4DGLA

Crystal structure of the ck2 tetrameric holoenzyme
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
208
structure length
200
Chain Sequence
SWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Casein kinase II subunit beta
publication title Structural determinants of protein kinase CK2 regulation by autoinhibitory polymerization.
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 200
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01214 CK_II_beta Casein kinase II regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1820.10 Mainly Alpha Orthogonal Bundle protein kinase ck2 holoenzyme, chain C, domain 1 protein kinase ck2 holoenzyme, chain C, domain 1 4dglA01
2.20.25.20 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4dglA02
2JMOA 1JWHC 4MD7A 2M48A 4NH1C 2M6NA 1RQFA 3EEDA 4DGLA 2R6MA 1QF8A 4MD8A 4MD9A 2RT9A
chains in the Genus database with same CATH superfamily
3Q87A 1N2FA 2HF1A 4NB8A 3CMEZ 2Q4ZA 2R93I 4RS4A 3CPWY 4E2ZA 2QRCB 2V3VA 3PO3S 2IZ3A 1YIJ1 3CCEZ 1YI2Z 1X3WA 3G71Z 2W03A 1Q821 2V45A 4NB9A 3GCFA 1TWAI 3K7AI 2JIMA 3CCQZ 2ZAEB 2F4MA 1Q812 2HU9A 1Z03A 2R6MA 1M902 2JUBA 1QVGY 3CC4Z 3GKQA 3CCSZ 1Q16A 4MD8A 4RVDA 2RBLA 3NDIA 2NVTI 1Q811 3CCU1 3IFUA 2QEX1 1VQ8Z 1M901 1QVFY 1YIJZ 3J81b 1K8A2 2JIPA 3CPWZ 2YADA 1SIWA 3H0GI 3D9XA 2JIOA 1YJ91 1DL6A 4AYBA 1Q861 2VF1A 2QR1B 3S17I 2JA6I 3HOWI 1VQL1 2KPIA 4A3KI 2NVXI 3M4OI 2AKLA 1PFTA 1Q7Y2 3GTLI 2F4OA 2J6AA 4HGYA 2JNYA 1QVGZ 3I561 3S15I 4NBFA 1K83I 4MD9A 2JA5I 4E30A 4A3CI 2VPZA 3JAMb 3CCUZ 5T67A 4BY7I 1I3QI 1YJN1 1N8R2 2AYDA 2QEXZ 2RT9A 2JA7I 1TWFI 3FKII 1SFOI 2KI7B 2VPXA 2LIYA 4EWCA 3KIFA 4A3GI 1ZB9A 2O53A 1VQLZ 3BG0B 1RO2A 3GTGI 1VQO1 1FDOA 2QREB 3MZKB 3CCV1 3PO2I 5LL6f 1X3ZA 1VQN1 3I56Z 3MZLB 1YUKA 5T6BA 1QYPA 1R9TI 4CL1A 3S2HI 1YJNZ 5IP7I 3QWUA 2E2II 2JMOA 3EEDA 2GTHA 3J80f 1WIIA 1NJI2 3FQMA 3MONA 3GTMI 2M48A 4NBCA 1VQM1 4BBSI 1VQOZ 2B63I 4XX2A 3CC41 2VUMI 1VLAA 1Z01A 4TNUA 1NJI1 4X6AI 1S7MA 1ML8A 4E2XA 5A2Qf 3NDJA 3VMGA 1VQ61 2QLVB 3NFZA 1Y1WI 5T64A 1VQ81 4NBHA 4MD7A 3BG1B 1TWGI 1TFIA 3HOVI 2OOYB 3GTJI 3GTMS 4A3MI 3CC7Z 1JWHC 1K9M2 4NBDA 1RNIA 3S1MI 4DGLA 5C4JI 1VQMZ 1WCMI 1Y1VI 1ZB8A 3IF8A 3CCL1 2QRDB 4Y52I 4NH1C 1K9M1 3D2LA 1M1K2 2OTL1 4A3BI 2PK7A 1VQ6Z 3OW2Y 4RVGA 2LFUA 4A3EI 5FLXf 3VMHA 1KRLA 3S1NI 2PM9A 2IZ4A 3NH8A 3HOXI 1M1K1 3I551 1Y1VS 4DQYB 3VMIA 2QA4Z 5FLMI 2E9HA 5D1PA 2V8IA 1K8A1 4RV9A 3CCLZ 3H3VJ 1RO4A 2JA8I 1Z02A 4NBGA 3J7A4 2OTLZ 1VQ5Z 2P3YA 3HOUI 1KD12 2G2KA 3S1QI 1Q7Y1 1KC82 3OW2Z 4A3DI 2JS4A 5CM2M 2BJOA 4MONA 5IP9I 3TE5B 3I55Z 2YU9I 2R7ZI 2OZKA 5C44I 1VQ71 1KD11 1N8R1 1L1OC 1YHQ1 1FDIA 3J81f 1NUIA 4Y7NI 3CXCY 3CCM1 2R92I 2GTIA 2I3CA 2LEXA 2RIQA 4MH4A 2NAPA 1QXFA 4RVHA 4A3JI 1S72Z 2O4HA 4E32A 3M3YI 1VQPZ 4A93I 2DE5A 3CC71 3RZDI 3U50C 3G6EZ 3KIHA 3JAMf 5IT9f 1VQ7Z 1ZH1A 1YHQZ 1TWCI 4BY1I 2H85A 3CCMZ 2K3RA 3S2DI 3EERA 3CXCZ 2E7ZA 2WAQA 1P9NA 1K732 1LQLA 1YJW1 3CD61 1YITZ 4NFRA 2NVYI 4S1TA 2OTJZ 2IV2X 3S1RI 3PO3I 3T4NB 4BBRI 3TDHB 3P5JB 1K731 3G4S1 2M6NA 3CCR1 3GTPI 4E2WA 3RZOI 2OOXB 2DE7A 3F3PC 4NBAA 2QA41 2JIRA 3NH4A 1Q822 4E2YA 1I6HI 3HOZI 3HOYI 4A3FI 2VPYA 3CMA1 1YJWZ 3CD6Z 1VQ51 5D1OA 1W2BZ 2EGTA 2JR6A 3FQQA 4A3LI 2GU2A 1X0TA 2V8JA 4E33A 2DE6A 1USPA 3I4NI 2E2HI 4QTTA 3G4SZ 3CCRZ 3LUSA 4BXXI 1WW9A 1WZNA 1Q862 3GTQI 1QF8A 3CMAZ 2QKDA 3VTNA 3IX0A 1S721 1KQSY 3NH5A 3ESWA 1VQP1 1VQ91 1RQFA 2JIQA 2RHBA 3G6E1 3VB9A 3J80b 1Y8CA 5C4XI 2NVQI 3HKZA 2PMZA 2WB1A 2P28A 1KC81 5IT9b 2RPRA 4QTUA 1TWHI 3GTOI 1NP6A 1RLYA 1YIT1 1QVFZ 1YJ9Z 2OTJ1 4RVFA 4NOZA 5A2Qb 1JJ2Y 4A3II 1KQSZ 3GTKI 1I50I 1VQ9Z 3CCJ1 5D1OB 1VQK1 3CC21 1VQ41 3IR7A 1RO0A 1USPB 2V8KA 4MRIA 2K5RA 3I07A 4NBEA 3I4MI 4NBBA 3CME1 2W04A 2VPWA 3F3FC 3S16I 1W2BY 5AN9F 3CCE1 1YI21 4E31A 4DK1A 1AA6A 2VUGA 4HGZA 3G711 1YUAA 2Y0SA 3CCQ1 4HH4A 3D6WA 3CCJZ 1JJ2Z 1VQKZ 5FLXb 1WJ2A 3S14I 3CCVZ 3CC2Z 3CQZI 1VQ4Z 3CCS1 1VQNZ 4MXUA 2Q51A 5C3EI 2E2JI
chains in the Genus database with same CATH topology
3Q87A 1N2FA 2HF1A 4NB8A 3CMEZ 2Q4ZA 2R93I 4RS4A 3CPWY 4E2ZA 2QRCB 3PO3S 2IZ3A 1YIJ1 3CCEZ 1YI2Z 1X3WA 3G71Z 2W03A 1Q821 4NB9A 3GCFA 1TWAI 3K7AI 3CCQZ 2ZAEB 2F4MA 1Q812 2HU9A 1Z03A 2R6MA 1M902 2JUBA 1QVGY 3CC4Z 3GKQA 3CCSZ 4MD8A 4RVDA 2RBLA 3NDIA 2NVTI 1Q811 3CCU1 3IFUA 2QEX1 1VQ8Z 1M901 1QVFY 1YIJZ 3J81b 1K8A2 3CPWZ 2YADA 3H0GI 3D9XA 1YJ91 1DL6A 4AYBA 1Q861 2VF1A 2QR1B 3S17I 2JA6I 3HOWI 1VQL1 2KPIA 4A3KI 2NVXI 3M4OI 2AKLA 1PFTA 1Q7Y2 3GTLI 2F4OA 2J6AA 4HGYA 2JNYA 1QVGZ 3I561 3S15I 4NBFA 1K83I 4MD9A 2JA5I 4E30A 4A3CI 3JAMb 3CCUZ 5T67A 4BY7I 1I3QI 1YJN1 1N8R2 2QEXZ 2RT9A 2JA7I 1TWFI 3FKII 1SFOI 2KI7B 2LIYA 4EWCA 3KIFA 4A3GI 1ZB9A 2O53A 1VQLZ 3BG0B 1RO2A 3GTGI 1VQO1 2QREB 3MZKB 3CCV1 3PO2I 5LL6f 1X3ZA 1VQN1 3I56Z 3MZLB 1YUKA 5T6BA 1QYPA 1R9TI 4CL1A 3S2HI 1YJNZ 5IP7I 3QWUA 2E2II 2JMOA 3EEDA 2GTHA 3J80f 1WIIA 1NJI2 3FQMA 3MONA 3GTMI 2M48A 4NBCA 1VQM1 4BBSI 1VQOZ 2B63I 4XX2A 3CC41 2VUMI 1VLAA 1Z01A 4TNUA 1NJI1 4X6AI 1S7MA 1ML8A 4E2XA 5A2Qf 3NDJA 3VMGA 1VQ61 2QLVB 3NFZA 1Y1WI 5T64A 1VQ81 4NBHA 4MD7A 3BG1B 1TWGI 1TFIA 3HOVI 2OOYB 3GTJI 3GTMS 4A3MI 3CC7Z 1JWHC 1K9M2 4NBDA 1RNIA 3S1MI 4DGLA 5C4JI 1VQMZ 1WCMI 1Y1VI 1ZB8A 3IF8A 3CCL1 2QRDB 4Y52I 4NH1C 1K9M1 1M1K2 2OTL1 4A3BI 2PK7A 1VQ6Z 3OW2Y 4RVGA 2LFUA 4A3EI 5FLXf 3VMHA 1KRLA 3S1NI 2PM9A 2IZ4A 3NH8A 3HOXI 1M1K1 3I551 1Y1VS 4DQYB 3VMIA 2QA4Z 5FLMI 2E9HA 5D1PA 2V8IA 1K8A1 4RV9A 3CCLZ 3H3VJ 1RO4A 2JA8I 1Z02A 4NBGA 3J7A4 2OTLZ 1VQ5Z 2P3YA 3HOUI 1KD12 2G2KA 3S1QI 1Q7Y1 1KC82 3OW2Z 4A3DI 2JS4A 5CM2M 2BJOA 4MONA 5IP9I 3TE5B 3I55Z 2YU9I 2R7ZI 2OZKA 5C44I 1VQ71 1KD11 1N8R1 1L1OC 1YHQ1 3J81f 1NUIA 4Y7NI 3CXCY 3CCM1 2R92I 2GTIA 2I3CA 2RIQA 4MH4A 4RVHA 4A3JI 1S72Z 2O4HA 4E32A 3M3YI 1VQPZ 4A93I 2DE5A 3CC71 3RZDI 3U50C 3G6EZ 3KIHA 3JAMf 5IT9f 1VQ7Z 1ZH1A 1YHQZ 1TWCI 4BY1I 2H85A 3CCMZ 2K3RA 3S2DI 3EERA 3CXCZ 2WAQA 1P9NA 1K732 1LQLA 1YJW1 3CD61 1YITZ 4NFRA 2NVYI 4S1TA 2OTJZ 3S1RI 3PO3I 3T4NB 4BBRI 3TDHB 3P5JB 1K731 3G4S1 2M6NA 3CCR1 3GTPI 4E2WA 3RZOI 2OOXB 2DE7A 3F3PC 4NBAA 2QA41 3NH4A 1Q822 4E2YA 1I6HI 3HOZI 3HOYI 4A3FI 3CMA1 1YJWZ 3CD6Z 1VQ51 5D1OA 1W2BZ 2EGTA 2JR6A 3FQQA 4A3LI 2GU2A 1X0TA 2V8JA 4E33A 2DE6A 1USPA 3I4NI 2E2HI 4QTTA 3G4SZ 3CCRZ 3LUSA 4BXXI 1WW9A 1Q862 3GTQI 1QF8A 3CMAZ 2QKDA 3VTNA 3IX0A 1S721 1KQSY 3NH5A 3ESWA 1VQP1 1VQ91 1RQFA 2RHBA 3G6E1 3VB9A 3J80b 5C4XI 2NVQI 3HKZA 2PMZA 2WB1A 2P28A 1KC81 5IT9b 2RPRA 4QTUA 1TWHI 3GTOI 1NP6A 1RLYA 1YIT1 1QVFZ 1YJ9Z 2OTJ1 4RVFA 4NOZA 5A2Qb 1JJ2Y 4A3II 1KQSZ 3GTKI 1I50I 1VQ9Z 3CCJ1 5D1OB 1VQK1 3CC21 1VQ41 1RO0A 1USPB 2V8KA 4MRIA 2K5RA 3I07A 4NBEA 3I4MI 4NBBA 3CME1 2W04A 3F3FC 3S16I 1W2BY 5AN9F 3CCE1 1YI21 4E31A 4DK1A 2VUGA 4HGZA 3G711 1YUAA 2Y0SA 3CCQ1 4HH4A 3D6WA 3CCJZ 1JJ2Z 1VQKZ 5FLXb 3S14I 3CCVZ 3CC2Z 3CQZI 1VQ4Z 3CCS1 1VQNZ 4MXUA 2Q51A 5C3EI 2E2JI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JMO A;  1JWH C;  4MD7 A;  2M48 A;  4NH1 C;  2M6N A;  1RQF A;  3EED A;  4DGL A;  2R6M A;  1QF8 A;  4MD8 A;  4MD9 A;  2RT9 A; 
#chains in the Genus database with same CATH topology
 3Q87 A;  1N2F A;  2HF1 A;  4NB8 A;  3CME Z;  2Q4Z A;  2R93 I;  4RS4 A;  3CPW Y;  4E2Z A;  2QRC B;  2V3V A;  3PO3 S;  2IZ3 A;  1YIJ 1;  3CCE Z;  1YI2 Z;  1X3W A;  3G71 Z;  2W03 A;  1Q82 1;  2V45 A;  4NB9 A;  3GCF A;  1TWA I;  3K7A I;  2JIM A;  3CCQ Z;  2ZAE B;  2F4M A;  1Q81 2;  2HU9 A;  1Z03 A;  2R6M A;  1M90 2;  2JUB A;  1QVG Y;  3CC4 Z;  3GKQ A;  3CCS Z;  1Q16 A;  4MD8 A;  4RVD A;  2RBL A;  3NDI A;  2NVT I;  1Q81 1;  3CCU 1;  3IFU A;  2QEX 1;  1VQ8 Z;  1M90 1;  1QVF Y;  1YIJ Z;  3J81 b;  1K8A 2;  2JIP A;  3CPW Z;  2YAD A;  1SIW A;  3H0G I;  3D9X A;  2JIO A;  1YJ9 1;  1DL6 A;  4AYB A;  1Q86 1;  2VF1 A;  2QR1 B;  3S17 I;  2JA6 I;  3HOW I;  1VQL 1;  2KPI A;  4A3K I;  2NVX I;  3M4O I;  2AKL A;  1PFT A;  1Q7Y 2;  3GTL I;  2F4O A;  2J6A A;  4HGY A;  2JNY A;  1QVG Z;  3I56 1;  3S15 I;  4NBF A;  1K83 I;  4MD9 A;  2JA5 I;  4E30 A;  4A3C I;  2VPZ A;  3JAM b;  3CCU Z;  5T67 A;  4BY7 I;  1I3Q I;  1YJN 1;  1N8R 2;  2AYD A;  2QEX Z;  2RT9 A;  2JA7 I;  1TWF I;  3FKI I;  1SFO I;  2KI7 B;  2VPX A;  2LIY A;  4EWC A;  3KIF A;  4A3G I;  1ZB9 A;  2O53 A;  1VQL Z;  3BG0 B;  1RO2 A;  3GTG I;  1VQO 1;  1FDO A;  2QRE B;  3MZK B;  3CCV 1;  3PO2 I;  5LL6 f;  1X3Z A;  1VQN 1;  3I56 Z;  3MZL B;  1YUK A;  5T6B A;  1QYP A;  1R9T I;  4CL1 A;  3S2H I;  1YJN Z;  5IP7 I;  3QWU A;  2E2I I;  2JMO A;  3EED A;  2GTH A;  3J80 f;  1WII A;  1NJI 2;  3FQM A;  3MON A;  3GTM I;  2M48 A;  4NBC A;  1VQM 1;  4BBS I;  1VQO Z;  2B63 I;  4XX2 A;  3CC4 1;  2VUM I;  1VLA A;  1Z01 A;  4TNU A;  1NJI 1;  4X6A I;  1S7M A;  1ML8 A;  4E2X A;  5A2Q f;  3NDJ A;  3VMG A;  1VQ6 1;  2QLV B;  3NFZ A;  1Y1W I;  5T64 A;  1VQ8 1;  4NBH A;  4MD7 A;  3BG1 B;  1TWG I;  1TFI A;  3HOV I;  2OOY B;  3GTJ I;  3GTM S;  4A3M I;  3CC7 Z;  1JWH C;  1K9M 2;  4NBD A;  1RNI A;  3S1M I;  4DGL A;  5C4J I;  1VQM Z;  1WCM I;  1Y1V I;  1ZB8 A;  3IF8 A;  3CCL 1;  2QRD B;  4Y52 I;  4NH1 C;  1K9M 1;  3D2L A;  1M1K 2;  2OTL 1;  4A3B I;  2PK7 A;  1VQ6 Z;  3OW2 Y;  4RVG A;  2LFU A;  4A3E I;  5FLX f;  3VMH A;  1KRL A;  3S1N I;  2PM9 A;  2IZ4 A;  3NH8 A;  3HOX I;  1M1K 1;  3I55 1;  1Y1V S;  4DQY B;  3VMI A;  2QA4 Z;  5FLM I;  2E9H A;  5D1P A;  2V8I A;  1K8A 1;  4RV9 A;  3CCL Z;  3H3V J;  1RO4 A;  2JA8 I;  1Z02 A;  4NBG A;  3J7A 4;  2OTL Z;  1VQ5 Z;  2P3Y A;  3HOU I;  1KD1 2;  2G2K A;  3S1Q I;  1Q7Y 1;  1KC8 2;  3OW2 Z;  4A3D I;  2JS4 A;  5CM2 M;  2BJO A;  4MON A;  5IP9 I;  3TE5 B;  3I55 Z;  2YU9 I;  2R7Z I;  2OZK A;  5C44 I;  1VQ7 1;  1KD1 1;  1N8R 1;  1L1O C;  1YHQ 1;  1FDI A;  3J81 f;  1NUI A;  4Y7N I;  3CXC Y;  3CCM 1;  2R92 I;  2GTI A;  2I3C A;  2LEX A;  2RIQ A;  4MH4 A;  2NAP A;  1QXF A;  4RVH A;  4A3J I;  1S72 Z;  2O4H A;  4E32 A;  3M3Y I;  1VQP Z;  4A93 I;  2DE5 A;  3CC7 1;  3RZD I;  3U50 C;  3G6E Z;  3KIH A;  3JAM f;  5IT9 f;  1VQ7 Z;  1ZH1 A;  1YHQ Z;  1TWC I;  4BY1 I;  2H85 A;  3CCM Z;  2K3R A;  3S2D I;  3EER A;  3CXC Z;  2E7Z A;  2WAQ A;  1P9N A;  1K73 2;  1LQL A;  1YJW 1;  3CD6 1;  1YIT Z;  4NFR A;  2NVY I;  4S1T A;  2OTJ Z;  2IV2 X;  3S1R I;  3PO3 I;  3T4N B;  4BBR I;  3TDH B;  3P5J B;  1K73 1;  3G4S 1;  2M6N A;  3CCR 1;  3GTP I;  4E2W A;  3RZO I;  2OOX B;  2DE7 A;  3F3P C;  4NBA A;  2QA4 1;  2JIR A;  3NH4 A;  1Q82 2;  4E2Y A;  1I6H I;  3HOZ I;  3HOY I;  4A3F I;  2VPY A;  3CMA 1;  1YJW Z;  3CD6 Z;  1VQ5 1;  5D1O A;  1W2B Z;  2EGT A;  2JR6 A;  3FQQ A;  4A3L I;  2GU2 A;  1X0T A;  2V8J A;  4E33 A;  2DE6 A;  1USP A;  3I4N I;  2E2H I;  4QTT A;  3G4S Z;  3CCR Z;  3LUS A;  4BXX I;  1WW9 A;  1WZN A;  1Q86 2;  3GTQ I;  1QF8 A;  3CMA Z;  2QKD A;  3VTN A;  3IX0 A;  1S72 1;  1KQS Y;  3NH5 A;  3ESW A;  1VQP 1;  1VQ9 1;  1RQF A;  2JIQ A;  2RHB A;  3G6E 1;  3VB9 A;  3J80 b;  1Y8C A;  5C4X I;  2NVQ I;  3HKZ A;  2PMZ A;  2WB1 A;  2P28 A;  1KC8 1;  5IT9 b;  2RPR A;  4QTU A;  1TWH I;  3GTO I;  1NP6 A;  1RLY A;  1YIT 1;  1QVF Z;  1YJ9 Z;  2OTJ 1;  4RVF A;  4NOZ A;  5A2Q b;  1JJ2 Y;  4A3I I;  1KQS Z;  3GTK I;  1I50 I;  1VQ9 Z;  3CCJ 1;  5D1O B;  1VQK 1;  3CC2 1;  1VQ4 1;  3IR7 A;  1RO0 A;  1USP B;  2V8K A;  4MRI A;  2K5R A;  3I07 A;  4NBE A;  3I4M I;  4NBB A;  3CME 1;  2W04 A;  2VPW A;  3F3F C;  3S16 I;  1W2B Y;  5AN9 F;  3CCE 1;  1YI2 1;  4E31 A;  4DK1 A;  1AA6 A;  2VUG A;  4HGZ A;  3G71 1;  1YUA A;  2Y0S A;  3CCQ 1;  4HH4 A;  3D6W A;  3CCJ Z;  1JJ2 Z;  1VQK Z;  5FLX b;  1WJ2 A;  3S14 I;  3CCV Z;  3CC2 Z;  3CQZ I;  1VQ4 Z;  3CCS 1;  1VQN Z;  4MXU A;  2Q51 A;  5C3E I;  2E2J I; 
#chains in the Genus database with same CATH homology
 3Q87 A;  1N2F A;  2HF1 A;  4NB8 A;  3CME Z;  2Q4Z A;  2R93 I;  4RS4 A;  3CPW Y;  4E2Z A;  2QRC B;  3PO3 S;  2IZ3 A;  1YIJ 1;  3CCE Z;  1YI2 Z;  1X3W A;  3G71 Z;  2W03 A;  1Q82 1;  4NB9 A;  3GCF A;  1TWA I;  3K7A I;  3CCQ Z;  2ZAE B;  2F4M A;  1Q81 2;  2HU9 A;  1Z03 A;  2R6M A;  1M90 2;  2JUB A;  1QVG Y;  3CC4 Z;  3GKQ A;  3CCS Z;  4MD8 A;  4RVD A;  2RBL A;  3NDI A;  2NVT I;  1Q81 1;  3CCU 1;  3IFU A;  2QEX 1;  1VQ8 Z;  1M90 1;  1QVF Y;  1YIJ Z;  3J81 b;  1K8A 2;  3CPW Z;  2YAD A;  3H0G I;  3D9X A;  1YJ9 1;  1DL6 A;  4AYB A;  1Q86 1;  2VF1 A;  2QR1 B;  3S17 I;  2JA6 I;  3HOW I;  1VQL 1;  2KPI A;  4A3K I;  2NVX I;  3M4O I;  2AKL A;  1PFT A;  1Q7Y 2;  3GTL I;  2F4O A;  2J6A A;  4HGY A;  2JNY A;  1QVG Z;  3I56 1;  3S15 I;  4NBF A;  1K83 I;  4MD9 A;  2JA5 I;  4E30 A;  4A3C I;  3JAM b;  3CCU Z;  5T67 A;  4BY7 I;  1I3Q I;  1YJN 1;  1N8R 2;  2QEX Z;  2RT9 A;  2JA7 I;  1TWF I;  3FKI I;  1SFO I;  2KI7 B;  2LIY A;  4EWC A;  3KIF A;  4A3G I;  1ZB9 A;  2O53 A;  1VQL Z;  3BG0 B;  1RO2 A;  3GTG I;  1VQO 1;  2QRE B;  3MZK B;  3CCV 1;  3PO2 I;  5LL6 f;  1X3Z A;  1VQN 1;  3I56 Z;  3MZL B;  1YUK A;  5T6B A;  1QYP A;  1R9T I;  4CL1 A;  3S2H I;  1YJN Z;  5IP7 I;  3QWU A;  2E2I I;  2JMO A;  3EED A;  2GTH A;  3J80 f;  1WII A;  1NJI 2;  3FQM A;  3MON A;  3GTM I;  2M48 A;  4NBC A;  1VQM 1;  4BBS I;  1VQO Z;  2B63 I;  4XX2 A;  3CC4 1;  2VUM I;  1VLA A;  1Z01 A;  4TNU A;  1NJI 1;  4X6A I;  1S7M A;  1ML8 A;  4E2X A;  5A2Q f;  3NDJ A;  3VMG A;  1VQ6 1;  2QLV B;  3NFZ A;  1Y1W I;  5T64 A;  1VQ8 1;  4NBH A;  4MD7 A;  3BG1 B;  1TWG I;  1TFI A;  3HOV I;  2OOY B;  3GTJ I;  3GTM S;  4A3M I;  3CC7 Z;  1JWH C;  1K9M 2;  4NBD A;  1RNI A;  3S1M I;  4DGL A;  5C4J I;  1VQM Z;  1WCM I;  1Y1V I;  1ZB8 A;  3IF8 A;  3CCL 1;  2QRD B;  4Y52 I;  4NH1 C;  1K9M 1;  1M1K 2;  2OTL 1;  4A3B I;  2PK7 A;  1VQ6 Z;  3OW2 Y;  4RVG A;  2LFU A;  4A3E I;  5FLX f;  3VMH A;  1KRL A;  3S1N I;  2PM9 A;  2IZ4 A;  3NH8 A;  3HOX I;  1M1K 1;  3I55 1;  1Y1V S;  4DQY B;  3VMI A;  2QA4 Z;  5FLM I;  2E9H A;  5D1P A;  2V8I A;  1K8A 1;  4RV9 A;  3CCL Z;  3H3V J;  1RO4 A;  2JA8 I;  1Z02 A;  4NBG A;  3J7A 4;  2OTL Z;  1VQ5 Z;  2P3Y A;  3HOU I;  1KD1 2;  2G2K A;  3S1Q I;  1Q7Y 1;  1KC8 2;  3OW2 Z;  4A3D I;  2JS4 A;  5CM2 M;  2BJO A;  4MON A;  5IP9 I;  3TE5 B;  3I55 Z;  2YU9 I;  2R7Z I;  2OZK A;  5C44 I;  1VQ7 1;  1KD1 1;  1N8R 1;  1L1O C;  1YHQ 1;  3J81 f;  1NUI A;  4Y7N I;  3CXC Y;  3CCM 1;  2R92 I;  2GTI A;  2I3C A;  2RIQ A;  4MH4 A;  4RVH A;  4A3J I;  1S72 Z;  2O4H A;  4E32 A;  3M3Y I;  1VQP Z;  4A93 I;  2DE5 A;  3CC7 1;  3RZD I;  3U50 C;  3G6E Z;  3KIH A;  3JAM f;  5IT9 f;  1VQ7 Z;  1ZH1 A;  1YHQ Z;  1TWC I;  4BY1 I;  2H85 A;  3CCM Z;  2K3R A;  3S2D I;  3EER A;  3CXC Z;  2WAQ A;  1P9N A;  1K73 2;  1LQL A;  1YJW 1;  3CD6 1;  1YIT Z;  4NFR A;  2NVY I;  4S1T A;  2OTJ Z;  3S1R I;  3PO3 I;  3T4N B;  4BBR I;  3TDH B;  3P5J B;  1K73 1;  3G4S 1;  2M6N A;  3CCR 1;  3GTP I;  4E2W A;  3RZO I;  2OOX B;  2DE7 A;  3F3P C;  4NBA A;  2QA4 1;  3NH4 A;  1Q82 2;  4E2Y A;  1I6H I;  3HOZ I;  3HOY I;  4A3F I;  3CMA 1;  1YJW Z;  3CD6 Z;  1VQ5 1;  5D1O A;  1W2B Z;  2EGT A;  2JR6 A;  3FQQ A;  4A3L I;  2GU2 A;  1X0T A;  2V8J A;  4E33 A;  2DE6 A;  1USP A;  3I4N I;  2E2H I;  4QTT A;  3G4S Z;  3CCR Z;  3LUS A;  4BXX I;  1WW9 A;  1Q86 2;  3GTQ I;  1QF8 A;  3CMA Z;  2QKD A;  3VTN A;  3IX0 A;  1S72 1;  1KQS Y;  3NH5 A;  3ESW A;  1VQP 1;  1VQ9 1;  1RQF A;  2RHB A;  3G6E 1;  3VB9 A;  3J80 b;  5C4X I;  2NVQ I;  3HKZ A;  2PMZ A;  2WB1 A;  2P28 A;  1KC8 1;  5IT9 b;  2RPR A;  4QTU A;  1TWH I;  3GTO I;  1NP6 A;  1RLY A;  1YIT 1;  1QVF Z;  1YJ9 Z;  2OTJ 1;  4RVF A;  4NOZ A;  5A2Q b;  1JJ2 Y;  4A3I I;  1KQS Z;  3GTK I;  1I50 I;  1VQ9 Z;  3CCJ 1;  5D1O B;  1VQK 1;  3CC2 1;  1VQ4 1;  1RO0 A;  1USP B;  2V8K A;  4MRI A;  2K5R A;  3I07 A;  4NBE A;  3I4M I;  4NBB A;  3CME 1;  2W04 A;  3F3F C;  3S16 I;  1W2B Y;  5AN9 F;  3CCE 1;  1YI2 1;  4E31 A;  4DK1 A;  2VUG A;  4HGZ A;  3G71 1;  1YUA A;  2Y0S A;  3CCQ 1;  4HH4 A;  3D6W A;  3CCJ Z;  1JJ2 Z;  1VQK Z;  5FLX b;  3S14 I;  3CCV Z;  3CC2 Z;  3CQZ I;  1VQ4 Z;  3CCS 1;  1VQN Z;  4MXU A;  2Q51 A;  5C3E I;  2E2J I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...