4DGLA

Crystal structure of the ck2 tetrameric holoenzyme
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
208
structure length
200
Chain Sequence
b'SWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Casein kinase II subunit beta
publication title Structural determinants of protein kinase CK2 regulation by autoinhibitory polymerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 48
structure length 200
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01214 CK_II_beta Casein kinase II regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1820.10 Mainly Alpha Orthogonal Bundle protein kinase ck2 holoenzyme, chain C, domain 1 protein kinase ck2 holoenzyme, chain C, domain 1 4dglA01
2.20.25.20 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4dglA02
4MD9A 4DGLA 1QF8A 2RT9A 4MD7A 4MD8A 3EEDA 2M6NA 4NH1C 1JWHC 1RQFA 2JMOA 2M48A 2R6MA
chains in the Genus database with same CATH superfamily
2JA6I 3G71Z 2VPYA 2PMZA 3IR7A 1VQ91 1ZH1A 4MONA 3S2DI 3CC41 4E2ZA 3HOVI 3JAMb 1VQLZ 4NFRA 1K83I 2F4MA 4E30A 3TE5B 2QR1B 2WAQA 1Y1VI 1VQK1 1Q16A 3VTNA 1KQSY 3GTMI 3VB9A 4RVHA 3CCLZ 4NBDA 1K8A2 2YADA 2GTIA 1WJ2A 3G4SZ 1S72Z 1TFIA 4MD9A 2OZKA 1NJI2 1Q862 1YI21 2ZAEB 2JIPA 1VQ41 2R7ZI 2VF1A 5IP9I 2JNYA 1QVGY 1Z02A 3VMIA 3GTQI 3CCR1 1YJWZ 1RO4A 1FDIA 2JIQA 1TWGI 3FQQA 2HF1A 4QTTA 2RHBA 1YJNZ 1M1K2 2RPRA 4HH4A 3CC21 1VQO1 1KD12 2GTHA 3CCQ1 1W2BZ 3IFUA 4MRIA 3CMEZ 2OTL1 1SIWA 2IZ4A 1PFTA 1Q811 3NH8A 4E2WA 4DQYB 4NBHA 2M48A 3NDIA 1Q7Y1 2JA8I 3CCEZ 1RNIA 1WW9A 1K9M1 1TWAI 1S7MA 3OW2Y 2K5RA 4BBRI 1Q822 1VQPZ 3H3VJ 1QVFY 3FKII 4A3JI 1ML8A 2W04A 2QRCB 3CPWZ 2E2HI 5C44I 1VQ6Z 3PO3S 3S1NI 4EWCA 1USPB 5FLXf 1YJ91 5T67A 3VMGA 1Q821 2AKLA 1K731 4A3LI 4E2YA 3CC4Z 5IP7I 2LFUA 2VUGA 1ZB8A 1VQ81 4Y7NI 2Q51A 4NOZA 5FLXb 3RZDI 2JIOA 1VQKZ 3CQZI 3CCU1 3K7AI 4MXUA 3HOZI 2RIQA 4NB8A 2JIMA 4NB9A 3BG1B 4NBGA 1RQFA 1KC81 2V8KA 1Y1VS 1N8R1 3S17I 1Z01A 3U50C 2B63I 2QEX1 1VQ4Z 4A3KI 3J7A4 3IX0A 2E7ZA 4Y52I 3S1RI 3S1MI 3CCRZ 1M902 3J80f 2VPXA 1VQ51 4MD7A 4HGZA 2PK7A 1WCMI 1VQN1 3T4NB 3J81f 4NBEA 1RO0A 4BY1I 1YUKA 2PM9A 3CC2Z 1VQOZ 4NBBA 3J80b 2QA4Z 3ESWA 5C4XI 2JR6A 2O4HA 1K8A1 1JJ2Y 4NH1C 3CC71 2OTLZ 2E9HA 3S2HI 3J81b 2OTJ1 1YIT1 2IV2X 3CD61 3M4OI 1NJI1 3EERA 1Q861 3I551 2EGTA 3VMHA 1VQM1 3CCJ1 3GCFA 1KRLA 3TDHB 4DGLA 4XX2A 4NBCA 5D1PA 3D2LA 5T64A 3CCL1 3P5JB 1M1K1 2R93I 1TWCI 3CMA1 4BBSI 2JMOA 2NAPA 1KD11 2BJOA 3FQMA 2V3VA 3H0GI 4E31A 4RV9A 1YJ9Z 3KIFA 2V8IA 2AYDA 3EEDA 2DE5A 5A2Qf 3CPWY 1YJW1 4A3DI 1SFOI 3NH4A 3IF8A 3MZLB 3F3PC 1WIIA 2OOXB 2NVXI 1VQ8Z 4TNUA 4A3MI 3MONA 5A2Qb 3G6E1 5FLMI 1YIJ1 4RVDA 1ZB9A 2P3YA 3CCV1 3CXCZ 1VQ9Z 3S1QI 2M6NA 1YUAA 4BXXI 3CCM1 1DL6A 2J6AA 1Z03A 2NVQI 2GU2A 3F3FC 2W03A 5D1OA 3I07A 4RVGA 1NUIA 2Q4ZA 3LUSA 2QEXZ 3OW2Z 4E33A 3CCS1 1QVFZ 1LQLA 2V45A 4QTUA 3PO3I 4A3FI 1VQ5Z 2VPZA 1VQ71 2JUBA 2E2II 3HOWI 1I3QI 3QWUA 3GTMS 2DE7A 1YHQ1 1I50I 2OOYB 5LL6f 1YI2Z 1FDOA 3GKQA 3HKZA 5C4JI 2JA7I 1Y1WI 4NBFA 3CC7Z 3GTJI 4S1TA 3KIHA 3NDJA 2YU9I 2OTJZ 4NBAA 1YITZ 3I561 1TWHI 4CL1A 3CD6Z 1L1OC 3I55Z 1Y8CA 1VQMZ 2DE6A 3CCJZ 3RZOI 3CCQZ 1M901 5T6BA 3G711 1VQ61 2O53A 1QYPA 3GTPI 2RBLA 4RVFA 2LEXA 3HOUI 3S14I 1W2BY 2R6MA 3CMAZ 3D9XA 1VQL1 1KQSZ 1JWHC 3I4MI 3GTOI 2JIRA 1N2FA 5CM2M 1QF8A 2JS4A 3M3YI 2R92I 4A3CI 2HU9A 3GTKI 3S15I 3Q87A 1AA6A 1QXFA 1X3WA 3S16I 5AN9F 2QRDB 1NP6A 2IZ3A 3G4S1 1S721 1QVGZ 1JJ2Z 2I3CA 2QREB 2P28A 2E2JI 1R9TI 2G2KA 4BY7I 1Q812 3G6EZ 2NVTI 1YIJZ 2QA41 3BG0B 2VUMI 3CCVZ 1P9NA 2KI7B 1X0TA 1RO2A 1Q7Y2 3MZKB 2Y0SA 2VPWA 2QKDA 4AYBA 1WZNA 3CCMZ 4MH4A 1K9M2 3PO2I 3CXCY 1YJN1 3GTLI 3CCUZ 3I4NI 2KPIA 1USPA 4A93I 3CCSZ 3CME1 3D6WA 1RLYA 1K732 1I6HI 1VQ7Z 3HOYI 2RT9A 5C3EI 4A3GI 2LIYA 4DK1A 2JA5I 2V8JA 1YHQZ 3NH5A 2F4OA 3GTGI 1VLAA 2QLVB 1X3ZA 2K3RA 4E32A 4HGYA 3CCE1 4A3II 5IT9f 1TWFI 3HOXI 4A3EI 4A3BI 2WB1A 3I56Z 1VQP1 1VQNZ 4E2XA 2H85A 2NVYI 1KC82 4MD8A 3NFZA 1N8R2 5IT9b 4X6AI 5D1OB 3JAMf 4RS4A
chains in the Genus database with same CATH topology
2JA6I 3G71Z 2PMZA 1VQ91 1ZH1A 4MONA 3S2DI 3CC41 4E2ZA 3HOVI 3JAMb 1VQLZ 4NFRA 1K83I 2F4MA 4E30A 3TE5B 2QR1B 2WAQA 1Y1VI 1VQK1 3VTNA 1KQSY 3GTMI 3VB9A 4RVHA 3CCLZ 4NBDA 1K8A2 2YADA 2GTIA 3G4SZ 1S72Z 1TFIA 4MD9A 2OZKA 1NJI2 1Q862 1YI21 2ZAEB 1VQ41 2R7ZI 2VF1A 5IP9I 2JNYA 1QVGY 1Z02A 3VMIA 3GTQI 3CCR1 1YJWZ 1RO4A 1TWGI 3FQQA 2HF1A 4QTTA 2RHBA 1YJNZ 1M1K2 2RPRA 4HH4A 3CC21 1VQO1 1KD12 2GTHA 3CCQ1 1W2BZ 3IFUA 4MRIA 3CMEZ 2OTL1 2IZ4A 1PFTA 1Q811 3NH8A 4E2WA 4DQYB 4NBHA 2M48A 3NDIA 1Q7Y1 2JA8I 3CCEZ 1RNIA 1WW9A 1K9M1 1TWAI 1S7MA 3OW2Y 2K5RA 4BBRI 1Q822 1VQPZ 3H3VJ 1QVFY 3FKII 4A3JI 1ML8A 2W04A 2QRCB 3CPWZ 2E2HI 5C44I 1VQ6Z 3PO3S 3S1NI 4EWCA 1USPB 5FLXf 1YJ91 5T67A 3VMGA 1Q821 2AKLA 1K731 4A3LI 4E2YA 3CC4Z 5IP7I 2LFUA 2VUGA 1ZB8A 1VQ81 4Y7NI 2Q51A 4NOZA 5FLXb 3RZDI 1VQKZ 3CQZI 3CCU1 3K7AI 4MXUA 3HOZI 2RIQA 4NB8A 4NB9A 3BG1B 4NBGA 1RQFA 1KC81 2V8KA 1Y1VS 1N8R1 3S17I 1Z01A 3U50C 2B63I 2QEX1 1VQ4Z 4A3KI 3J7A4 3IX0A 4Y52I 3S1RI 3S1MI 3CCRZ 1M902 3J80f 1VQ51 4MD7A 4HGZA 2PK7A 1WCMI 1VQN1 3T4NB 3J81f 4NBEA 1RO0A 4BY1I 1YUKA 2PM9A 3CC2Z 1VQOZ 4NBBA 3J80b 2QA4Z 3ESWA 5C4XI 2JR6A 2O4HA 1K8A1 1JJ2Y 4NH1C 3CC71 2OTLZ 2E9HA 3S2HI 3J81b 2OTJ1 1YIT1 3CD61 3M4OI 1NJI1 3EERA 1Q861 3I551 2EGTA 3VMHA 1VQM1 3CCJ1 3GCFA 1KRLA 3TDHB 4DGLA 4XX2A 4NBCA 5D1PA 5T64A 3CCL1 3P5JB 1M1K1 2R93I 1TWCI 3CMA1 4BBSI 2JMOA 1KD11 2BJOA 3FQMA 3H0GI 4E31A 4RV9A 1YJ9Z 3KIFA 2V8IA 3EEDA 2DE5A 5A2Qf 3CPWY 1YJW1 4A3DI 1SFOI 3NH4A 3IF8A 3MZLB 3F3PC 1WIIA 2OOXB 2NVXI 1VQ8Z 4TNUA 4A3MI 3MONA 5A2Qb 3G6E1 5FLMI 1YIJ1 4RVDA 1ZB9A 2P3YA 3CCV1 3CXCZ 1VQ9Z 3S1QI 2M6NA 1YUAA 4BXXI 3CCM1 1DL6A 2J6AA 1Z03A 2NVQI 2GU2A 3F3FC 2W03A 5D1OA 3I07A 4RVGA 1NUIA 2Q4ZA 3LUSA 2QEXZ 3OW2Z 4E33A 3CCS1 1QVFZ 1LQLA 4QTUA 3PO3I 4A3FI 1VQ5Z 1VQ71 2JUBA 2E2II 3HOWI 1I3QI 3QWUA 3GTMS 2DE7A 1YHQ1 1I50I 2OOYB 5LL6f 1YI2Z 3GKQA 3HKZA 5C4JI 2JA7I 1Y1WI 4NBFA 3CC7Z 3GTJI 4S1TA 3KIHA 3NDJA 2YU9I 2OTJZ 4NBAA 1YITZ 3I561 1TWHI 4CL1A 3CD6Z 1L1OC 3I55Z 1VQMZ 2DE6A 3CCJZ 3RZOI 3CCQZ 1M901 5T6BA 3G711 1VQ61 2O53A 1QYPA 3GTPI 2RBLA 4RVFA 3HOUI 3S14I 1W2BY 2R6MA 3CMAZ 3D9XA 1VQL1 1KQSZ 1JWHC 3I4MI 3GTOI 1N2FA 5CM2M 1QF8A 2JS4A 3M3YI 2R92I 4A3CI 2HU9A 3GTKI 3S15I 3Q87A 1X3WA 3S16I 5AN9F 2QRDB 1NP6A 2IZ3A 3G4S1 1S721 1QVGZ 1JJ2Z 2I3CA 2QREB 2P28A 2E2JI 1R9TI 2G2KA 4BY7I 1Q812 3G6EZ 2NVTI 1YIJZ 2QA41 3BG0B 2VUMI 3CCVZ 1P9NA 2KI7B 1X0TA 1RO2A 1Q7Y2 3MZKB 2Y0SA 2QKDA 4AYBA 3CCMZ 4MH4A 1K9M2 3PO2I 3CXCY 1YJN1 3GTLI 3CCUZ 3I4NI 2KPIA 1USPA 4A93I 3CCSZ 3CME1 3D6WA 1RLYA 1K732 1I6HI 1VQ7Z 3HOYI 2RT9A 5C3EI 4A3GI 2LIYA 4DK1A 2JA5I 2V8JA 1YHQZ 3NH5A 2F4OA 3GTGI 1VLAA 2QLVB 1X3ZA 2K3RA 4E32A 4HGYA 3CCE1 4A3II 5IT9f 1TWFI 3HOXI 4A3EI 4A3BI 2WB1A 3I56Z 1VQP1 1VQNZ 4E2XA 2H85A 2NVYI 1KC82 4MD8A 3NFZA 1N8R2 5IT9b 4X6AI 5D1OB 3JAMf 4RS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MD9 A;  4DGL A;  1QF8 A;  2RT9 A;  4MD7 A;  4MD8 A;  3EED A;  2M6N A;  4NH1 C;  1JWH C;  1RQF A;  2JMO A;  2M48 A;  2R6M A; 
#chains in the Genus database with same CATH topology
 2JA6 I;  3G71 Z;  2VPY A;  2PMZ A;  3IR7 A;  1VQ9 1;  1ZH1 A;  4MON A;  3S2D I;  3CC4 1;  4E2Z A;  3HOV I;  3JAM b;  1VQL Z;  4NFR A;  1K83 I;  2F4M A;  4E30 A;  3TE5 B;  2QR1 B;  2WAQ A;  1Y1V I;  1VQK 1;  1Q16 A;  3VTN A;  1KQS Y;  3GTM I;  3VB9 A;  4RVH A;  3CCL Z;  4NBD A;  1K8A 2;  2YAD A;  2GTI A;  1WJ2 A;  3G4S Z;  1S72 Z;  1TFI A;  4MD9 A;  2OZK A;  1NJI 2;  1Q86 2;  1YI2 1;  2ZAE B;  2JIP A;  1VQ4 1;  2R7Z I;  2VF1 A;  5IP9 I;  2JNY A;  1QVG Y;  1Z02 A;  3VMI A;  3GTQ I;  3CCR 1;  1YJW Z;  1RO4 A;  1FDI A;  2JIQ A;  1TWG I;  3FQQ A;  2HF1 A;  4QTT A;  2RHB A;  1YJN Z;  1M1K 2;  2RPR A;  4HH4 A;  3CC2 1;  1VQO 1;  1KD1 2;  2GTH A;  3CCQ 1;  1W2B Z;  3IFU A;  4MRI A;  3CME Z;  2OTL 1;  1SIW A;  2IZ4 A;  1PFT A;  1Q81 1;  3NH8 A;  4E2W A;  4DQY B;  4NBH A;  2M48 A;  3NDI A;  1Q7Y 1;  2JA8 I;  3CCE Z;  1RNI A;  1WW9 A;  1K9M 1;  1TWA I;  1S7M A;  3OW2 Y;  2K5R A;  4BBR I;  1Q82 2;  1VQP Z;  3H3V J;  1QVF Y;  3FKI I;  4A3J I;  1ML8 A;  2W04 A;  2QRC B;  3CPW Z;  2E2H I;  5C44 I;  1VQ6 Z;  3PO3 S;  3S1N I;  4EWC A;  1USP B;  5FLX f;  1YJ9 1;  5T67 A;  3VMG A;  1Q82 1;  2AKL A;  1K73 1;  4A3L I;  4E2Y A;  3CC4 Z;  5IP7 I;  2LFU A;  2VUG A;  1ZB8 A;  1VQ8 1;  4Y7N I;  2Q51 A;  4NOZ A;  5FLX b;  3RZD I;  2JIO A;  1VQK Z;  3CQZ I;  3CCU 1;  3K7A I;  4MXU A;  3HOZ I;  2RIQ A;  4NB8 A;  2JIM A;  4NB9 A;  3BG1 B;  4NBG A;  1RQF A;  1KC8 1;  2V8K A;  1Y1V S;  1N8R 1;  3S17 I;  1Z01 A;  3U50 C;  2B63 I;  2QEX 1;  1VQ4 Z;  4A3K I;  3J7A 4;  3IX0 A;  2E7Z A;  4Y52 I;  3S1R I;  3S1M I;  3CCR Z;  1M90 2;  3J80 f;  2VPX A;  1VQ5 1;  4MD7 A;  4HGZ A;  2PK7 A;  1WCM I;  1VQN 1;  3T4N B;  3J81 f;  4NBE A;  1RO0 A;  4BY1 I;  1YUK A;  2PM9 A;  3CC2 Z;  1VQO Z;  4NBB A;  3J80 b;  2QA4 Z;  3ESW A;  5C4X I;  2JR6 A;  2O4H A;  1K8A 1;  1JJ2 Y;  4NH1 C;  3CC7 1;  2OTL Z;  2E9H A;  3S2H I;  3J81 b;  2OTJ 1;  1YIT 1;  2IV2 X;  3CD6 1;  3M4O I;  1NJI 1;  3EER A;  1Q86 1;  3I55 1;  2EGT A;  3VMH A;  1VQM 1;  3CCJ 1;  3GCF A;  1KRL A;  3TDH B;  4DGL A;  4XX2 A;  4NBC A;  5D1P A;  3D2L A;  5T64 A;  3CCL 1;  3P5J B;  1M1K 1;  2R93 I;  1TWC I;  3CMA 1;  4BBS I;  2JMO A;  2NAP A;  1KD1 1;  2BJO A;  3FQM A;  2V3V A;  3H0G I;  4E31 A;  4RV9 A;  1YJ9 Z;  3KIF A;  2V8I A;  2AYD A;  3EED A;  2DE5 A;  5A2Q f;  3CPW Y;  1YJW 1;  4A3D I;  1SFO I;  3NH4 A;  3IF8 A;  3MZL B;  3F3P C;  1WII A;  2OOX B;  2NVX I;  1VQ8 Z;  4TNU A;  4A3M I;  3MON A;  5A2Q b;  3G6E 1;  5FLM I;  1YIJ 1;  4RVD A;  1ZB9 A;  2P3Y A;  3CCV 1;  3CXC Z;  1VQ9 Z;  3S1Q I;  2M6N A;  1YUA A;  4BXX I;  3CCM 1;  1DL6 A;  2J6A A;  1Z03 A;  2NVQ I;  2GU2 A;  3F3F C;  2W03 A;  5D1O A;  3I07 A;  4RVG A;  1NUI A;  2Q4Z A;  3LUS A;  2QEX Z;  3OW2 Z;  4E33 A;  3CCS 1;  1QVF Z;  1LQL A;  2V45 A;  4QTU A;  3PO3 I;  4A3F I;  1VQ5 Z;  2VPZ A;  1VQ7 1;  2JUB A;  2E2I I;  3HOW I;  1I3Q I;  3QWU A;  3GTM S;  2DE7 A;  1YHQ 1;  1I50 I;  2OOY B;  5LL6 f;  1YI2 Z;  1FDO A;  3GKQ A;  3HKZ A;  5C4J I;  2JA7 I;  1Y1W I;  4NBF A;  3CC7 Z;  3GTJ I;  4S1T A;  3KIH A;  3NDJ A;  2YU9 I;  2OTJ Z;  4NBA A;  1YIT Z;  3I56 1;  1TWH I;  4CL1 A;  3CD6 Z;  1L1O C;  3I55 Z;  1Y8C A;  1VQM Z;  2DE6 A;  3CCJ Z;  3RZO I;  3CCQ Z;  1M90 1;  5T6B A;  3G71 1;  1VQ6 1;  2O53 A;  1QYP A;  3GTP I;  2RBL A;  4RVF A;  2LEX A;  3HOU I;  3S14 I;  1W2B Y;  2R6M A;  3CMA Z;  3D9X A;  1VQL 1;  1KQS Z;  1JWH C;  3I4M I;  3GTO I;  2JIR A;  1N2F A;  5CM2 M;  1QF8 A;  2JS4 A;  3M3Y I;  2R92 I;  4A3C I;  2HU9 A;  3GTK I;  3S15 I;  3Q87 A;  1AA6 A;  1QXF A;  1X3W A;  3S16 I;  5AN9 F;  2QRD B;  1NP6 A;  2IZ3 A;  3G4S 1;  1S72 1;  1QVG Z;  1JJ2 Z;  2I3C A;  2QRE B;  2P28 A;  2E2J I;  1R9T I;  2G2K A;  4BY7 I;  1Q81 2;  3G6E Z;  2NVT I;  1YIJ Z;  2QA4 1;  3BG0 B;  2VUM I;  3CCV Z;  1P9N A;  2KI7 B;  1X0T A;  1RO2 A;  1Q7Y 2;  3MZK B;  2Y0S A;  2VPW A;  2QKD A;  4AYB A;  1WZN A;  3CCM Z;  4MH4 A;  1K9M 2;  3PO2 I;  3CXC Y;  1YJN 1;  3GTL I;  3CCU Z;  3I4N I;  2KPI A;  1USP A;  4A93 I;  3CCS Z;  3CME 1;  3D6W A;  1RLY A;  1K73 2;  1I6H I;  1VQ7 Z;  3HOY I;  2RT9 A;  5C3E I;  4A3G I;  2LIY A;  4DK1 A;  2JA5 I;  2V8J A;  1YHQ Z;  3NH5 A;  2F4O A;  3GTG I;  1VLA A;  2QLV B;  1X3Z A;  2K3R A;  4E32 A;  4HGY A;  3CCE 1;  4A3I I;  5IT9 f;  1TWF I;  3HOX I;  4A3E I;  4A3B I;  2WB1 A;  3I56 Z;  1VQP 1;  1VQN Z;  4E2X A;  2H85 A;  2NVY I;  1KC8 2;  4MD8 A;  3NFZ A;  1N8R 2;  5IT9 b;  4X6A I;  5D1O B;  3JAM f;  4RS4 A; 
#chains in the Genus database with same CATH homology
 2JA6 I;  3G71 Z;  2PMZ A;  1VQ9 1;  1ZH1 A;  4MON A;  3S2D I;  3CC4 1;  4E2Z A;  3HOV I;  3JAM b;  1VQL Z;  4NFR A;  1K83 I;  2F4M A;  4E30 A;  3TE5 B;  2QR1 B;  2WAQ A;  1Y1V I;  1VQK 1;  3VTN A;  1KQS Y;  3GTM I;  3VB9 A;  4RVH A;  3CCL Z;  4NBD A;  1K8A 2;  2YAD A;  2GTI A;  3G4S Z;  1S72 Z;  1TFI A;  4MD9 A;  2OZK A;  1NJI 2;  1Q86 2;  1YI2 1;  2ZAE B;  1VQ4 1;  2R7Z I;  2VF1 A;  5IP9 I;  2JNY A;  1QVG Y;  1Z02 A;  3VMI A;  3GTQ I;  3CCR 1;  1YJW Z;  1RO4 A;  1TWG I;  3FQQ A;  2HF1 A;  4QTT A;  2RHB A;  1YJN Z;  1M1K 2;  2RPR A;  4HH4 A;  3CC2 1;  1VQO 1;  1KD1 2;  2GTH A;  3CCQ 1;  1W2B Z;  3IFU A;  4MRI A;  3CME Z;  2OTL 1;  2IZ4 A;  1PFT A;  1Q81 1;  3NH8 A;  4E2W A;  4DQY B;  4NBH A;  2M48 A;  3NDI A;  1Q7Y 1;  2JA8 I;  3CCE Z;  1RNI A;  1WW9 A;  1K9M 1;  1TWA I;  1S7M A;  3OW2 Y;  2K5R A;  4BBR I;  1Q82 2;  1VQP Z;  3H3V J;  1QVF Y;  3FKI I;  4A3J I;  1ML8 A;  2W04 A;  2QRC B;  3CPW Z;  2E2H I;  5C44 I;  1VQ6 Z;  3PO3 S;  3S1N I;  4EWC A;  1USP B;  5FLX f;  1YJ9 1;  5T67 A;  3VMG A;  1Q82 1;  2AKL A;  1K73 1;  4A3L I;  4E2Y A;  3CC4 Z;  5IP7 I;  2LFU A;  2VUG A;  1ZB8 A;  1VQ8 1;  4Y7N I;  2Q51 A;  4NOZ A;  5FLX b;  3RZD I;  1VQK Z;  3CQZ I;  3CCU 1;  3K7A I;  4MXU A;  3HOZ I;  2RIQ A;  4NB8 A;  4NB9 A;  3BG1 B;  4NBG A;  1RQF A;  1KC8 1;  2V8K A;  1Y1V S;  1N8R 1;  3S17 I;  1Z01 A;  3U50 C;  2B63 I;  2QEX 1;  1VQ4 Z;  4A3K I;  3J7A 4;  3IX0 A;  4Y52 I;  3S1R I;  3S1M I;  3CCR Z;  1M90 2;  3J80 f;  1VQ5 1;  4MD7 A;  4HGZ A;  2PK7 A;  1WCM I;  1VQN 1;  3T4N B;  3J81 f;  4NBE A;  1RO0 A;  4BY1 I;  1YUK A;  2PM9 A;  3CC2 Z;  1VQO Z;  4NBB A;  3J80 b;  2QA4 Z;  3ESW A;  5C4X I;  2JR6 A;  2O4H A;  1K8A 1;  1JJ2 Y;  4NH1 C;  3CC7 1;  2OTL Z;  2E9H A;  3S2H I;  3J81 b;  2OTJ 1;  1YIT 1;  3CD6 1;  3M4O I;  1NJI 1;  3EER A;  1Q86 1;  3I55 1;  2EGT A;  3VMH A;  1VQM 1;  3CCJ 1;  3GCF A;  1KRL A;  3TDH B;  4DGL A;  4XX2 A;  4NBC A;  5D1P A;  5T64 A;  3CCL 1;  3P5J B;  1M1K 1;  2R93 I;  1TWC I;  3CMA 1;  4BBS I;  2JMO A;  1KD1 1;  2BJO A;  3FQM A;  3H0G I;  4E31 A;  4RV9 A;  1YJ9 Z;  3KIF A;  2V8I A;  3EED A;  2DE5 A;  5A2Q f;  3CPW Y;  1YJW 1;  4A3D I;  1SFO I;  3NH4 A;  3IF8 A;  3MZL B;  3F3P C;  1WII A;  2OOX B;  2NVX I;  1VQ8 Z;  4TNU A;  4A3M I;  3MON A;  5A2Q b;  3G6E 1;  5FLM I;  1YIJ 1;  4RVD A;  1ZB9 A;  2P3Y A;  3CCV 1;  3CXC Z;  1VQ9 Z;  3S1Q I;  2M6N A;  1YUA A;  4BXX I;  3CCM 1;  1DL6 A;  2J6A A;  1Z03 A;  2NVQ I;  2GU2 A;  3F3F C;  2W03 A;  5D1O A;  3I07 A;  4RVG A;  1NUI A;  2Q4Z A;  3LUS A;  2QEX Z;  3OW2 Z;  4E33 A;  3CCS 1;  1QVF Z;  1LQL A;  4QTU A;  3PO3 I;  4A3F I;  1VQ5 Z;  1VQ7 1;  2JUB A;  2E2I I;  3HOW I;  1I3Q I;  3QWU A;  3GTM S;  2DE7 A;  1YHQ 1;  1I50 I;  2OOY B;  5LL6 f;  1YI2 Z;  3GKQ A;  3HKZ A;  5C4J I;  2JA7 I;  1Y1W I;  4NBF A;  3CC7 Z;  3GTJ I;  4S1T A;  3KIH A;  3NDJ A;  2YU9 I;  2OTJ Z;  4NBA A;  1YIT Z;  3I56 1;  1TWH I;  4CL1 A;  3CD6 Z;  1L1O C;  3I55 Z;  1VQM Z;  2DE6 A;  3CCJ Z;  3RZO I;  3CCQ Z;  1M90 1;  5T6B A;  3G71 1;  1VQ6 1;  2O53 A;  1QYP A;  3GTP I;  2RBL A;  4RVF A;  3HOU I;  3S14 I;  1W2B Y;  2R6M A;  3CMA Z;  3D9X A;  1VQL 1;  1KQS Z;  1JWH C;  3I4M I;  3GTO I;  1N2F A;  5CM2 M;  1QF8 A;  2JS4 A;  3M3Y I;  2R92 I;  4A3C I;  2HU9 A;  3GTK I;  3S15 I;  3Q87 A;  1X3W A;  3S16 I;  5AN9 F;  2QRD B;  1NP6 A;  2IZ3 A;  3G4S 1;  1S72 1;  1QVG Z;  1JJ2 Z;  2I3C A;  2QRE B;  2P28 A;  2E2J I;  1R9T I;  2G2K A;  4BY7 I;  1Q81 2;  3G6E Z;  2NVT I;  1YIJ Z;  2QA4 1;  3BG0 B;  2VUM I;  3CCV Z;  1P9N A;  2KI7 B;  1X0T A;  1RO2 A;  1Q7Y 2;  3MZK B;  2Y0S A;  2QKD A;  4AYB A;  3CCM Z;  4MH4 A;  1K9M 2;  3PO2 I;  3CXC Y;  1YJN 1;  3GTL I;  3CCU Z;  3I4N I;  2KPI A;  1USP A;  4A93 I;  3CCS Z;  3CME 1;  3D6W A;  1RLY A;  1K73 2;  1I6H I;  1VQ7 Z;  3HOY I;  2RT9 A;  5C3E I;  4A3G I;  2LIY A;  4DK1 A;  2JA5 I;  2V8J A;  1YHQ Z;  3NH5 A;  2F4O A;  3GTG I;  1VLA A;  2QLV B;  1X3Z A;  2K3R A;  4E32 A;  4HGY A;  3CCE 1;  4A3I I;  5IT9 f;  1TWF I;  3HOX I;  4A3E I;  4A3B I;  2WB1 A;  3I56 Z;  1VQP 1;  1VQN Z;  4E2X A;  2H85 A;  2NVY I;  1KC8 2;  4MD8 A;  3NFZ A;  1N8R 2;  5IT9 b;  4X6A I;  5D1O B;  3JAM f;  4RS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...