;  3EED A;  1Q82 2;  3GTP I;  1TWC I;  1VLA A;  4BXX I;  3CC4 Z;  3M3Y I;  2JIM A;  5C3E I;  1SIW A;  2JNY A;  3CCJ 1;  4NBH A;  2I3C A;  3VMH A;  2JA8 I;  3LUS A;  1AA6 A;  2JUB A;  1Q81 1;  1KQS Y;  5A2Q f;  3I55 1;  2O53 A;  1WII A;  3J80 f;  5IT9 b;  2DE6 A;  3CD6 Z;  3CME Z;  2NVT I;  2NVQ I;  2Q4Z A; 
#chains in the Genus database with same CATH homology
 3CCR 1;  4MD9 A;  3ESW A;  1L1O C;  2V8I A;  4HGY A;  1RO2 A;  3FQQ A;  4DGL A;  2WAQ A;  4HGZ A;  1YJN 1;  1VQ6 Z;  3VMG A;  1RO0 A;  2JA6 I;  3S1M I;  1RLY A;  4S1T A;  1Y1V S;  2F4O A;  4NB8 A;  3T4N B;  4NBC A;  3CCV Z;  2GTH A;  4MD7 A;  3BG0 B;  2M6N A;  1Z01 A;  1X3W A;  2OZK A;  1S7M A;  5A2Q b;  1M1K 2;  4E31 A;  1K73 1;  3G6E Z;  2RIQ A;  4RV9 A;  2OTL 1;  3NH5 A;  3J80 b;  1VQK Z;  1QF8 A;  2V8J A;  1NUI A;  2LIY A;  3CQZ I;  4A3M I;  3CMA Z;  1TWH I;  3TE5 B;  1TFI A;  4RVG A;  5FLX b;  3CC4 1;  1Q82 1;  1QYP A;  3HOX I;  4MON A;  4NBG A;  3MZL B;  1VQL Z;  1Z02 A;  1YJW Z;  3D6W A;  3MON A;  4QTU A;  2QRC B;  3GTK I;  2R93 I;  3NH8 A;  3CC2 Z;  2YU9 I;  3GTG I;  2GTI A;  3CCS Z;  1K8A 1;  2M48 A;  3CD6 1;  3CME 1;  3OW2 Y;  1I50 I;  2QA4 Z;  3J7A 4;  2Q51 A;  2VUM I;  2JS4 A;  3I4M I;  3KIF A;  4DK1 A;  3IFU A;  1WW9 A;  2W03 A;  2R7Z I;  5LL6 f;  3CPW Z;  1VQ6 1;  4E2Z A;  4A3C I;  2DE5 A;  3CCM Z;  2Y0S A;  4E2X A;  1QVF Z;  4NBD A;  3QWU A;  2V8K A;  3CCV 1;  5CM2 M;  3M4O I;  4BBS I;  3CCL Z;  2QR1 B;  1JJ2 Z;  3G6E 1;  2HU9 A;  4NBE A;  4QTT A;  2LFU A;  2B63 I;  1M1K 1;  2JMO A;  2O4H A;  1VQ9 Z;  4A3J I;  1VQK 1;  2JR6 A;  3MZK B;  2NVX I;  1Q7Y 2;  4NOZ A;  1S72 Z;  3S17 I;  3Q87 A;  2VF1 A;  3CMA 1;  2W04 A;  3S15 I;  3HOU I;  2RHB A;  1NJI 2;  1VQL 1;  3G71 Z;  2R6M A;  1YJW 1;  4EWC A;  3NDI A;  2HF1 A;  3CC2 1;  2QKD A;  3CCS 1;  3U50 C;  2DE7 A;  5FLX f;  1Z03 A;  4NBA A;  2QA4 1;  2IZ4 A;  2RBL A;  4CL1 A;  3S2H I;  1VQ7 Z;  2K5R A;  1YIT Z;  1RNI A;  3GTO I;  3VMI A;  1R9T I;  3CCE Z;  4A3I I;  4MH4 A;  4NH1 C;  3JAM f;  3CCM 1;  3P5J B;  1PFT A;  4BY7 I;  4Y7N I;  1QVG Z;  4Y52 I;  4A3D I;  3CCL 1;  4RVD A;  1N8R 2;  4DQY B;  4E32 A;  2E2H I;  1P9N A;  3CC7 Z;  1X0T A;  2AKL A;  1VQ9 1;  5C4J I;  2KPI A;  1M90 2;  4RVF A;  1WCM I;  1K9M 2;  1YIJ Z;  3VB9 A;  4TNU A;  2P3Y A;  1S72 1;  3EER A;  4A3K I;  1RQF A;  5C4X I;  2GU2 A;  1Q7Y 1;  3S14 I;  3JAM b;  3CPW Y;  1I3Q I;  3CXC Z;  4A3L I;  3S1Q I;  3S1R I;  3HOV I;  3GTL I;  1QVF Y;  2PMZ A;  3G71 1;  1KD1 2;  2G2K A;  4E2Y A;  2H85 A;  3IF8 A;  1NJI 1;  1X3Z A;  2J6A A;  2KI7 B;  1JJ2 Y;  1K83 I;  3S2D I;  3IX0 A;  1VQO Z;  3CCQ 1;  4A93 I;  2RT9 A;  2OTJ Z;  3FQM A;  3F3F C;  2R92 I;  4AYB A;  1Q86 2;  2E2I I;  3HOY I;  4E2W A;  4NBF A;  2IZ3 A;  3CCU Z;  1VQ7 1;  3G4S Z;  1YIT 1;  2WB1 A;  5T6B A;  5AN9 F;  3CCE 1;  3VTN A;  2QLV B;  1ZB8 A;  3NFZ A;  2QRE B;  1VQM Z;  3D9X A;  2NVY I;  3I56 Z;  1YI2 Z;  4MD8 A;  1N8R 1;  4E33 A;  2OOY B;  3CC7 1;  3S16 I;  1NP6 A;  4E30 A;  3GTQ I;  3NH4 A;  4RVH A;  1VQP Z;  4NB9 A;  1YIJ 1;  1TWA I;  3PO3 I;  1YJ9 1;  1M90 1;  1K9M 1;  2VUG A;  3GKQ A;  1W2B Z;  3J81 b;  1ML8 A;  4MRI A;  1Y1V I;  3GTM I;  3FKI I;  3GCF A;  3HOW I;  5C44 I;  3CCQ Z;  5IP9 I;  1K8A 2;  3H0G I;  3NDJ A;  1QVG Y;  2F4M A;  4NBB A;  2QEX Z;  3RZD I;  1KD1 1;  2K3R A;  1YUK A;  4NFR A;  1LQL A;  1VQO 1;  1VQN Z;  2OTJ 1;  4BBR I;  4MXU A;  1JWH C;  3PO3 S;  5D1O B;  5T64 A;  3CCU 1;  1KQS Z;  3G4S 1;  1Q86 1;  1VQ5 Z;  4A3F I;  1KC8 2;  5T67 A;  3GTM S;  5D1P A;  3CXC Y;  4RS4 A;  1VQ8 Z;  3K7A I;  1YHQ Z;  2JA7 I;  1VQM 1;  1USP B;  1VQ4 Z;  2OOX B;  1YJ9 Z;  3I56 1;  1YI2 1;  5FLM I;  3I07 A;  2E9H A;  2E2J I;  1Y1W I;  3GTJ I;  2PK7 A;  3CCJ Z;  4A3G I;  2PM9 A;  1VQP 1;  1SFO I;  3TDH B;  1Q81 2;  4HH4 A;  3I4N I;  3RZO I;  5IP7 I;  2JA5 I;  2ZAE B;  3I55 Z;  4XX2 A;  5D1O A;  3H3V J;  1ZH1 A;  3HKZ A;  3KIH A;  2RPR A;  2EGT A;  3BG1 B;  1ZB9 A;  4A3B I;  2YAD A;  3CCR Z;  1TWG I;  2QEX 1;  1YJN Z;  1KRL A;  1USP A;  4A3E I;  1VQN 1;  4X6A I;  3J81 f;  3HOZ I;  2P28 A;  1RO4 A;  1DL6 A;  1N2F A;  1K73 2;  1YUA A;  1VQ5 1;  4BY1 I;  1W2B Y;  2OTL Z;  1TWF I;  1KC8 1;  3S1N I;  1VQ8 1;  3OW2 Z;  3PO2 I;  1I6H I;  5IT9 f;  1YHQ 1;  3F3P C;  2BJO A;  2QRD B;  1VQ4 1;  3EED A;  1Q82 2;  3GTP I;  1TWC I;  1VLA A;  4BXX I;  3CC4 Z;  3M3Y I;  5C3E I;  2JNY A;  3CCJ 1;  4NBH A;  2I3C A;  3VMH A;  2JA8 I;  3LUS A;  2JUB A;  1Q81 1;  1KQS Y;  5A2Q f;  3I55 1;  2O53 A;  1WII A;  3J80 f;  5IT9 b;  2DE6 A;  3CD6 Z;  3CME Z;  2NVT I;  2NVQ I;  2Q4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...