4DGLA

Crystal structure of the ck2 tetrameric holoenzyme
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
208
structure length
200
Chain Sequence
SWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural determinants of protein kinase CK2 regulation by autoinhibitory polymerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Casein kinase II subunit beta
total genus 48
structure length 200
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01214 CK_II_beta Casein kinase II regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1820.10 Mainly Alpha Orthogonal Bundle protein kinase ck2 holoenzyme, chain C, domain 1 protein kinase ck2 holoenzyme, chain C, domain 1 4dglA01
2.20.25.20 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4dglA02
2RT9A 4DGLA 3EEDA 4MD9A 2M48A 2M6NA 4MD7A 4MD8A 2JMOA 4NH1C 2R6MA 1QF8A 1JWHC 1RQFA
chains in the Genus database with same CATH superfamily
3MONA 4RVFA 4A3EI 1Z02A 2HF1A 1NJI2 2Y0SA 1VQOZ 4NBDA 4QTUA 1TFIA 5IT9f 2R6MA 2V8JA 4E33A 4NBGA 4S1TA 2JA8I 2WB1A 3GTLI 1NJI1 3D6WA 1Z03A 4HH4A 5FLXb 3MZLB 4HGYA 4NBHA 1KQSY 1YI2Z 2I3CA 3CCQZ 1VQ5Z 2P28A 1VQ8Z 3J80f 3M4OI 2V45A 2JIQA 1JJ2Z 4DQYB 2ZAEB 1VQM1 5T67A 1YJNZ 3NH8A 1KC82 1I6HI 2QEX1 3FQQA 2GTIA 1M1K2 1Y1WI 1TWFI 1QF8A 5A2Qb 3H3VJ 1K8A1 2VUMI 2F4MA 2YADA 3GTGI 1USPA 4RVGA 4E30A 3G71Z 3VMHA 1YIJ1 1N2FA 3NDJA 3CMAZ 4E2ZA 4NH1C 3I551 2JIMA 4A3GI 3GTJI 1YJW1 1Q821 4QTTA 2DE5A 3D9XA 3PO2I 3I07A 4A3CI 1WCMI 1K8A2 1L1OC 3IFUA 1YUAA 3CXCZ 3CCE1 2QR1B 1QXFA 3PO3I 4A93I 2E2JI 3J81f 1VQLZ 3IX0A 1I3QI 3S2HI 1VLAA 3T4NB 4A3MI 4MD9A 2OOYB 2PK7A 3TDHB 4XX2A 1ML8A 4DGLA 1RO2A 1DL6A 1VQ7Z 3CC7Z 3CCVZ 1YJ9Z 2F4OA 2M48A 1Q861 1USPB 2B63I 2AYDA 3CMA1 4A3DI 3H0GI 2RBLA 4RS4A 2OTJZ 3IF8A 5C44I 3HKZA 3S1RI 3GTOI 2RPRA 1YI21 2OTLZ 3CPWZ 2NVYI 4MONA 1RLYA 4BBSI 2P3YA 2NAPA 3ESWA 1VQK1 3I4MI 3CCLZ 3KIFA 3NDIA 1X3ZA 2RHBA 5D1OA 3G4SZ 2M6NA 2OTL1 1K731 2JA5I 2OOXB 3CCUZ 1Q811 2Q4ZA 3NFZA 1VQL1 3S16I 1FDOA 2GU2A 3JAMb 3CCS1 4A3JI 4AYBA 3GTKI 3CMEZ 3CPWY 3CCJ1 3CC41 3JAMf 3S2DI 4A3II 3HOVI 4BBRI 1VQ71 1VQPZ 4A3FI 2KPIA 2JA6I 5C4JI 3GTPI 2AKLA 4HGZA 3S14I 5D1PA 5FLXf 3RZOI 4A3LI 3CME1 1VQ9Z 3KIHA 1SFOI 1VQNZ 1WJ2A 1YIJZ 2O53A 2GTHA 4A3BI 2QKDA 4BXXI 1M901 3OW2Y 2NVTI 1JWHC 3CCRZ 3S17I 4NB9A 4MD8A 2DE7A 2IV2X 2W03A 1RQFA 4MRIA 4DK1A 3VTNA 3EEDA 1S7MA 1X0TA 1WW9A 4NB8A 5T6BA 3RZDI 3QWUA 5T64A 2VPYA 3S1QI 1QVGZ 1VQ4Z 3CC2Z 1S72Z 1VQP1 3PO3S 1VQ6Z 1YITZ 1FDIA 1KQSZ 1KD12 1KC81 2RIQA 1ZB8A 1N8R1 3GCFA 1VQO1 3F3PC 2OZKA 2LFUA 1VQ61 2PMZA 1YIT1 2VPXA 2JIPA 2JS4A 4RVDA 2QRDB 4MXUA 4EWCA 2NVXI 4RVHA 1KD11 4NBAA 1VQ51 2E2II 3I4NI 3Q87A 3HOUI 3CC71 3GTMS 3EERA 4NFRA 1S721 4E31A 1Q822 1NUIA 3CC21 2JUBA 3J7A4 3CCV1 3S1MI 3VMGA 1NP6A 1R9TI 3J81b 4E2WA 2IZ4A 1P9NA 2NVQI 2R93I 4TNUA 3NH5A 3CCMZ 2LEXA 1Q7Y2 5CM2M 1Q16A 5FLMI 3LUSA 1I50I 2JA7I 3S15I 2V8IA 1VQ91 2Q51A 2LIYA 3BG1B 2VUGA 1YUKA 1TWAI 4MD7A 1Z01A 4X6AI 1YJWZ 2QREB 1RO0A 2R7ZI 1K732 1RO4A 4E2XA 2JR6A 2O4HA 2KI7B 3OW2Z 4NOZA 2EGTA 1K9M2 4A3KI 3CCQ1 5C4XI 1VQ81 4NBBA 3M3YI 3TE5B 3VB9A 5IP7I 1TWGI 3NH4A 1KRLA 3G4S1 5IP9I 3FKII 4E2YA 2JNYA 2YU9I 5LL6f 1YJN1 2V3VA 1K83I 1RNIA 1VQ41 4NBFA 3CCSZ 1W2BY 1Q862 3IR7A 3U50C 1LQLA 1YHQZ 2K5RA 3CCM1 2OTJ1 3G711 1WIIA 2JMOA 2R92I 1YHQ1 3HOYI 1Y8CA 3J80b 1QVFY 1N8R2 5A2Qf 1QVGY 3CCL1 4BY1I 3CD6Z 3K7AI 4MH4A 3GKQA 1QYPA 5D1OB 2E2HI 1JJ2Y 2DE6A 1W2BZ 4NBEA 3CCU1 1ZH1A 3CQZI 2G2KA 3D2LA 3CCEZ 1QVFZ 1TWCI 2E7ZA 2JIRA 2HU9A 1Y1VI 4Y52I 4Y7NI 4E32A 2BJOA 3G6EZ 3S1NI 3I561 1WZNA 2WAQA 2K3RA 1ZB9A 5AN9F 2PM9A 2VPZA 1VQMZ 3P5JB 3GTMI 1K9M1 2QLVB 1M902 3GTQI 3MZKB 1AA6A 1VQN1 2VF1A 2QA41 3BG0B 1TWHI 1Q812 3CCR1 3FQMA 2V8KA 4CL1A 2H85A 5IT9b 3CD61 3CXCY 2QA4Z 1VQKZ 3HOWI 4RV9A 1X3WA 2RT9A 3I55Z 1M1K1 2JIOA 3F3FC 4BY7I 1Y1VS 2IZ3A 5C3EI 3HOXI 3VMIA 2QRCB 3HOZI 3I56Z 1PFTA 1Q7Y1 1SIWA 2QEXZ 4NBCA 1YJ91 3G6E1 2W04A 2E9HA 3CC4Z 2VPWA 3CCJZ 2J6AA
chains in the Genus database with same CATH topology
3MONA 4RVFA 4A3EI 1Z02A 2HF1A 1NJI2 2Y0SA 1VQOZ 4NBDA 4QTUA 1TFIA 5IT9f 2R6MA 2V8JA 4E33A 4NBGA 4S1TA 2JA8I 2WB1A 3GTLI 1NJI1 3D6WA 1Z03A 4HH4A 5FLXb 3MZLB 4HGYA 4NBHA 1KQSY 1YI2Z 2I3CA 3CCQZ 1VQ5Z 2P28A 1VQ8Z 3J80f 3M4OI 1JJ2Z 4DQYB 2ZAEB 1VQM1 5T67A 1YJNZ 3NH8A 1KC82 1I6HI 2QEX1 3FQQA 2GTIA 1M1K2 1Y1WI 1TWFI 1QF8A 5A2Qb 3H3VJ 1K8A1 2VUMI 2F4MA 2YADA 3GTGI 1USPA 4RVGA 4E30A 3G71Z 3VMHA 1YIJ1 1N2FA 3NDJA 3CMAZ 4E2ZA 4NH1C 3I551 4A3GI 3GTJI 1YJW1 1Q821 4QTTA 2DE5A 3D9XA 3PO2I 3I07A 4A3CI 1WCMI 1K8A2 1L1OC 3IFUA 1YUAA 3CXCZ 3CCE1 2QR1B 3PO3I 4A93I 2E2JI 3J81f 1VQLZ 3IX0A 1I3QI 3S2HI 1VLAA 3T4NB 4A3MI 4MD9A 2OOYB 2PK7A 3TDHB 4XX2A 1ML8A 4DGLA 1RO2A 1DL6A 1VQ7Z 3CC7Z 3CCVZ 1YJ9Z 2F4OA 2M48A 1Q861 1USPB 2B63I 3CMA1 4A3DI 3H0GI 2RBLA 4RS4A 2OTJZ 3IF8A 5C44I 3HKZA 3S1RI 3GTOI 2RPRA 1YI21 2OTLZ 3CPWZ 2NVYI 4MONA 1RLYA 4BBSI 2P3YA 3ESWA 1VQK1 3I4MI 3CCLZ 3KIFA 3NDIA 1X3ZA 2RHBA 5D1OA 3G4SZ 2M6NA 2OTL1 1K731 2JA5I 2OOXB 3CCUZ 1Q811 2Q4ZA 3NFZA 1VQL1 3S16I 2GU2A 3JAMb 3CCS1 4A3JI 4AYBA 3GTKI 3CMEZ 3CPWY 3CCJ1 3CC41 3JAMf 3S2DI 4A3II 3HOVI 4BBRI 1VQ71 1VQPZ 4A3FI 2KPIA 2JA6I 5C4JI 3GTPI 2AKLA 4HGZA 3S14I 5D1PA 5FLXf 3RZOI 4A3LI 3CME1 1VQ9Z 3KIHA 1SFOI 1VQNZ 1YIJZ 2O53A 2GTHA 4A3BI 2QKDA 4BXXI 1M901 3OW2Y 2NVTI 1JWHC 3CCRZ 3S17I 4NB9A 4MD8A 2DE7A 2W03A 1RQFA 4MRIA 4DK1A 3VTNA 3EEDA 1S7MA 1X0TA 1WW9A 4NB8A 5T6BA 3RZDI 3QWUA 5T64A 3S1QI 1QVGZ 1VQ4Z 3CC2Z 1S72Z 1VQP1 3PO3S 1VQ6Z 1YITZ 1KQSZ 1KD12 1KC81 2RIQA 1ZB8A 1N8R1 3GCFA 1VQO1 3F3PC 2OZKA 2LFUA 1VQ61 2PMZA 1YIT1 2JS4A 4RVDA 2QRDB 4MXUA 4EWCA 2NVXI 4RVHA 1KD11 4NBAA 1VQ51 2E2II 3I4NI 3Q87A 3HOUI 3CC71 3GTMS 3EERA 4NFRA 1S721 4E31A 1Q822 1NUIA 3CC21 2JUBA 3J7A4 3CCV1 3S1MI 3VMGA 1NP6A 1R9TI 3J81b 4E2WA 2IZ4A 1P9NA 2NVQI 2R93I 4TNUA 3NH5A 3CCMZ 1Q7Y2 5CM2M 5FLMI 3LUSA 1I50I 2JA7I 3S15I 2V8IA 1VQ91 2Q51A 2LIYA 3BG1B 2VUGA 1YUKA 1TWAI 4MD7A 1Z01A 4X6AI 1YJWZ 2QREB 1RO0A 2R7ZI 1K732 1RO4A 4E2XA 2JR6A 2O4HA 2KI7B 3OW2Z 4NOZA 2EGTA 1K9M2 4A3KI 3CCQ1 5C4XI 1VQ81 4NBBA 3M3YI 3TE5B 3VB9A 5IP7I 1TWGI 3NH4A 1KRLA 3G4S1 5IP9I 3FKII 4E2YA 2JNYA 2YU9I 5LL6f 1YJN1 1K83I 1RNIA 1VQ41 4NBFA 3CCSZ 1W2BY 1Q862 3U50C 1LQLA 1YHQZ 2K5RA 3CCM1 2OTJ1 3G711 1WIIA 2JMOA 2R92I 1YHQ1 3HOYI 3J80b 1QVFY 1N8R2 5A2Qf 1QVGY 3CCL1 4BY1I 3CD6Z 3K7AI 4MH4A 3GKQA 1QYPA 5D1OB 2E2HI 1JJ2Y 2DE6A 1W2BZ 4NBEA 3CCU1 1ZH1A 3CQZI 2G2KA 3CCEZ 1QVFZ 1TWCI 2HU9A 1Y1VI 4Y52I 4Y7NI 4E32A 2BJOA 3G6EZ 3S1NI 3I561 2WAQA 2K3RA 1ZB9A 5AN9F 2PM9A 1VQMZ 3P5JB 3GTMI 1K9M1 2QLVB 1M902 3GTQI 3MZKB 1VQN1 2VF1A 2QA41 3BG0B 1TWHI 1Q812 3CCR1 3FQMA 2V8KA 4CL1A 2H85A 5IT9b 3CD61 3CXCY 2QA4Z 1VQKZ 3HOWI 4RV9A 1X3WA 2RT9A 3I55Z 1M1K1 3F3FC 4BY7I 1Y1VS 2IZ3A 5C3EI 3HOXI 3VMIA 2QRCB 3HOZI 3I56Z 1PFTA 1Q7Y1 4NBCA 3G6E1 1YJ91 2QEXZ 2W04A 2E9HA 3CC4Z 3CCJZ 2J6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RT9 A;  4DGL A;  3EED A;  4MD9 A;  2M48 A;  2M6N A;  4MD7 A;  4MD8 A;  2JMO A;  4NH1 C;  2R6M A;  1QF8 A;  1JWH C;  1RQF A; 
#chains in the Genus database with same CATH topology
 3MON A;  4RVF A;  4A3E I;  1Z02 A;  2HF1 A;  1NJI 2;  2Y0S A;  1VQO Z;  4NBD A;  4QTU A;  1TFI A;  5IT9 f;  2R6M A;  2V8J A;  4E33 A;  4NBG A;  4S1T A;  2JA8 I;  2WB1 A;  3GTL I;  1NJI 1;  3D6W A;  1Z03 A;  4HH4 A;  5FLX b;  3MZL B;  4HGY A;  4NBH A;  1KQS Y;  1YI2 Z;  2I3C A;  3CCQ Z;  1VQ5 Z;  2P28 A;  1VQ8 Z;  3J80 f;  3M4O I;  2V45 A;  2JIQ A;  1JJ2 Z;  4DQY B;  2ZAE B;  1VQM 1;  5T67 A;  1YJN Z;  3NH8 A;  1KC8 2;  1I6H I;  2QEX 1;  3FQQ A;  2GTI A;  1M1K 2;  1Y1W I;  1TWF I;  1QF8 A;  5A2Q b;  3H3V J;  1K8A 1;  2VUM I;  2F4M A;  2YAD A;  3GTG I;  1USP A;  4RVG A;  4E30 A;  3G71 Z;  3VMH A;  1YIJ 1;  1N2F A;  3NDJ A;  3CMA Z;  4E2Z A;  4NH1 C;  3I55 1;  2JIM A;  4A3G I;  3GTJ I;  1YJW 1;  1Q82 1;  4QTT A;  2DE5 A;  3D9X A;  3PO2 I;  3I07 A;  4A3C I;  1WCM I;  1K8A 2;  1L1O C;  3IFU A;  1YUA A;  3CXC Z;  3CCE 1;  2QR1 B;  1QXF A;  3PO3 I;  4A93 I;  2E2J I;  3J81 f;  1VQL Z;  3IX0 A;  1I3Q I;  3S2H I;  1VLA A;  3T4N B;  4A3M I;  4MD9 A;  2OOY B;  2PK7 A;  3TDH B;  4XX2 A;  1ML8 A;  4DGL A;  1RO2 A;  1DL6 A;  1VQ7 Z;  3CC7 Z;  3CCV Z;  1YJ9 Z;  2F4O A;  2M48 A;  1Q86 1;  1USP B;  2B63 I;  2AYD A;  3CMA 1;  4A3D I;  3H0G I;  2RBL A;  4RS4 A;  2OTJ Z;  3IF8 A;  5C44 I;  3HKZ A;  3S1R I;  3GTO I;  2RPR A;  1YI2 1;  2OTL Z;  3CPW Z;  2NVY I;  4MON A;  1RLY A;  4BBS I;  2P3Y A;  2NAP A;  3ESW A;  1VQK 1;  3I4M I;  3CCL Z;  3KIF A;  3NDI A;  1X3Z A;  2RHB A;  5D1O A;  3G4S Z;  2M6N A;  2OTL 1;  1K73 1;  2JA5 I;  2OOX B;  3CCU Z;  1Q81 1;  2Q4Z A;  3NFZ A;  1VQL 1;  3S16 I;  1FDO A;  2GU2 A;  3JAM b;  3CCS 1;  4A3J I;  4AYB A;  3GTK I;  3CME Z;  3CPW Y;  3CCJ 1;  3CC4 1;  3JAM f;  3S2D I;  4A3I I;  3HOV I;  4BBR I;  1VQ7 1;  1VQP Z;  4A3F I;  2KPI A;  2JA6 I;  5C4J I;  3GTP I;  2AKL A;  4HGZ A;  3S14 I;  5D1P A;  5FLX f;  3RZO I;  4A3L I;  3CME 1;  1VQ9 Z;  3KIH A;  1SFO I;  1VQN Z;  1WJ2 A;  1YIJ Z;  2O53 A;  2GTH A;  4A3B I;  2QKD A;  4BXX I;  1M90 1;  3OW2 Y;  2NVT I;  1JWH C;  3CCR Z;  3S17 I;  4NB9 A;  4MD8 A;  2DE7 A;  2IV2 X;  2W03 A;  1RQF A;  4MRI A;  4DK1 A;  3VTN A;  3EED A;  1S7M A;  1X0T A;  1WW9 A;  4NB8 A;  5T6B A;  3RZD I;  3QWU A;  5T64 A;  2VPY A;  3S1Q I;  1QVG Z;  1VQ4 Z;  3CC2 Z;  1S72 Z;  1VQP 1;  3PO3 S;  1VQ6 Z;  1YIT Z;  1FDI A;  1KQS Z;  1KD1 2;  1KC8 1;  2RIQ A;  1ZB8 A;  1N8R 1;  3GCF A;  1VQO 1;  3F3P C;  2OZK A;  2LFU A;  1VQ6 1;  2PMZ A;  1YIT 1;  2VPX A;  2JIP A;  2JS4 A;  4RVD A;  2QRD B;  4MXU A;  4EWC A;  2NVX I;  4RVH A;  1KD1 1;  4NBA A;  1VQ5 1;  2E2I I;  3I4N I;  3Q87 A;  3HOU I;  3CC7 1;  3GTM S;  3EER A;  4NFR A;  1S72 1;  4E31 A;  1Q82 2;  1NUI A;  3CC2 1;  2JUB A;  3J7A 4;  3CCV 1;  3S1M I;  3VMG A;  1NP6 A;  1R9T I;  3J81 b;  4E2W A;  2IZ4 A;  1P9N A;  2NVQ I;  2R93 I;  4TNU A;  3NH5 A;  3CCM Z;  2LEX A;  1Q7Y 2;  5CM2 M;  1Q16 A;  5FLM I;  3LUS A;  1I50 I;  2JA7 I;  3S15 I;  2V8I A;  1VQ9 1;  2Q51 A;  2LIY A;  3BG1 B;  2VUG A;  1YUK A;  1TWA I;  4MD7 A;  1Z01 A;  4X6A I;  1YJW Z;  2QRE B;  1RO0 A;  2R7Z I;  1K73 2;  1RO4 A;  4E2X A;  2JR6 A;  2O4H A;  2KI7 B;  3OW2 Z;  4NOZ A;  2EGT A;  1K9M 2;  4A3K I;  3CCQ 1;  5C4X I;  1VQ8 1;  4NBB A;  3M3Y I;  3TE5 B;  3VB9 A;  5IP7 I;  1TWG I;  3NH4 A;  1KRL A;  3G4S 1;  5IP9 I;  3FKI I;  4E2Y A;  2JNY A;  2YU9 I;  5LL6 f;  1YJN 1;  2V3V A;  1K83 I;  1RNI A;  1VQ4 1;  4NBF A;  3CCS Z;  1W2B Y;  1Q86 2;  3IR7 A;  3U50 C;  1LQL A;  1YHQ Z;  2K5R A;  3CCM 1;  2OTJ 1;  3G71 1;  1WII A;  2JMO A;  2R92 I;  1YHQ 1;  3HOY I;  1Y8C A;  3J80 b;  1QVF Y;  1N8R 2;  5A2Q f;  1QVG Y;  3CCL 1;  4BY1 I;  3CD6 Z;  3K7A I;  4MH4 A;  3GKQ A;  1QYP A;  5D1O B;  2E2H I;  1JJ2 Y;  2DE6 A;  1W2B Z;  4NBE A;  3CCU 1;  1ZH1 A;  3CQZ I;  2G2K A;  3D2L A;  3CCE Z;  1QVF Z;  1TWC I;  2E7Z A;  2JIR A;  2HU9 A;  1Y1V I;  4Y52 I;  4Y7N I;  4E32 A;  2BJO A;  3G6E Z;  3S1N I;  3I56 1;  1WZN A;  2WAQ A;  2K3R A;  1ZB9 A;  5AN9 F;  2PM9 A;  2VPZ A;  1VQM Z;  3P5J B;  3GTM I;  1K9M 1;  2QLV B;  1M90 2;  3GTQ I;  3MZK B;  1AA6 A;  1VQN 1;  2VF1 A;  2QA4 1;  3BG0 B;  1TWH I;  1Q81 2;  3CCR 1;  3FQM A;  2V8K A;  4CL1 A;  2H85 A;  5IT9 b;  3CD6 1;  3CXC Y;  2QA4 Z;  1VQK Z;  3HOW I;  4RV9 A;  1X3W A;  2RT9 A;  3I55 Z;  1M1K 1;  2JIO A;  3F3F C;  4BY7 I;  1Y1V S;  2IZ3 A;  5C3E I;  3HOX I;  3VMI A;  2QRC B;  3HOZ I;  3I56 Z;  1PFT A;  1Q7Y 1;  1SIW A;  2QEX Z;  4NBC A;  1YJ9 1;  3G6E 1;  2W04 A;  2E9H A;  3CC4 Z;  2VPW A;  3CCJ Z;  2J6A A; 
#chains in the Genus database with same CATH homology
 3MON A;  4RVF A;  4A3E I;  1Z02 A;  2HF1 A;  1NJI 2;  2Y0S A;  1VQO Z;  4NBD A;  4QTU A;  1TFI A;  5IT9 f;  2R6M A;  2V8J A;  4E33 A;  4NBG A;  4S1T A;  2JA8 I;  2WB1 A;  3GTL I;  1NJI 1;  3D6W A;  1Z03 A;  4HH4 A;  5FLX b;  3MZL B;  4HGY A;  4NBH A;  1KQS Y;  1YI2 Z;  2I3C A;  3CCQ Z;  1VQ5 Z;  2P28 A;  1VQ8 Z;  3J80 f;  3M4O I;  1JJ2 Z;  4DQY B;  2ZAE B;  1VQM 1;  5T67 A;  1YJN Z;  3NH8 A;  1KC8 2;  1I6H I;  2QEX 1;  3FQQ A;  2GTI A;  1M1K 2;  1Y1W I;  1TWF I;  1QF8 A;  5A2Q b;  3H3V J;  1K8A 1;  2VUM I;  2F4M A;  2YAD A;  3GTG I;  1USP A;  4RVG A;  4E30 A;  3G71 Z;  3VMH A;  1YIJ 1;  1N2F A;  3NDJ A;  3CMA Z;  4E2Z A;  4NH1 C;  3I55 1;  4A3G I;  3GTJ I;  1YJW 1;  1Q82 1;  4QTT A;  2DE5 A;  3D9X A;  3PO2 I;  3I07 A;  4A3C I;  1WCM I;  1K8A 2;  1L1O C;  3IFU A;  1YUA A;  3CXC Z;  3CCE 1;  2QR1 B;  3PO3 I;  4A93 I;  2E2J I;  3J81 f;  1VQL Z;  3IX0 A;  1I3Q I;  3S2H I;  1VLA A;  3T4N B;  4A3M I;  4MD9 A;  2OOY B;  2PK7 A;  3TDH B;  4XX2 A;  1ML8 A;  4DGL A;  1RO2 A;  1DL6 A;  1VQ7 Z;  3CC7 Z;  3CCV Z;  1YJ9 Z;  2F4O A;  2M48 A;  1Q86 1;  1USP B;  2B63 I;  3CMA 1;  4A3D I;  3H0G I;  2RBL A;  4RS4 A;  2OTJ Z;  3IF8 A;  5C44 I;  3HKZ A;  3S1R I;  3GTO I;  2RPR A;  1YI2 1;  2OTL Z;  3CPW Z;  2NVY I;  4MON A;  1RLY A;  4BBS I;  2P3Y A;  3ESW A;  1VQK 1;  3I4M I;  3CCL Z;  3KIF A;  3NDI A;  1X3Z A;  2RHB A;  5D1O A;  3G4S Z;  2M6N A;  2OTL 1;  1K73 1;  2JA5 I;  2OOX B;  3CCU Z;  1Q81 1;  2Q4Z A;  3NFZ A;  1VQL 1;  3S16 I;  2GU2 A;  3JAM b;  3CCS 1;  4A3J I;  4AYB A;  3GTK I;  3CME Z;  3CPW Y;  3CCJ 1;  3CC4 1;  3JAM f;  3S2D I;  4A3I I;  3HOV I;  4BBR I;  1VQ7 1;  1VQP Z;  4A3F I;  2KPI A;  2JA6 I;  5C4J I;  3GTP I;  2AKL A;  4HGZ A;  3S14 I;  5D1P A;  5FLX f;  3RZO I;  4A3L I;  3CME 1;  1VQ9 Z;  3KIH A;  1SFO I;  1VQN Z;  1YIJ Z;  2O53 A;  2GTH A;  4A3B I;  2QKD A;  4BXX I;  1M90 1;  3OW2 Y;  2NVT I;  1JWH C;  3CCR Z;  3S17 I;  4NB9 A;  4MD8 A;  2DE7 A;  2W03 A;  1RQF A;  4MRI A;  4DK1 A;  3VTN A;  3EED A;  1S7M A;  1X0T A;  1WW9 A;  4NB8 A;  5T6B A;  3RZD I;  3QWU A;  5T64 A;  3S1Q I;  1QVG Z;  1VQ4 Z;  3CC2 Z;  1S72 Z;  1VQP 1;  3PO3 S;  1VQ6 Z;  1YIT Z;  1KQS Z;  1KD1 2;  1KC8 1;  2RIQ A;  1ZB8 A;  1N8R 1;  3GCF A;  1VQO 1;  3F3P C;  2OZK A;  2LFU A;  1VQ6 1;  2PMZ A;  1YIT 1;  2JS4 A;  4RVD A;  2QRD B;  4MXU A;  4EWC A;  2NVX I;  4RVH A;  1KD1 1;  4NBA A;  1VQ5 1;  2E2I I;  3I4N I;  3Q87 A;  3HOU I;  3CC7 1;  3GTM S;  3EER A;  4NFR A;  1S72 1;  4E31 A;  1Q82 2;  1NUI A;  3CC2 1;  2JUB A;  3J7A 4;  3CCV 1;  3S1M I;  3VMG A;  1NP6 A;  1R9T I;  3J81 b;  4E2W A;  2IZ4 A;  1P9N A;  2NVQ I;  2R93 I;  4TNU A;  3NH5 A;  3CCM Z;  1Q7Y 2;  5CM2 M;  5FLM I;  3LUS A;  1I50 I;  2JA7 I;  3S15 I;  2V8I A;  1VQ9 1;  2Q51 A;  2LIY A;  3BG1 B;  2VUG A;  1YUK A;  1TWA I;  4MD7 A;  1Z01 A;  4X6A I;  1YJW Z;  2QRE B;  1RO0 A;  2R7Z I;  1K73 2;  1RO4 A;  4E2X A;  2JR6 A;  2O4H A;  2KI7 B;  3OW2 Z;  4NOZ A;  2EGT A;  1K9M 2;  4A3K I;  3CCQ 1;  5C4X I;  1VQ8 1;  4NBB A;  3M3Y I;  3TE5 B;  3VB9 A;  5IP7 I;  1TWG I;  3NH4 A;  1KRL A;  3G4S 1;  5IP9 I;  3FKI I;  4E2Y A;  2JNY A;  2YU9 I;  5LL6 f;  1YJN 1;  1K83 I;  1RNI A;  1VQ4 1;  4NBF A;  3CCS Z;  1W2B Y;  1Q86 2;  3U50 C;  1LQL A;  1YHQ Z;  2K5R A;  3CCM 1;  2OTJ 1;  3G71 1;  1WII A;  2JMO A;  2R92 I;  1YHQ 1;  3HOY I;  3J80 b;  1QVF Y;  1N8R 2;  5A2Q f;  1QVG Y;  3CCL 1;  4BY1 I;  3CD6 Z;  3K7A I;  4MH4 A;  3GKQ A;  1QYP A;  5D1O B;  2E2H I;  1JJ2 Y;  2DE6 A;  1W2B Z;  4NBE A;  3CCU 1;  1ZH1 A;  3CQZ I;  2G2K A;  3CCE Z;  1QVF Z;  1TWC I;  2HU9 A;  1Y1V I;  4Y52 I;  4Y7N I;  4E32 A;  2BJO A;  3G6E Z;  3S1N I;  3I56 1;  2WAQ A;  2K3R A;  1ZB9 A;  5AN9 F;  2PM9 A;  1VQM Z;  3P5J B;  3GTM I;  1K9M 1;  2QLV B;  1M90 2;  3GTQ I;  3MZK B;  1VQN 1;  2VF1 A;  2QA4 1;  3BG0 B;  1TWH I;  1Q81 2;  3CCR 1;  3FQM A;  2V8K A;  4CL1 A;  2H85 A;  5IT9 b;  3CD6 1;  3CXC Y;  2QA4 Z;  1VQK Z;  3HOW I;  4RV9 A;  1X3W A;  2RT9 A;  3I55 Z;  1M1K 1;  3F3F C;  4BY7 I;  1Y1V S;  2IZ3 A;  5C3E I;  3HOX I;  3VMI A;  2QRC B;  3HOZ I;  3I56 Z;  1PFT A;  1Q7Y 1;  4NBC A;  3G6E 1;  1YJ9 1;  2QEX Z;  2W04 A;  2E9H A;  3CC4 Z;  3CCJ Z;  2J6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...