4Y7NI

The structure insight into 5-carboxycytosine recognition by rna polymerase ii during transcription elongation.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for 5-carboxycytosine recognition by RNA polymerase II elongation complex.
pubmed doi rcsb
molecule tags Transcription/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 11
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2015-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4y7nI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4y7nI02
4QTUA 3S1NI 1R9TI 2JNYA 1Y1VI 3I4MI 3GTQI 3M4OI 3GTLI 1TWAI 3GTGI 3PO3S 5FLMI 1Y1WI 3PO2I 3GTJI 2J6AA 4BXXI 4NB8A 1WW9A 3H0GI 4A93I 4BY7I 2B63I 1I50I 3S1RI 4NBBA 1RLYA 1USPB 3GCFA 3K7AI 3HOYI 1RO4A 3S15I 4NBEA 3M3YI 4MH4A 1TWFI 2BJOA 2DE7A 3CQZI 5IP9I 2RBLA 1L1OC 3FKII 1TFIA 2NVYI 5C4JI 2NVQI 3I4NI 3S14I 2K5RA 2DE5A 2PK7A 4Y7NI 5C3EI 1I3QI 4QTTA 2NVXI 4XX2A 3VMGA 2JS4A 4NOZA 1X3WA 2HF1A 3EERA 4A3II 3Q87A 4NB9A 1SFOI 2E2II 3GTOI 4A3GI 3PO3I 2JA6I 2JR6A 3LUSA 4A3LI 4A3EI 2R7ZI 1ML8A 4A3FI 3HOWI 4NBFA 2F4OA 3S2HI 2R92I 3VB9A 3VMHA 3GTMI 2R93I 2JA8I 1ZB8A 5C4XI 3RZDI 1NUIA 4A3MI 2NVTI 1TWCI 3ESWA 3HOXI 1TWGI 1Y1VS 3D6WA 4BY1I 3S16I 3S1QI 3HOUI 4BBRI 3GKQA 4A3KI 4A3CI 3U50C 4A3DI 4NBHA 4A3JI 4BBSI 4NBAA 3I07A 3VMIA 2VUMI 3HOVI 1I6HI 2YU9I 2E2HI 1YUAA 2F4MA 4NBGA 3RZOI 1WCMI 4NBCA 1TWHI 4Y52I 4NBDA 4A3BI 1USPA 2E2JI 3S1MI 1LQLA 1DL6A 2AKLA 5C44I 3GTPI 5IP7I 1PFTA 3S2DI 3HOZI 2DE6A 1VLAA 1ZB9A 3S17I 1QYPA 1N2FA 3H3VJ 2JA5I 4X6AI 2P3YA 2KPIA 5CM2M 1X3ZA 3GTKI 2JA7I 1K83I 3GTMS
chains in the Genus database with same CATH superfamily
4QTUA 1VQN1 3S1NI 2I3CA 2JNYA 2QKDA 2V8KA 4RVGA 1N8R1 1VQPZ 3BG1B 5T67A 3GTJI 2V3VA 1RO2A 4BY7I 5AN9F 1I50I 2OOYB 3S1RI 4NBBA 3CCJZ 3CCM1 4MRIA 5T64A 3J7A4 5IP9I 4RVDA 3G4SZ 1S72Z 3FKII 1TFIA 2NVYI 4E31A 2K3RA 2PK7A 2JIOA 2VPWA 4MONA 5C3EI 1VQ61 3CXCZ 3CMEZ 3F3PC 2JMOA 1VQMZ 3CMAZ 2JA6I 2NAPA 2ZAEB 3J80f 4A3LI 2R7ZI 1ML8A 4A3FI 3G71Z 4NBFA 2QEXZ 1Z01A 3J80b 3VMHA 1JWHC 5FLXf 2NVTI 3IX0A 1YJ9Z 1YHQ1 3P5JB 1Z02A 1S7MA 1K8A1 3MZKB 4A3DI 5A2Qf 4NBAA 3I07A 3I551 1K9M1 1YUAA 1YJWZ 1YJNZ 3RZOI 3QWUA 3KIHA 4AYBA 4Y52I 3CCE1 3D9XA 1KD11 1VQ71 1DL6A 3CCU1 2AKLA 5C44I 2AYDA 3I561 1VQOZ 5T6BA 1VQK1 2PM9A 2DE6A 1YIT1 3EEDA 1ZB9A 2WAQA 1QVFZ 4E2XA 1QYPA 1QVGY 4MD8A 1X3ZA 1VQP1 3TE5B 2JA7I 1K83I 2RHBA 1Q16A 3CC7Z 2RPRA 3CCL1 1W2BZ 1R9TI 5D1OA 3CC4Z 2JUBA 1K732 3M4OI 2YADA 3GTLI 2R6MA 2OZKA 3GTGI 3PO3S 5FLMI 2OTJZ 1Y1WI 3PO2I 3OW2Y 4BXXI 2OTLZ 3FQMA 1RLYA 1X0TA 4NH1C 1Q862 1N8R2 2E7ZA 5D1PA 4E2ZA 4NBEA 3M3YI 1YIJZ 3IFUA 1Y8CA 5D1OB 1TWFI 2BJOA 5LL6f 2VUGA 3CME1 3NDJA 2K5RA 2DE5A 1I3QI 2RT9A 3G6E1 3VMGA 4NOZA 2E2II 1VQ8Z 4A3GI 2IV2X 3NFZA 2LIYA 4MD9A 1YJ91 1W2BY 3IF8A 1YHQZ 3HOWI 1M902 3BG0B 2F4OA 3S2HI 3VB9A 1M1K2 1ZB8A 3RZDI 3J81f 3CC21 4A3MI 3HOXI 1TWGI 3S16I 3I55Z 1Z03A 3HOUI 4BBRI 3J81b 1VQ5Z 3CCR1 3CCS1 4DGLA 3U50C 1KQSY 2JIPA 4NBHA 2IZ4A 4BBSI 3VMIA 4MXUA 2E2HI 3VTNA 2GTIA 2F4MA 1K9M2 4NBCA 1YI21 4NBDA 3S1MI 3GTPI 5IP7I 1Q811 3S2DI 1P9NA 1VLAA 2VPYA 3S17I 1VQLZ 1NP6A 2Y0SA 2M6NA 2JA5I 3H3VJ 4X6AI 3MONA 5CM2M 1Q822 2OTJ1 2QA4Z 1RO0A 3NH5A 3I4MI 2OTL1 2QR1B 3CPWZ 3CCQZ 3GTQI 1RNIA 3CCJ1 2Q51A 1JJ2Z 1VQNZ 3CCMZ 3CCVZ 3H0GI 4A93I 2QRCB 2KI7B 2B63I 3GCFA 3K7AI 2WB1A 3D2LA 1RO4A 4DK1A 3HKZA 3CPWY 2P28A 3F3FC 1QVFY 5IT9b 3CQZI 1SIWA 4RS4A 4S1TA 2RBLA 1L1OC 2JIRA 4RVFA 5IT9f 1WZNA 4E2YA 1WJ2A 4QTTA 2QEX1 4HGYA 1S721 1X3WA 3EERA 3GTOI 1SFOI 3Q87A 4NB9A 3PO3I 1M1K1 2QRDB 2R92I 4HGZA 1ZH1A 3CCRZ 3CCSZ 3GTMI 2JA8I 1M901 5C4XI 1NUIA 2VPZA 2G2KA 1TWCI 3ESWA 1VQ9Z 2GU2A 1Y1VS 3D6WA 4NFRA 3S1QI 2IZ3A 2VPXA 1YJW1 4A3KI 2V8IA 3HOVI 1I6HI 3CD61 4HH4A 4NBGA 1NJI1 3CXCY 2RIQA 3MZLB 4DQYB 2O53A 4A3BI 1LQLA 3T4NB 1Q861 1FDIA 1PFTA 3NH8A 2VF1A 1YJN1 2Q4ZA 1KRLA 2O4HA 1KC81 3CC71 1JJ2Y 2QLVB 2OOXB 3CCEZ 1N2FA 3CCQ1 2KPIA 1VQ41 3I56Z 1VQO1 3GTKI 1K731 1YITZ 3GTMS 3CCV1 1Y1VI 2PMZA 2V45A 4RV9A 1Q7Y1 1TWAI 3CCLZ 4E30A 1YIJ1 3NDIA 2J6AA 4NB8A 1WW9A 3JAMb 3CC41 3HOYI 2EGTA 1USPB 4E32A 3S15I 2W03A 3JAMf 1KD12 4MH4A 2V8JA 1RQFA 2DE7A 3G6EZ 1Q821 1YUKA 3S14I 5C4JI 2H85A 2NVQI 3I4NI 1KQSZ 3TDHB 3FQQA 4Y7NI 1QVGZ 5A2Qb 2NVXI 1AA6A 4XX2A 1Q812 1K8A2 1QF8A 3G4S1 2JS4A 2QREB 4EWCA 2HF1A 4A3II 2JIMA 3CC2Z 1VQ91 2JR6A 3LUSA 1FDOA 4A3EI 3OW2Z 1VQ6Z 2R93I 1QXFA 1VQ81 1VQM1 3CMA1 4E2WA 4BY1I 3G711 2GTHA 3IR7A 3CD6Z 3GKQA 4RVHA 3NH4A 4A3CI 4A3JI 1YI2Z 2VUMI 4TNUA 1NJI2 2YU9I 2LEXA 1Q7Y2 5FLXb 1VQ51 2W04A 2M48A 1WCMI 4MD7A 1TWHI 1VQL1 1WIIA 1USPA 2E2JI 2LFUA 2E9HA 1VQ4Z 3HOZI 2QA41 4E33A 1KC82 1VQ7Z 2P3YA 3CCUZ 2HU9A 4CL1A 1VQKZ 2JIQA 3KIFA
chains in the Genus database with same CATH topology
4QTUA 1VQN1 3S1NI 2I3CA 2JNYA 2QKDA 2V8KA 4RVGA 1N8R1 1VQPZ 3BG1B 5T67A 3GTJI 1RO2A 4BY7I 5AN9F 1I50I 2OOYB 3S1RI 4NBBA 3CCJZ 3CCM1 4MRIA 5T64A 3J7A4 5IP9I 4RVDA 3G4SZ 1S72Z 3FKII 1TFIA 2NVYI 4E31A 2K3RA 2PK7A 5C3EI 4MONA 1VQ61 3CXCZ 3CMEZ 3F3PC 2JMOA 1VQMZ 3CMAZ 2JA6I 2ZAEB 3J80f 4A3LI 2R7ZI 1ML8A 4A3FI 3G71Z 4NBFA 2QEXZ 1Z01A 3J80b 3VMHA 1JWHC 5FLXf 2NVTI 3IX0A 1YJ9Z 1YHQ1 3P5JB 1Z02A 1S7MA 1K8A1 3MZKB 4A3DI 5A2Qf 4NBAA 3I07A 3I551 1K9M1 1YUAA 1YJWZ 1YJNZ 3RZOI 3QWUA 3KIHA 4AYBA 4Y52I 3CCE1 3D9XA 1KD11 1VQ71 1DL6A 3CCU1 2AKLA 5C44I 3I561 1VQOZ 5T6BA 1VQK1 2PM9A 2DE6A 1YIT1 3EEDA 1ZB9A 2WAQA 1QVFZ 4E2XA 1QYPA 1QVGY 4MD8A 1X3ZA 1VQP1 3TE5B 2JA7I 1K83I 2RHBA 3CC7Z 2RPRA 3CCL1 1W2BZ 1R9TI 5D1OA 3CC4Z 2JUBA 1K732 3M4OI 2YADA 3GTLI 2R6MA 2OZKA 3GTGI 3PO3S 5FLMI 2OTJZ 1Y1WI 3PO2I 3OW2Y 4BXXI 2OTLZ 3FQMA 1RLYA 1X0TA 4NH1C 1Q862 1N8R2 5D1PA 4E2ZA 4NBEA 3M3YI 1YIJZ 3IFUA 5D1OB 1TWFI 2BJOA 5LL6f 2VUGA 3CME1 3NDJA 2K5RA 2DE5A 1I3QI 2RT9A 3G6E1 3VMGA 4NOZA 2E2II 1VQ8Z 4A3GI 3NFZA 2LIYA 4MD9A 1YJ91 1W2BY 3IF8A 1YHQZ 3HOWI 1M902 3BG0B 2F4OA 3S2HI 3VB9A 1M1K2 1ZB8A 3RZDI 3J81f 3CC21 4A3MI 3HOXI 1TWGI 3S16I 3I55Z 1Z03A 3HOUI 4BBRI 3J81b 1VQ5Z 3CCR1 3CCS1 4DGLA 3U50C 1KQSY 4NBHA 2IZ4A 4BBSI 3VMIA 4MXUA 2E2HI 3VTNA 2GTIA 2F4MA 1K9M2 4NBCA 1YI21 4NBDA 3S1MI 3GTPI 5IP7I 1Q811 3S2DI 1P9NA 1VLAA 3S17I 1VQLZ 1NP6A 2Y0SA 2M6NA 2JA5I 3H3VJ 4X6AI 3MONA 5CM2M 1Q822 2OTJ1 2QA4Z 1RO0A 3NH5A 3I4MI 2OTL1 2QR1B 3CPWZ 3CCQZ 3GTQI 1RNIA 3CCJ1 2Q51A 1JJ2Z 1VQNZ 3CCMZ 3CCVZ 3H0GI 4A93I 2QRCB 2KI7B 2B63I 3GCFA 3K7AI 2WB1A 1RO4A 4DK1A 3HKZA 3CPWY 2P28A 3F3FC 1QVFY 5IT9b 3CQZI 4RS4A 4S1TA 2RBLA 1L1OC 4RVFA 5IT9f 4E2YA 4QTTA 2QEX1 4HGYA 1S721 1X3WA 3EERA 3GTOI 1SFOI 3Q87A 4NB9A 3PO3I 1M1K1 2QRDB 2R92I 4HGZA 1ZH1A 3CCRZ 3CCSZ 3GTMI 2JA8I 1M901 5C4XI 1NUIA 2G2KA 1TWCI 3ESWA 1VQ9Z 2GU2A 1Y1VS 3D6WA 4NFRA 3S1QI 2IZ3A 1YJW1 4A3KI 2V8IA 3HOVI 1I6HI 3CD61 4HH4A 4NBGA 1NJI1 3CXCY 2RIQA 3MZLB 4DQYB 2O53A 4A3BI 1LQLA 3T4NB 1Q861 1PFTA 3NH8A 1YJN1 2VF1A 2Q4ZA 1KRLA 2O4HA 1KC81 3CC71 1JJ2Y 2QLVB 2OOXB 3CCEZ 1N2FA 3CCQ1 2KPIA 1VQ41 3I56Z 1VQO1 3GTKI 1K731 1YITZ 3GTMS 3CCV1 1Y1VI 2PMZA 4RV9A 1Q7Y1 1TWAI 3CCLZ 4E30A 1YIJ1 3NDIA 2J6AA 4NB8A 1WW9A 3JAMb 3CC41 3HOYI 2EGTA 1USPB 4E32A 3S15I 2W03A 3JAMf 1KD12 4MH4A 2V8JA 1RQFA 2DE7A 3G6EZ 1Q821 1YUKA 3S14I 5C4JI 2H85A 2NVQI 3I4NI 1KQSZ 3TDHB 3FQQA 4Y7NI 1QVGZ 5A2Qb 2NVXI 4XX2A 1Q812 1K8A2 1QF8A 3G4S1 2JS4A 2QREB 4EWCA 2HF1A 4A3II 3CC2Z 1VQ91 2JR6A 3LUSA 4A3EI 3OW2Z 1VQ6Z 2R93I 1VQ81 1VQM1 3CMA1 4E2WA 4BY1I 3G711 2GTHA 3CD6Z 3GKQA 4RVHA 3NH4A 4A3CI 4A3JI 1YI2Z 2VUMI 4TNUA 1NJI2 2YU9I 1Q7Y2 5FLXb 1VQ51 2W04A 2M48A 1WCMI 4MD7A 1TWHI 1VQL1 1WIIA 1USPA 2E2JI 2LFUA 2E9HA 1VQ4Z 3HOZI 2QA41 4E33A 1KC82 1VQ7Z 2P3YA 3CCUZ 2HU9A 4CL1A 1VQKZ 3KIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QTU A;  3S1N I;  1R9T I;  2JNY A;  1Y1V I;  3I4M I;  3GTQ I;  3M4O I;  3GTL I;  1TWA I;  3GTG I;  3PO3 S;  5FLM I;  1Y1W I;  3PO2 I;  3GTJ I;  2J6A A;  4BXX I;  4NB8 A;  1WW9 A;  3H0G I;  4A93 I;  4BY7 I;  2B63 I;  1I50 I;  3S1R I;  4NBB A;  1RLY A;  1USP B;  3GCF A;  3K7A I;  3HOY I;  1RO4 A;  3S15 I;  4NBE A;  3M3Y I;  4MH4 A;  1TWF I;  2BJO A;  2DE7 A;  3CQZ I;  5IP9 I;  2RBL A;  1L1O C;  3FKI I;  1TFI A;  2NVY I;  5C4J I;  2NVQ I;  3I4N I;  3S14 I;  2K5R A;  2DE5 A;  2PK7 A;  4Y7N I;  5C3E I;  1I3Q I;  4QTT A;  2NVX I;  4XX2 A;  3VMG A;  2JS4 A;  4NOZ A;  1X3W A;  2HF1 A;  3EER A;  4A3I I;  3Q87 A;  4NB9 A;  1SFO I;  2E2I I;  3GTO I;  4A3G I;  3PO3 I;  2JA6 I;  2JR6 A;  3LUS A;  4A3L I;  4A3E I;  2R7Z I;  1ML8 A;  4A3F I;  3HOW I;  4NBF A;  2F4O A;  3S2H I;  2R92 I;  3VB9 A;  3VMH A;  3GTM I;  2R93 I;  2JA8 I;  1ZB8 A;  5C4X I;  3RZD I;  1NUI A;  4A3M I;  2NVT I;  1TWC I;  3ESW A;  3HOX I;  1TWG I;  1Y1V S;  3D6W A;  4BY1 I;  3S16 I;  3S1Q I;  3HOU I;  4BBR I;  3GKQ A;  4A3K I;  4A3C I;  3U50 C;  4A3D I;  4NBH A;  4A3J I;  4BBS I;  4NBA A;  3I07 A;  3VMI A;  2VUM I;  3HOV I;  1I6H I;  2YU9 I;  2E2H I;  1YUA A;  2F4M A;  4NBG A;  3RZO I;  1WCM I;  4NBC A;  1TWH I;  4Y52 I;  4NBD A;  4A3B I;  1USP A;  2E2J I;  3S1M I;  1LQL A;  1DL6 A;  2AKL A;  5C44 I;  3GTP I;  5IP7 I;  1PFT A;  3S2D I;  3HOZ I;  2DE6 A;  1VLA A;  1ZB9 A;  3S17 I;  1QYP A;  1N2F A;  3H3V J;  2JA5 I;  4X6A I;  2P3Y A;  2KPI A;  5CM2 M;  1X3Z A;  3GTK I;  2JA7 I;  1K83 I;  3GTM S; 
#chains in the Genus database with same CATH topology
 4QTU A;  1VQN 1;  3S1N I;  2I3C A;  2JNY A;  2QKD A;  2V8K A;  4RVG A;  1N8R 1;  1VQP Z;  3BG1 B;  5T67 A;  3GTJ I;  2V3V A;  1RO2 A;  4BY7 I;  5AN9 F;  1I50 I;  2OOY B;  3S1R I;  4NBB A;  3CCJ Z;  3CCM 1;  4MRI A;  5T64 A;  3J7A 4;  5IP9 I;  4RVD A;  3G4S Z;  1S72 Z;  3FKI I;  1TFI A;  2NVY I;  4E31 A;  2K3R A;  2PK7 A;  2JIO A;  2VPW A;  4MON A;  5C3E I;  1VQ6 1;  3CXC Z;  3CME Z;  3F3P C;  2JMO A;  1VQM Z;  3CMA Z;  2JA6 I;  2NAP A;  2ZAE B;  3J80 f;  4A3L I;  2R7Z I;  1ML8 A;  4A3F I;  3G71 Z;  4NBF A;  2QEX Z;  1Z01 A;  3J80 b;  3VMH A;  1JWH C;  5FLX f;  2NVT I;  3IX0 A;  1YJ9 Z;  1YHQ 1;  3P5J B;  1Z02 A;  1S7M A;  1K8A 1;  3MZK B;  4A3D I;  5A2Q f;  4NBA A;  3I07 A;  3I55 1;  1K9M 1;  1YUA A;  1YJW Z;  1YJN Z;  3RZO I;  3QWU A;  3KIH A;  4AYB A;  4Y52 I;  3CCE 1;  3D9X A;  1KD1 1;  1VQ7 1;  1DL6 A;  3CCU 1;  2AKL A;  5C44 I;  2AYD A;  3I56 1;  1VQO Z;  5T6B A;  1VQK 1;  2PM9 A;  2DE6 A;  1YIT 1;  3EED A;  1ZB9 A;  2WAQ A;  1QVF Z;  4E2X A;  1QYP A;  1QVG Y;  4MD8 A;  1X3Z A;  1VQP 1;  3TE5 B;  2JA7 I;  1K83 I;  2RHB A;  1Q16 A;  3CC7 Z;  2RPR A;  3CCL 1;  1W2B Z;  1R9T I;  5D1O A;  3CC4 Z;  2JUB A;  1K73 2;  3M4O I;  2YAD A;  3GTL I;  2R6M A;  2OZK A;  3GTG I;  3PO3 S;  5FLM I;  2OTJ Z;  1Y1W I;  3PO2 I;  3OW2 Y;  4BXX I;  2OTL Z;  3FQM A;  1RLY A;  1X0T A;  4NH1 C;  1Q86 2;  1N8R 2;  2E7Z A;  5D1P A;  4E2Z A;  4NBE A;  3M3Y I;  1YIJ Z;  3IFU A;  1Y8C A;  5D1O B;  1TWF I;  2BJO A;  5LL6 f;  2VUG A;  3CME 1;  3NDJ A;  2K5R A;  2DE5 A;  1I3Q I;  2RT9 A;  3G6E 1;  3VMG A;  4NOZ A;  2E2I I;  1VQ8 Z;  4A3G I;  2IV2 X;  3NFZ A;  2LIY A;  4MD9 A;  1YJ9 1;  1W2B Y;  3IF8 A;  1YHQ Z;  3HOW I;  1M90 2;  3BG0 B;  2F4O A;  3S2H I;  3VB9 A;  1M1K 2;  1ZB8 A;  3RZD I;  3J81 f;  3CC2 1;  4A3M I;  3HOX I;  1TWG I;  3S16 I;  3I55 Z;  1Z03 A;  3HOU I;  4BBR I;  3J81 b;  1VQ5 Z;  3CCR 1;  3CCS 1;  4DGL A;  3U50 C;  1KQS Y;  2JIP A;  4NBH A;  2IZ4 A;  4BBS I;  3VMI A;  4MXU A;  2E2H I;  3VTN A;  2GTI A;  2F4M A;  1K9M 2;  4NBC A;  1YI2 1;  4NBD A;  3S1M I;  3GTP I;  5IP7 I;  1Q81 1;  3S2D I;  1P9N A;  1VLA A;  2VPY A;  3S17 I;  1VQL Z;  1NP6 A;  2Y0S A;  2M6N A;  2JA5 I;  3H3V J;  4X6A I;  3MON A;  5CM2 M;  1Q82 2;  2OTJ 1;  2QA4 Z;  1RO0 A;  3NH5 A;  3I4M I;  2OTL 1;  2QR1 B;  3CPW Z;  3CCQ Z;  3GTQ I;  1RNI A;  3CCJ 1;  2Q51 A;  1JJ2 Z;  1VQN Z;  3CCM Z;  3CCV Z;  3H0G I;  4A93 I;  2QRC B;  2KI7 B;  2B63 I;  3GCF A;  3K7A I;  2WB1 A;  3D2L A;  1RO4 A;  4DK1 A;  3HKZ A;  3CPW Y;  2P28 A;  3F3F C;  1QVF Y;  5IT9 b;  3CQZ I;  1SIW A;  4RS4 A;  4S1T A;  2RBL A;  1L1O C;  2JIR A;  4RVF A;  5IT9 f;  1WZN A;  4E2Y A;  1WJ2 A;  4QTT A;  2QEX 1;  4HGY A;  1S72 1;  1X3W A;  3EER A;  3GTO I;  1SFO I;  3Q87 A;  4NB9 A;  3PO3 I;  1M1K 1;  2QRD B;  2R92 I;  4HGZ A;  1ZH1 A;  3CCR Z;  3CCS Z;  3GTM I;  2JA8 I;  1M90 1;  5C4X I;  1NUI A;  2VPZ A;  2G2K A;  1TWC I;  3ESW A;  1VQ9 Z;  2GU2 A;  1Y1V S;  3D6W A;  4NFR A;  3S1Q I;  2IZ3 A;  2VPX A;  1YJW 1;  4A3K I;  2V8I A;  3HOV I;  1I6H I;  3CD6 1;  4HH4 A;  4NBG A;  1NJI 1;  3CXC Y;  2RIQ A;  3MZL B;  4DQY B;  2O53 A;  4A3B I;  1LQL A;  3T4N B;  1Q86 1;  1FDI A;  1PFT A;  3NH8 A;  2VF1 A;  1YJN 1;  2Q4Z A;  1KRL A;  2O4H A;  1KC8 1;  3CC7 1;  1JJ2 Y;  2QLV B;  2OOX B;  3CCE Z;  1N2F A;  3CCQ 1;  2KPI A;  1VQ4 1;  3I56 Z;  1VQO 1;  3GTK I;  1K73 1;  1YIT Z;  3GTM S;  3CCV 1;  1Y1V I;  2PMZ A;  2V45 A;  4RV9 A;  1Q7Y 1;  1TWA I;  3CCL Z;  4E30 A;  1YIJ 1;  3NDI A;  2J6A A;  4NB8 A;  1WW9 A;  3JAM b;  3CC4 1;  3HOY I;  2EGT A;  1USP B;  4E32 A;  3S15 I;  2W03 A;  3JAM f;  1KD1 2;  4MH4 A;  2V8J A;  1RQF A;  2DE7 A;  3G6E Z;  1Q82 1;  1YUK A;  3S14 I;  5C4J I;  2H85 A;  2NVQ I;  3I4N I;  1KQS Z;  3TDH B;  3FQQ A;  4Y7N I;  1QVG Z;  5A2Q b;  2NVX I;  1AA6 A;  4XX2 A;  1Q81 2;  1K8A 2;  1QF8 A;  3G4S 1;  2JS4 A;  2QRE B;  4EWC A;  2HF1 A;  4A3I I;  2JIM A;  3CC2 Z;  1VQ9 1;  2JR6 A;  3LUS A;  1FDO A;  4A3E I;  3OW2 Z;  1VQ6 Z;  2R93 I;  1QXF A;  1VQ8 1;  1VQM 1;  3CMA 1;  4E2W A;  4BY1 I;  3G71 1;  2GTH A;  3IR7 A;  3CD6 Z;  3GKQ A;  4RVH A;  3NH4 A;  4A3C I;  4A3J I;  1YI2 Z;  2VUM I;  4TNU A;  1NJI 2;  2YU9 I;  2LEX A;  1Q7Y 2;  5FLX b;  1VQ5 1;  2W04 A;  2M48 A;  1WCM I;  4MD7 A;  1TWH I;  1VQL 1;  1WII A;  1USP A;  2E2J I;  2LFU A;  2E9H A;  1VQ4 Z;  3HOZ I;  2QA4 1;  4E33 A;  1KC8 2;  1VQ7 Z;  2P3Y A;  3CCU Z;  2HU9 A;  4CL1 A;  1VQK Z;  2JIQ A;  3KIF A; 
#chains in the Genus database with same CATH homology
 4QTU A;  1VQN 1;  3S1N I;  2I3C A;  2JNY A;  2QKD A;  2V8K A;  4RVG A;  1N8R 1;  1VQP Z;  3BG1 B;  5T67 A;  3GTJ I;  1RO2 A;  4BY7 I;  5AN9 F;  1I50 I;  2OOY B;  3S1R I;  4NBB A;  3CCJ Z;  3CCM 1;  4MRI A;  5T64 A;  3J7A 4;  5IP9 I;  4RVD A;  3G4S Z;  1S72 Z;  3FKI I;  1TFI A;  2NVY I;  4E31 A;  2K3R A;  2PK7 A;  5C3E I;  4MON A;  1VQ6 1;  3CXC Z;  3CME Z;  3F3P C;  2JMO A;  1VQM Z;  3CMA Z;  2JA6 I;  2ZAE B;  3J80 f;  4A3L I;  2R7Z I;  1ML8 A;  4A3F I;  3G71 Z;  4NBF A;  2QEX Z;  1Z01 A;  3J80 b;  3VMH A;  1JWH C;  5FLX f;  2NVT I;  3IX0 A;  1YJ9 Z;  1YHQ 1;  3P5J B;  1Z02 A;  1S7M A;  1K8A 1;  3MZK B;  4A3D I;  5A2Q f;  4NBA A;  3I07 A;  3I55 1;  1K9M 1;  1YUA A;  1YJW Z;  1YJN Z;  3RZO I;  3QWU A;  3KIH A;  4AYB A;  4Y52 I;  3CCE 1;  3D9X A;  1KD1 1;  1VQ7 1;  1DL6 A;  3CCU 1;  2AKL A;  5C44 I;  3I56 1;  1VQO Z;  5T6B A;  1VQK 1;  2PM9 A;  2DE6 A;  1YIT 1;  3EED A;  1ZB9 A;  2WAQ A;  1QVF Z;  4E2X A;  1QYP A;  1QVG Y;  4MD8 A;  1X3Z A;  1VQP 1;  3TE5 B;  2JA7 I;  1K83 I;  2RHB A;  3CC7 Z;  2RPR A;  3CCL 1;  1W2B Z;  1R9T I;  5D1O A;  3CC4 Z;  2JUB A;  1K73 2;  3M4O I;  2YAD A;  3GTL I;  2R6M A;  2OZK A;  3GTG I;  3PO3 S;  5FLM I;  2OTJ Z;  1Y1W I;  3PO2 I;  3OW2 Y;  4BXX I;  2OTL Z;  3FQM A;  1RLY A;  1X0T A;  4NH1 C;  1Q86 2;  1N8R 2;  5D1P A;  4E2Z A;  4NBE A;  3M3Y I;  1YIJ Z;  3IFU A;  5D1O B;  1TWF I;  2BJO A;  5LL6 f;  2VUG A;  3CME 1;  3NDJ A;  2K5R A;  2DE5 A;  1I3Q I;  2RT9 A;  3G6E 1;  3VMG A;  4NOZ A;  2E2I I;  1VQ8 Z;  4A3G I;  3NFZ A;  2LIY A;  4MD9 A;  1YJ9 1;  1W2B Y;  3IF8 A;  1YHQ Z;  3HOW I;  1M90 2;  3BG0 B;  2F4O A;  3S2H I;  3VB9 A;  1M1K 2;  1ZB8 A;  3RZD I;  3J81 f;  3CC2 1;  4A3M I;  3HOX I;  1TWG I;  3S16 I;  3I55 Z;  1Z03 A;  3HOU I;  4BBR I;  3J81 b;  1VQ5 Z;  3CCR 1;  3CCS 1;  4DGL A;  3U50 C;  1KQS Y;  4NBH A;  2IZ4 A;  4BBS I;  3VMI A;  4MXU A;  2E2H I;  3VTN A;  2GTI A;  2F4M A;  1K9M 2;  4NBC A;  1YI2 1;  4NBD A;  3S1M I;  3GTP I;  5IP7 I;  1Q81 1;  3S2D I;  1P9N A;  1VLA A;  3S17 I;  1VQL Z;  1NP6 A;  2Y0S A;  2M6N A;  2JA5 I;  3H3V J;  4X6A I;  3MON A;  5CM2 M;  1Q82 2;  2OTJ 1;  2QA4 Z;  1RO0 A;  3NH5 A;  3I4M I;  2OTL 1;  2QR1 B;  3CPW Z;  3CCQ Z;  3GTQ I;  1RNI A;  3CCJ 1;  2Q51 A;  1JJ2 Z;  1VQN Z;  3CCM Z;  3CCV Z;  3H0G I;  4A93 I;  2QRC B;  2KI7 B;  2B63 I;  3GCF A;  3K7A I;  2WB1 A;  1RO4 A;  4DK1 A;  3HKZ A;  3CPW Y;  2P28 A;  3F3F C;  1QVF Y;  5IT9 b;  3CQZ I;  4RS4 A;  4S1T A;  2RBL A;  1L1O C;  4RVF A;  5IT9 f;  4E2Y A;  4QTT A;  2QEX 1;  4HGY A;  1S72 1;  1X3W A;  3EER A;  3GTO I;  1SFO I;  3Q87 A;  4NB9 A;  3PO3 I;  1M1K 1;  2QRD B;  2R92 I;  4HGZ A;  1ZH1 A;  3CCR Z;  3CCS Z;  3GTM I;  2JA8 I;  1M90 1;  5C4X I;  1NUI A;  2G2K A;  1TWC I;  3ESW A;  1VQ9 Z;  2GU2 A;  1Y1V S;  3D6W A;  4NFR A;  3S1Q I;  2IZ3 A;  1YJW 1;  4A3K I;  2V8I A;  3HOV I;  1I6H I;  3CD6 1;  4HH4 A;  4NBG A;  1NJI 1;  3CXC Y;  2RIQ A;  3MZL B;  4DQY B;  2O53 A;  4A3B I;  1LQL A;  3T4N B;  1Q86 1;  1PFT A;  3NH8 A;  1YJN 1;  2VF1 A;  2Q4Z A;  1KRL A;  2O4H A;  1KC8 1;  3CC7 1;  1JJ2 Y;  2QLV B;  2OOX B;  3CCE Z;  1N2F A;  3CCQ 1;  2KPI A;  1VQ4 1;  3I56 Z;  1VQO 1;  3GTK I;  1K73 1;  1YIT Z;  3GTM S;  3CCV 1;  1Y1V I;  2PMZ A;  4RV9 A;  1Q7Y 1;  1TWA I;  3CCL Z;  4E30 A;  1YIJ 1;  3NDI A;  2J6A A;  4NB8 A;  1WW9 A;  3JAM b;  3CC4 1;  3HOY I;  2EGT A;  1USP B;  4E32 A;  3S15 I;  2W03 A;  3JAM f;  1KD1 2;  4MH4 A;  2V8J A;  1RQF A;  2DE7 A;  3G6E Z;  1Q82 1;  1YUK A;  3S14 I;  5C4J I;  2H85 A;  2NVQ I;  3I4N I;  1KQS Z;  3TDH B;  3FQQ A;  4Y7N I;  1QVG Z;  5A2Q b;  2NVX I;  4XX2 A;  1Q81 2;  1K8A 2;  1QF8 A;  3G4S 1;  2JS4 A;  2QRE B;  4EWC A;  2HF1 A;  4A3I I;  3CC2 Z;  1VQ9 1;  2JR6 A;  3LUS A;  4A3E I;  3OW2 Z;  1VQ6 Z;  2R93 I;  1VQ8 1;  1VQM 1;  3CMA 1;  4E2W A;  4BY1 I;  3G71 1;  2GTH A;  3CD6 Z;  3GKQ A;  4RVH A;  3NH4 A;  4A3C I;  4A3J I;  1YI2 Z;  2VUM I;  4TNU A;  1NJI 2;  2YU9 I;  1Q7Y 2;  5FLX b;  1VQ5 1;  2W04 A;  2M48 A;  1WCM I;  4MD7 A;  1TWH I;  1VQL 1;  1WII A;  1USP A;  2E2J I;  2LFU A;  2E9H A;  1VQ4 Z;  3HOZ I;  2QA4 1;  4E33 A;  1KC8 2;  1VQ7 Z;  2P3Y A;  3CCU Z;  2HU9 A;  4CL1 A;  1VQK Z;  3KIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...