4DGLA

Crystal structure of the ck2 tetrameric holoenzyme
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
208
structure length
200
Chain Sequence
SWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Casein kinase II subunit beta
publication title Structural determinants of protein kinase CK2 regulation by autoinhibitory polymerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 48
structure length 200
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01214 CK_II_beta Casein kinase II regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1820.10 Mainly Alpha Orthogonal Bundle protein kinase ck2 holoenzyme, chain C, domain 1 protein kinase ck2 holoenzyme, chain C, domain 1 4dglA01
2.20.25.20 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4dglA02
4MD8A 2R6MA 2JMOA 4NH1C 4MD7A 1QF8A 1JWHC 2M6NA 2RT9A 4DGLA 3EEDA 2M48A 4MD9A 1RQFA
chains in the Genus database with same CATH superfamily
3I4NI 2OOXB 3D2LA 2HU9A 1USPA 2QEXZ 4BBRI 4S1TA 1ML8A 3TDHB 1S72Z 4X6AI 4E30A 2E2HI 3J81f 1K731 3S1RI 2QA4Z 3GTLI 3BG0B 2ZAEB 3I551 1SIWA 1ZH1A 1WJ2A 5IT9b 4NBGA 4QTTA 3VB9A 3G6E1 3HKZA 2NAPA 3CCQ1 1I6HI 1WW9A 1VQNZ 4BY1I 2O53A 4HGYA 2RBLA 2R7ZI 3FQQA 1VQP1 4QTUA 1I3QI 2QRCB 1S7MA 3MZLB 2QREB 3VMGA 3GTMI 3CCL1 1TWCI 1Q861 2AKLA 1P9NA 1YUKA 2QRDB 3VMHA 2JA8I 3RZDI 4DGLA 3CC71 3I55Z 4NB8A 1RLYA 2Q51A 3CCV1 2VUMI 4XX2A 3G711 3G6EZ 2E2II 5D1OA 4NBHA 2JIQA 3CCQZ 3GKQA 3RZOI 4A93I 4BY7I 3M3YI 3S17I 2W03A 4A3CI 2B63I 2I3CA 3CPWY 3I07A 1JWHC 4A3LI 2BJOA 1Q7Y1 3CCS1 1WZNA 3CCE1 2YADA 3CCLZ 1RO2A 2QKDA 1M1K2 2IV2X 1RO0A 3GTGI 3S2DI 3CC7Z 3S16I 1ZB8A 4DK1A 1WIIA 1QF8A 1Y1VS 4NBDA 3CCVZ 4HH4A 3G71Z 2JR6A 3J80b 5C4XI 1VQ51 1VQ8Z 1YJN1 3H0GI 3CCR1 1NJI2 1K8A2 2LIYA 2JA6I 2VPZA 2V8IA 2GTHA 3S1NI 2R92I 1QVGY 3CC21 4EWCA 3CCSZ 3NDJA 3CCEZ 1QVFY 5IP9I 1X0TA 3IR7A 1DL6A 2E7ZA 4MXUA 3P5JB 3CD61 1KQSY 4NFRA 4A3MI 1QYPA 1NJI1 2OTL1 3FKII 2QR1B 4NB9A 2OTJ1 4MRIA 2K3RA 5C4JI 2GU2A 1Q822 4AYBA 2E2JI 4E2XA 1Q812 2G2KA 1VQ5Z 4RVDA 1YJNZ 1RO4A 1W2BZ 3CCRZ 4A3BI 1YUAA 3GTJI 3NFZA 3CXCZ 1VLAA 3PO3I 3KIFA 2RHBA 2V8KA 2VPWA 3CC2Z 2JIRA 2R93I 2H85A 1QXFA 3GTPI 3T4NB 3LUSA 1Q811 5IT9f 2KPIA 1Z01A 3CD6Z 1K9M2 3M4OI 3G4S1 2V45A 2OTLZ 4E31A 1VQL1 2IZ4A 5C3EI 2OTJZ 4NBFA 4RVFA 1WCMI 1YJW1 4RVGA 3F3FC 2LEXA 1VQ91 1TFIA 1TWFI 4MH4A 4A3DI 2VPYA 1K9M1 1VQ81 2JIOA 3GTQI 3MZKB 3HOVI 3FQMA 1Y1WI 3JAMb 1VQ61 2M6NA 1NUIA 1FDIA 3CCU1 3G4SZ 1VQLZ 1Q16A 1JJ2Z 1YJWZ 1Y8CA 2RT9A 1W2BY 2WB1A 2E9HA 5D1PA 3NDIA 3CQZI 5D1OB 1VQ9Z 3I561 5FLMI 4MD7A 3CCMZ 1Z02A 3CXCY 3F3PC 4CL1A 3S15I 1YIT1 3JAMf 2VPXA 1YI21 3PO2I 4NH1C 4NBAA 1M1K1 2F4OA 3CCJ1 2JIMA 1VQ4Z 5A2Qb 3KIHA 5AN9F 2F4MA 2K5RA 2JA5I 2NVQI 1VQ6Z 2PK7A 2OZKA 1YIJZ 3CCUZ 1VQOZ 2DE5A 3ESWA 1N8R2 3HOUI 1FDOA 2JNYA 3J80f 3J81b 3GTMS 3TE5B 1K732 1TWAI 1K8A1 5A2Qf 3EERA 4RS4A 3HOWI 3NH5A 3IF8A 2LFUA 3I56Z 2GTIA 3S14I 1TWGI 4MD8A 1KD12 3CME1 4A3FI 1YITZ 1I50I 1YI2Z 1LQLA 3S2HI 4MD9A 3HOZI 3CCJZ 3CPWZ 5T6BA 1M902 2JIPA 3D6WA 3VTNA 1Z03A 4NBEA 1N8R1 3CC4Z 5T64A 1Y1VI 3Q87A 3U50C 1USPB 3EEDA 2V8JA 3S1MI 2EGTA 5T67A 1VQM1 1SFOI 1JJ2Y 4NOZA 1KD11 1Q821 1KC82 2PM9A 4A3KI 1YHQ1 1Q862 2PMZA 2DE7A 4E2WA 2RPRA 2JMOA 1M901 3MONA 3S1QI 2VF1A 1YJ91 4Y7NI 4MONA 1K83I 2RIQA 3GCFA 4A3EI 4RV9A 2P28A 5IP7I 2AYDA 1X3WA 3CMA1 3HOYI 3OW2Z 2JS4A 3IX0A 3NH4A 3CMEZ 4E2YA 2W04A 3K7AI 1AA6A 3CCM1 3J7A4 1KC81 4RVHA 5CM2M 1QVGZ 2HF1A 4DQYB 1VQK1 3H3VJ 2JUBA 1X3ZA 1VQ71 1VQ41 1QVFZ 2NVYI 2P3YA 5FLXb 1VQMZ 2J6AA 2OOYB 1Q7Y2 3GTOI 4NBCA 4HGZA 1KQSZ 2V3VA 3HOXI 1NP6A 1TWHI 2QLVB 1YHQZ 4E32A 1YIJ1 1PFTA 3BG1B 4NBBA 4A3GI 1KRLA 1ZB9A 2JA7I 1RNIA 1VQO1 1YJ9Z 4A3JI 2Q4ZA 3CMAZ 2M48A 1L1OC 1VQPZ 5FLXf 2YU9I 1RQFA 3GTKI 4Y52I 2QEX1 3IFUA 1VQKZ 4BXXI 4TNUA 5LL6f 1S721 1VQ7Z 5C44I 3CC41 2NVTI 4E33A 3D9XA 3I4MI 3PO3S 4A3II 2Y0SA 2QA41 2KI7B 2DE6A 4BBSI 1R9TI 4E2ZA 2IZ3A 2O4HA 3OW2Y 2R6MA 2NVXI 1N2FA 3QWUA 3VMIA 2WAQA 2VUGA 1VQN1 3NH8A
chains in the Genus database with same CATH topology
3I4NI 2OOXB 2HU9A 1USPA 2QEXZ 4BBRI 4S1TA 1ML8A 3TDHB 1S72Z 4X6AI 4E30A 2E2HI 3J81f 1K731 3S1RI 2QA4Z 3GTLI 3BG0B 2ZAEB 3I551 1ZH1A 5IT9b 4NBGA 4QTTA 3VB9A 3G6E1 3HKZA 3CCQ1 1I6HI 1WW9A 1VQNZ 4BY1I 2O53A 4HGYA 2RBLA 2R7ZI 3FQQA 1VQP1 4QTUA 1I3QI 2QRCB 1S7MA 3MZLB 2QREB 3VMGA 3GTMI 3CCL1 1TWCI 1Q861 2AKLA 1P9NA 1YUKA 2QRDB 3VMHA 2JA8I 3RZDI 4DGLA 3CC71 3I55Z 4NB8A 1RLYA 2Q51A 3CCV1 2VUMI 4XX2A 3G711 3G6EZ 2E2II 5D1OA 4NBHA 3CCQZ 3GKQA 3RZOI 4A93I 4BY7I 3M3YI 3S17I 2W03A 4A3CI 2B63I 2I3CA 3CPWY 3I07A 1JWHC 4A3LI 2BJOA 1Q7Y1 3CCS1 3CCE1 2YADA 3CCLZ 1RO2A 2QKDA 1M1K2 1RO0A 3GTGI 3S2DI 3CC7Z 3S16I 1ZB8A 4DK1A 1WIIA 1QF8A 1Y1VS 4NBDA 3CCVZ 4HH4A 3G71Z 2JR6A 3J80b 5C4XI 1VQ51 1VQ8Z 1YJN1 3H0GI 3CCR1 1NJI2 1K8A2 2LIYA 2JA6I 2V8IA 2GTHA 3S1NI 2R92I 1QVGY 3CC21 4EWCA 3CCSZ 3NDJA 3CCEZ 1QVFY 5IP9I 1X0TA 1DL6A 4MXUA 3P5JB 3CD61 1KQSY 4NFRA 4A3MI 1QYPA 1NJI1 2OTL1 3FKII 2QR1B 4NB9A 2OTJ1 4MRIA 2K3RA 5C4JI 2GU2A 1Q822 4AYBA 2E2JI 4E2XA 1Q812 2G2KA 1VQ5Z 4RVDA 1YJNZ 1RO4A 1W2BZ 3CCRZ 4A3BI 1YUAA 3GTJI 3NFZA 3CXCZ 1VLAA 3PO3I 3KIFA 2RHBA 2V8KA 3CC2Z 2R93I 2H85A 3GTPI 3T4NB 3LUSA 1Q811 5IT9f 2KPIA 1Z01A 3CD6Z 1K9M2 3M4OI 3G4S1 2OTLZ 4E31A 1VQL1 2IZ4A 5C3EI 2OTJZ 4NBFA 4RVFA 1WCMI 1YJW1 4RVGA 3F3FC 1VQ91 1TFIA 1TWFI 4MH4A 4A3DI 1K9M1 1VQ81 3GTQI 3MZKB 3HOVI 3FQMA 1Y1WI 3JAMb 1VQ61 2M6NA 1NUIA 3CCU1 3G4SZ 1VQLZ 1JJ2Z 1YJWZ 2RT9A 1W2BY 2WB1A 2E9HA 5D1PA 3NDIA 3CQZI 5D1OB 1VQ9Z 3I561 5FLMI 4MD7A 3CCMZ 1Z02A 3CXCY 3F3PC 4CL1A 3S15I 1YIT1 3JAMf 1YI21 3PO2I 4NH1C 4NBAA 1M1K1 2F4OA 3CCJ1 1VQ4Z 5A2Qb 3KIHA 5AN9F 2F4MA 2K5RA 2JA5I 2NVQI 1VQ6Z 2PK7A 2OZKA 1YIJZ 3CCUZ 1VQOZ 2DE5A 3ESWA 1N8R2 3HOUI 2JNYA 3J80f 3J81b 3GTMS 3TE5B 1K732 1TWAI 1K8A1 5A2Qf 3EERA 4RS4A 3HOWI 3NH5A 3IF8A 2LFUA 3I56Z 2GTIA 3S14I 1TWGI 4MD8A 1KD12 3CME1 4A3FI 1YITZ 1I50I 1YI2Z 1LQLA 3S2HI 4MD9A 3HOZI 3CCJZ 3CPWZ 5T6BA 1M902 3D6WA 3VTNA 1Z03A 4NBEA 1N8R1 3CC4Z 5T64A 1Y1VI 3Q87A 3U50C 1USPB 3EEDA 2V8JA 3S1MI 2EGTA 5T67A 1VQM1 1SFOI 1JJ2Y 4NOZA 1KD11 1Q821 1KC82 2PM9A 4A3KI 1YHQ1 1Q862 2PMZA 2DE7A 4E2WA 2RPRA 2JMOA 1M901 3MONA 3S1QI 2VF1A 1YJ91 4Y7NI 4MONA 1K83I 2RIQA 3GCFA 4A3EI 4RV9A 2P28A 5IP7I 1X3WA 3CMA1 3HOYI 3OW2Z 2JS4A 3IX0A 3NH4A 3CMEZ 4E2YA 2W04A 3K7AI 3CCM1 3J7A4 1KC81 4RVHA 5CM2M 1QVGZ 2HF1A 4DQYB 1VQK1 3H3VJ 2JUBA 1X3ZA 1VQ71 1VQ41 1QVFZ 2NVYI 2P3YA 5FLXb 1VQMZ 2J6AA 2OOYB 1Q7Y2 3GTOI 4NBCA 4HGZA 1KQSZ 3HOXI 1NP6A 1TWHI 2QLVB 1YHQZ 4E32A 1YIJ1 1PFTA 3BG1B 4NBBA 4A3GI 1KRLA 1ZB9A 2JA7I 1RNIA 1VQO1 1YJ9Z 4A3JI 2Q4ZA 3CMAZ 2M48A 1L1OC 1VQPZ 5FLXf 2YU9I 1RQFA 3GTKI 4Y52I 2QEX1 3IFUA 1VQKZ 4BXXI 4TNUA 5LL6f 1S721 1VQ7Z 5C44I 3CC41 2NVTI 4E33A 3D9XA 3I4MI 3PO3S 4A3II 2Y0SA 2QA41 2KI7B 2DE6A 4BBSI 1R9TI 4E2ZA 2IZ3A 2O4HA 3OW2Y 2R6MA 2NVXI 1N2FA 3QWUA 3VMIA 2WAQA 2VUGA 1VQN1 3NH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MD8 A;  2R6M A;  2JMO A;  4NH1 C;  4MD7 A;  1QF8 A;  1JWH C;  2M6N A;  2RT9 A;  4DGL A;  3EED A;  2M48 A;  4MD9 A;  1RQF A; 
#chains in the Genus database with same CATH topology
 3I4N I;  2OOX B;  3D2L A;  2HU9 A;  1USP A;  2QEX Z;  4BBR I;  4S1T A;  1ML8 A;  3TDH B;  1S72 Z;  4X6A I;  4E30 A;  2E2H I;  3J81 f;  1K73 1;  3S1R I;  2QA4 Z;  3GTL I;  3BG0 B;  2ZAE B;  3I55 1;  1SIW A;  1ZH1 A;  1WJ2 A;  5IT9 b;  4NBG A;  4QTT A;  3VB9 A;  3G6E 1;  3HKZ A;  2NAP A;  3CCQ 1;  1I6H I;  1WW9 A;  1VQN Z;  4BY1 I;  2O53 A;  4HGY A;  2RBL A;  2R7Z I;  3FQQ A;  1VQP 1;  4QTU A;  1I3Q I;  2QRC B;  1S7M A;  3MZL B;  2QRE B;  3VMG A;  3GTM I;  3CCL 1;  1TWC I;  1Q86 1;  2AKL A;  1P9N A;  1YUK A;  2QRD B;  3VMH A;  2JA8 I;  3RZD I;  4DGL A;  3CC7 1;  3I55 Z;  4NB8 A;  1RLY A;  2Q51 A;  3CCV 1;  2VUM I;  4XX2 A;  3G71 1;  3G6E Z;  2E2I I;  5D1O A;  4NBH A;  2JIQ A;  3CCQ Z;  3GKQ A;  3RZO I;  4A93 I;  4BY7 I;  3M3Y I;  3S17 I;  2W03 A;  4A3C I;  2B63 I;  2I3C A;  3CPW Y;  3I07 A;  1JWH C;  4A3L I;  2BJO A;  1Q7Y 1;  3CCS 1;  1WZN A;  3CCE 1;  2YAD A;  3CCL Z;  1RO2 A;  2QKD A;  1M1K 2;  2IV2 X;  1RO0 A;  3GTG I;  3S2D I;  3CC7 Z;  3S16 I;  1ZB8 A;  4DK1 A;  1WII A;  1QF8 A;  1Y1V S;  4NBD A;  3CCV Z;  4HH4 A;  3G71 Z;  2JR6 A;  3J80 b;  5C4X I;  1VQ5 1;  1VQ8 Z;  1YJN 1;  3H0G I;  3CCR 1;  1NJI 2;  1K8A 2;  2LIY A;  2JA6 I;  2VPZ A;  2V8I A;  2GTH A;  3S1N I;  2R92 I;  1QVG Y;  3CC2 1;  4EWC A;  3CCS Z;  3NDJ A;  3CCE Z;  1QVF Y;  5IP9 I;  1X0T A;  3IR7 A;  1DL6 A;  2E7Z A;  4MXU A;  3P5J B;  3CD6 1;  1KQS Y;  4NFR A;  4A3M I;  1QYP A;  1NJI 1;  2OTL 1;  3FKI I;  2QR1 B;  4NB9 A;  2OTJ 1;  4MRI A;  2K3R A;  5C4J I;  2GU2 A;  1Q82 2;  4AYB A;  2E2J I;  4E2X A;  1Q81 2;  2G2K A;  1VQ5 Z;  4RVD A;  1YJN Z;  1RO4 A;  1W2B Z;  3CCR Z;  4A3B I;  1YUA A;  3GTJ I;  3NFZ A;  3CXC Z;  1VLA A;  3PO3 I;  3KIF A;  2RHB A;  2V8K A;  2VPW A;  3CC2 Z;  2JIR A;  2R93 I;  2H85 A;  1QXF A;  3GTP I;  3T4N B;  3LUS A;  1Q81 1;  5IT9 f;  2KPI A;  1Z01 A;  3CD6 Z;  1K9M 2;  3M4O I;  3G4S 1;  2V45 A;  2OTL Z;  4E31 A;  1VQL 1;  2IZ4 A;  5C3E I;  2OTJ Z;  4NBF A;  4RVF A;  1WCM I;  1YJW 1;  4RVG A;  3F3F C;  2LEX A;  1VQ9 1;  1TFI A;  1TWF I;  4MH4 A;  4A3D I;  2VPY A;  1K9M 1;  1VQ8 1;  2JIO A;  3GTQ I;  3MZK B;  3HOV I;  3FQM A;  1Y1W I;  3JAM b;  1VQ6 1;  2M6N A;  1NUI A;  1FDI A;  3CCU 1;  3G4S Z;  1VQL Z;  1Q16 A;  1JJ2 Z;  1YJW Z;  1Y8C A;  2RT9 A;  1W2B Y;  2WB1 A;  2E9H A;  5D1P A;  3NDI A;  3CQZ I;  5D1O B;  1VQ9 Z;  3I56 1;  5FLM I;  4MD7 A;  3CCM Z;  1Z02 A;  3CXC Y;  3F3P C;  4CL1 A;  3S15 I;  1YIT 1;  3JAM f;  2VPX A;  1YI2 1;  3PO2 I;  4NH1 C;  4NBA A;  1M1K 1;  2F4O A;  3CCJ 1;  2JIM A;  1VQ4 Z;  5A2Q b;  3KIH A;  5AN9 F;  2F4M A;  2K5R A;  2JA5 I;  2NVQ I;  1VQ6 Z;  2PK7 A;  2OZK A;  1YIJ Z;  3CCU Z;  1VQO Z;  2DE5 A;  3ESW A;  1N8R 2;  3HOU I;  1FDO A;  2JNY A;  3J80 f;  3J81 b;  3GTM S;  3TE5 B;  1K73 2;  1TWA I;  1K8A 1;  5A2Q f;  3EER A;  4RS4 A;  3HOW I;  3NH5 A;  3IF8 A;  2LFU A;  3I56 Z;  2GTI A;  3S14 I;  1TWG I;  4MD8 A;  1KD1 2;  3CME 1;  4A3F I;  1YIT Z;  1I50 I;  1YI2 Z;  1LQL A;  3S2H I;  4MD9 A;  3HOZ I;  3CCJ Z;  3CPW Z;  5T6B A;  1M90 2;  2JIP A;  3D6W A;  3VTN A;  1Z03 A;  4NBE A;  1N8R 1;  3CC4 Z;  5T64 A;  1Y1V I;  3Q87 A;  3U50 C;  1USP B;  3EED A;  2V8J A;  3S1M I;  2EGT A;  5T67 A;  1VQM 1;  1SFO I;  1JJ2 Y;  4NOZ A;  1KD1 1;  1Q82 1;  1KC8 2;  2PM9 A;  4A3K I;  1YHQ 1;  1Q86 2;  2PMZ A;  2DE7 A;  4E2W A;  2RPR A;  2JMO A;  1M90 1;  3MON A;  3S1Q I;  2VF1 A;  1YJ9 1;  4Y7N I;  4MON A;  1K83 I;  2RIQ A;  3GCF A;  4A3E I;  4RV9 A;  2P28 A;  5IP7 I;  2AYD A;  1X3W A;  3CMA 1;  3HOY I;  3OW2 Z;  2JS4 A;  3IX0 A;  3NH4 A;  3CME Z;  4E2Y A;  2W04 A;  3K7A I;  1AA6 A;  3CCM 1;  3J7A 4;  1KC8 1;  4RVH A;  5CM2 M;  1QVG Z;  2HF1 A;  4DQY B;  1VQK 1;  3H3V J;  2JUB A;  1X3Z A;  1VQ7 1;  1VQ4 1;  1QVF Z;  2NVY I;  2P3Y A;  5FLX b;  1VQM Z;  2J6A A;  2OOY B;  1Q7Y 2;  3GTO I;  4NBC A;  4HGZ A;  1KQS Z;  2V3V A;  3HOX I;  1NP6 A;  1TWH I;  2QLV B;  1YHQ Z;  4E32 A;  1YIJ 1;  1PFT A;  3BG1 B;  4NBB A;  4A3G I;  1KRL A;  1ZB9 A;  2JA7 I;  1RNI A;  1VQO 1;  1YJ9 Z;  4A3J I;  2Q4Z A;  3CMA Z;  2M48 A;  1L1O C;  1VQP Z;  5FLX f;  2YU9 I;  1RQF A;  3GTK I;  4Y52 I;  2QEX 1;  3IFU A;  1VQK Z;  4BXX I;  4TNU A;  5LL6 f;  1S72 1;  1VQ7 Z;  5C44 I;  3CC4 1;  2NVT I;  4E33 A;  3D9X A;  3I4M I;  3PO3 S;  4A3I I;  2Y0S A;  2QA4 1;  2KI7 B;  2DE6 A;  4BBS I;  1R9T I;  4E2Z A;  2IZ3 A;  2O4H A;  3OW2 Y;  2R6M A;  2NVX I;  1N2F A;  3QWU A;  3VMI A;  2WAQ A;  2VUG A;  1VQN 1;  3NH8 A; 
#chains in the Genus database with same CATH homology
 3I4N I;  2OOX B;  2HU9 A;  1USP A;  2QEX Z;  4BBR I;  4S1T A;  1ML8 A;  3TDH B;  1S72 Z;  4X6A I;  4E30 A;  2E2H I;  3J81 f;  1K73 1;  3S1R I;  2QA4 Z;  3GTL I;  3BG0 B;  2ZAE B;  3I55 1;  1ZH1 A;  5IT9 b;  4NBG A;  4QTT A;  3VB9 A;  3G6E 1;  3HKZ A;  3CCQ 1;  1I6H I;  1WW9 A;  1VQN Z;  4BY1 I;  2O53 A;  4HGY A;  2RBL A;  2R7Z I;  3FQQ A;  1VQP 1;  4QTU A;  1I3Q I;  2QRC B;  1S7M A;  3MZL B;  2QRE B;  3VMG A;  3GTM I;  3CCL 1;  1TWC I;  1Q86 1;  2AKL A;  1P9N A;  1YUK A;  2QRD B;  3VMH A;  2JA8 I;  3RZD I;  4DGL A;  3CC7 1;  3I55 Z;  4NB8 A;  1RLY A;  2Q51 A;  3CCV 1;  2VUM I;  4XX2 A;  3G71 1;  3G6E Z;  2E2I I;  5D1O A;  4NBH A;  3CCQ Z;  3GKQ A;  3RZO I;  4A93 I;  4BY7 I;  3M3Y I;  3S17 I;  2W03 A;  4A3C I;  2B63 I;  2I3C A;  3CPW Y;  3I07 A;  1JWH C;  4A3L I;  2BJO A;  1Q7Y 1;  3CCS 1;  3CCE 1;  2YAD A;  3CCL Z;  1RO2 A;  2QKD A;  1M1K 2;  1RO0 A;  3GTG I;  3S2D I;  3CC7 Z;  3S16 I;  1ZB8 A;  4DK1 A;  1WII A;  1QF8 A;  1Y1V S;  4NBD A;  3CCV Z;  4HH4 A;  3G71 Z;  2JR6 A;  3J80 b;  5C4X I;  1VQ5 1;  1VQ8 Z;  1YJN 1;  3H0G I;  3CCR 1;  1NJI 2;  1K8A 2;  2LIY A;  2JA6 I;  2V8I A;  2GTH A;  3S1N I;  2R92 I;  1QVG Y;  3CC2 1;  4EWC A;  3CCS Z;  3NDJ A;  3CCE Z;  1QVF Y;  5IP9 I;  1X0T A;  1DL6 A;  4MXU A;  3P5J B;  3CD6 1;  1KQS Y;  4NFR A;  4A3M I;  1QYP A;  1NJI 1;  2OTL 1;  3FKI I;  2QR1 B;  4NB9 A;  2OTJ 1;  4MRI A;  2K3R A;  5C4J I;  2GU2 A;  1Q82 2;  4AYB A;  2E2J I;  4E2X A;  1Q81 2;  2G2K A;  1VQ5 Z;  4RVD A;  1YJN Z;  1RO4 A;  1W2B Z;  3CCR Z;  4A3B I;  1YUA A;  3GTJ I;  3NFZ A;  3CXC Z;  1VLA A;  3PO3 I;  3KIF A;  2RHB A;  2V8K A;  3CC2 Z;  2R93 I;  2H85 A;  3GTP I;  3T4N B;  3LUS A;  1Q81 1;  5IT9 f;  2KPI A;  1Z01 A;  3CD6 Z;  1K9M 2;  3M4O I;  3G4S 1;  2OTL Z;  4E31 A;  1VQL 1;  2IZ4 A;  5C3E I;  2OTJ Z;  4NBF A;  4RVF A;  1WCM I;  1YJW 1;  4RVG A;  3F3F C;  1VQ9 1;  1TFI A;  1TWF I;  4MH4 A;  4A3D I;  1K9M 1;  1VQ8 1;  3GTQ I;  3MZK B;  3HOV I;  3FQM A;  1Y1W I;  3JAM b;  1VQ6 1;  2M6N A;  1NUI A;  3CCU 1;  3G4S Z;  1VQL Z;  1JJ2 Z;  1YJW Z;  2RT9 A;  1W2B Y;  2WB1 A;  2E9H A;  5D1P A;  3NDI A;  3CQZ I;  5D1O B;  1VQ9 Z;  3I56 1;  5FLM I;  4MD7 A;  3CCM Z;  1Z02 A;  3CXC Y;  3F3P C;  4CL1 A;  3S15 I;  1YIT 1;  3JAM f;  1YI2 1;  3PO2 I;  4NH1 C;  4NBA A;  1M1K 1;  2F4O A;  3CCJ 1;  1VQ4 Z;  5A2Q b;  3KIH A;  5AN9 F;  2F4M A;  2K5R A;  2JA5 I;  2NVQ I;  1VQ6 Z;  2PK7 A;  2OZK A;  1YIJ Z;  3CCU Z;  1VQO Z;  2DE5 A;  3ESW A;  1N8R 2;  3HOU I;  2JNY A;  3J80 f;  3J81 b;  3GTM S;  3TE5 B;  1K73 2;  1TWA I;  1K8A 1;  5A2Q f;  3EER A;  4RS4 A;  3HOW I;  3NH5 A;  3IF8 A;  2LFU A;  3I56 Z;  2GTI A;  3S14 I;  1TWG I;  4MD8 A;  1KD1 2;  3CME 1;  4A3F I;  1YIT Z;  1I50 I;  1YI2 Z;  1LQL A;  3S2H I;  4MD9 A;  3HOZ I;  3CCJ Z;  3CPW Z;  5T6B A;  1M90 2;  3D6W A;  3VTN A;  1Z03 A;  4NBE A;  1N8R 1;  3CC4 Z;  5T64 A;  1Y1V I;  3Q87 A;  3U50 C;  1USP B;  3EED A;  2V8J A;  3S1M I;  2EGT A;  5T67 A;  1VQM 1;  1SFO I;  1JJ2 Y;  4NOZ A;  1KD1 1;  1Q82 1;  1KC8 2;  2PM9 A;  4A3K I;  1YHQ 1;  1Q86 2;  2PMZ A;  2DE7 A;  4E2W A;  2RPR A;  2JMO A;  1M90 1;  3MON A;  3S1Q I;  2VF1 A;  1YJ9 1;  4Y7N I;  4MON A;  1K83 I;  2RIQ A;  3GCF A;  4A3E I;  4RV9 A;  2P28 A;  5IP7 I;  1X3W A;  3CMA 1;  3HOY I;  3OW2 Z;  2JS4 A;  3IX0 A;  3NH4 A;  3CME Z;  4E2Y A;  2W04 A;  3K7A I;  3CCM 1;  3J7A 4;  1KC8 1;  4RVH A;  5CM2 M;  1QVG Z;  2HF1 A;  4DQY B;  1VQK 1;  3H3V J;  2JUB A;  1X3Z A;  1VQ7 1;  1VQ4 1;  1QVF Z;  2NVY I;  2P3Y A;  5FLX b;  1VQM Z;  2J6A A;  2OOY B;  1Q7Y 2;  3GTO I;  4NBC A;  4HGZ A;  1KQS Z;  3HOX I;  1NP6 A;  1TWH I;  2QLV B;  1YHQ Z;  4E32 A;  1YIJ 1;  1PFT A;  3BG1 B;  4NBB A;  4A3G I;  1KRL A;  1ZB9 A;  2JA7 I;  1RNI A;  1VQO 1;  1YJ9 Z;  4A3J I;  2Q4Z A;  3CMA Z;  2M48 A;  1L1O C;  1VQP Z;  5FLX f;  2YU9 I;  1RQF A;  3GTK I;  4Y52 I;  2QEX 1;  3IFU A;  1VQK Z;  4BXX I;  4TNU A;  5LL6 f;  1S72 1;  1VQ7 Z;  5C44 I;  3CC4 1;  2NVT I;  4E33 A;  3D9X A;  3I4M I;  3PO3 S;  4A3I I;  2Y0S A;  2QA4 1;  2KI7 B;  2DE6 A;  4BBS I;  1R9T I;  4E2Z A;  2IZ3 A;  2O4H A;  3OW2 Y;  2R6M A;  2NVX I;  1N2F A;  3QWU A;  3VMI A;  2WAQ A;  2VUG A;  1VQN 1;  3NH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...