4DGLA

Crystal structure of the ck2 tetrameric holoenzyme
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
208
structure length
200
Chain Sequence
SWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Casein kinase II subunit beta
publication title Structural determinants of protein kinase CK2 regulation by autoinhibitory polymerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 48
structure length 200
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01214 CK_II_beta Casein kinase II regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1820.10 Mainly Alpha Orthogonal Bundle protein kinase ck2 holoenzyme, chain C, domain 1 protein kinase ck2 holoenzyme, chain C, domain 1 4dglA01
2.20.25.20 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4dglA02
4DGLA 4MD9A 2M48A 1RQFA 3EEDA 4MD8A 4MD7A 2M6NA 2R6MA 1JWHC 2JMOA 4NH1C 1QF8A 2RT9A
chains in the Genus database with same CATH superfamily
2JR6A 3OW2Y 2JUBA 1K8A2 2NVYI 1VQMZ 2VPWA 1KD11 1YIJZ 3S17I 5C4XI 2DE7A 4A3CI 4A3MI 3NDJA 3GTMS 2QREB 4RVFA 2VPYA 4RVDA 1QVFY 2JA8I 2V8JA 1M902 2M6NA 3G6EZ 1WJ2A 4HH4A 5C4JI 2JIMA 3CXCY 2QLVB 2RBLA 2GTIA 1AA6A 3PO2I 3GTOI 3D9XA 3EERA 4HGYA 3CCLZ 1RQFA 2JIOA 5LL6f 1NJI1 5CM2M 1VQP1 1P9NA 3CD6Z 4NFRA 1VQ91 3P5JB 2R7ZI 3S16I 2O53A 1YI21 1Q7Y1 2QRCB 1Q861 1Y8CA 3H0GI 3QWUA 3M4OI 1R9TI 1JWHC 2VUGA 3GKQA 1ZB9A 2VPXA 2P3YA 2QEX1 4NBBA 1QF8A 3H3VJ 2KI7B 3J81b 2R93I 1RO4A 4DQYB 2E7ZA 3S1QI 1KRLA 2LEXA 2JIQA 1Y1WI 4RS4A 1K83I 3KIHA 4DGLA 1YJ91 1YJ9Z 1VQ71 2LFUA 1YHQZ 3ESWA 3S2DI 1VQK1 1Q812 3CMA1 3S1MI 1VQLZ 4NBHA 2E9HA 2G2KA 2JA5I 2M48A 1VQ5Z 4NB8A 3CCM1 4A3KI 1YJN1 5FLXf 1VQ41 3CCEZ 4MH4A 1Q822 1LQLA 5FLXb 1VQ4Z 2E2JI 1ZH1A 1YIT1 2JA6I 1Z03A 1WCMI 4E2YA 3GCFA 1VQ81 1K9M2 1K732 2PMZA 1I50I 1W2BZ 1K8A1 2R92I 4A3DI 4A3II 4E30A 3VMHA 3J80f 4BBRI 3CQZI 3HOXI 5IP7I 3EEDA 3J80b 4MONA 4E2ZA 2OOYB 2J6AA 2F4OA 4HGZA 3BG1B 1M901 1NP6A 2DE5A 3D6WA 1I6HI 3PO3I 1NUIA 4NBFA 4A3JI 3CC71 1JJ2Z 1USPA 3HOUI 5A2Qf 2LIYA 2V45A 4A93I 1Y1VS 2JNYA 2JIPA 3J7A4 1M1K2 5A2Qb 1N8R1 1N2FA 2K5RA 3CC21 3CC41 3NH8A 3CCV1 2HU9A 1Y1VI 2Y0SA 3CCU1 2JIRA 4A3FI 4MD9A 1VQ61 1VQPZ 3VMGA 1TWCI 3G4S1 5D1PA 1VQ9Z 4NBEA 3F3FC 1YI2Z 3M3YI 3D2LA 3FQMA 2GTHA 3CME1 4EWCA 3CMEZ 1Q16A 4E33A 1PFTA 2NAPA 2Q51A 2Q4ZA 1KQSZ 3I4MI 3I551 3IF8A 2QEXZ 3TE5B 1X0TA 5AN9F 2YADA 2E2HI 4XX2A 3Q87A 2VUMI 4E31A 4A3LI 1NJI2 3G711 1VQN1 3I07A 3IX0A 4MRIA 1VQNZ 1Q7Y2 2IZ4A 1S721 1VQO1 3HOVI 4NBGA 5T67A 3VB9A 1Q811 3GTKI 2QKDA 1Z01A 2O4HA 1QVGY 1VQ7Z 3MONA 1TWFI 2QA41 1VQKZ 3TDHB 3CMAZ 1Q821 2ZAEB 2QA4Z 2V8IA 2V8KA 3CCMZ 1YJNZ 2W04A 2I3CA 3S2HI 2BJOA 3CCS1 3I561 1W2BY 1K9M1 3K7AI 3GTLI 2DE6A 2KPIA 1YITZ 3FQQA 3BG0B 1KC82 1YUAA 5IP9I 5D1OA 1VQ8Z 4S1TA 2OZKA 3FKII 3CCJ1 3LUSA 4NBAA 3U50C 4BY7I 1TFIA 5C3EI 2JS4A 3JAMf 4A3EI 2NVQI 3CCR1 3PO3S 5C44I 2OOXB 3JAMb 2JMOA 4RVGA 3HOZI 2WAQA 2OTL1 3IFUA 2AYDA 2VF1A 3S15I 3VTNA 1JJ2Y 4BBSI 3GTQI 3MZKB 4RVHA 1DL6A 1RNIA 1VQM1 1YIJ1 3GTGI 2AKLA 3CPWZ 2QR1B 3NH4A 1M1K1 4Y7NI 2NVXI 3CC7Z 3CCQ1 3OW2Z 1KD12 3CCQZ 2QRDB 2RHBA 3KIFA 3T4NB 1RO2A 1ML8A 3S14I 3GTJI 3G6E1 3GTMI 3HKZA 1QVFZ 2HF1A 3HOYI 2WB1A 2R6MA 3CC2Z 3CC4Z 4NH1C 1TWAI 4A3BI 3CCVZ 3CCUZ 4NOZA 1SIWA 3NFZA 2V3VA 3CCL1 1VQ6Z 3F3PC 1TWHI 3G4SZ 1QXFA 4A3GI 1KQSY 3CXCZ 4X6AI 1Z02A 1N8R2 3HOWI 2E2II 4MXUA 1YJW1 1WZNA 3CD61 1VLAA 1YJWZ 1S7MA 4QTTA 5IT9f 2YU9I 1X3WA 3IR7A 3I55Z 1L1OC 4BXXI 5IT9b 2H85A 5T64A 3G71Z 2OTJ1 2EGTA 2P28A 4NBCA 2OTJZ 4DK1A 1Q862 4Y52I 1S72Z 2RIQA 1VQOZ 1RO0A 4AYBA 3J81f 1TWGI 3NDIA 2W03A 2PM9A 1FDOA 3MZLB 1SFOI 4E32A 4QTUA 2JA7I 5D1OB 2RPRA 5FLMI 4RV9A 1WW9A 3I4NI 4MD8A 4E2XA 1KC81 1K731 1X3ZA 4CL1A 3RZOI 3CCSZ 3I56Z 1YHQ1 3S1NI 4BY1I 4TNUA 1YUKA 1VQL1 4NBDA 2GU2A 2K3RA 1VQ51 2IV2X 1ZB8A 2VPZA 3NH5A 2PK7A 3VMIA 4E2WA 1I3QI 1WIIA 3CCE1 3CCJZ 3RZDI 4MD7A 1QYPA 2IZ3A 1QVGZ 4NB9A 1FDIA 3S1RI 2F4MA 2NVTI 3CCRZ 3GTPI 1USPB 2B63I 3CPWY 1RLYA 2OTLZ 5T6BA 2RT9A
chains in the Genus database with same CATH topology
2JR6A 3OW2Y 2JUBA 1K8A2 2NVYI 1VQMZ 1KD11 1YIJZ 3S17I 5C4XI 2DE7A 4A3CI 4A3MI 3NDJA 3GTMS 2QREB 4RVFA 4RVDA 1QVFY 2JA8I 2V8JA 1M902 2M6NA 3G6EZ 4HH4A 5C4JI 3CXCY 2QLVB 2RBLA 2GTIA 3PO2I 3GTOI 3D9XA 3EERA 4HGYA 3CCLZ 1RQFA 5LL6f 1NJI1 5CM2M 1VQP1 1P9NA 3CD6Z 4NFRA 1VQ91 3P5JB 2R7ZI 3S16I 2O53A 1YI21 1Q7Y1 2QRCB 1Q861 3H0GI 3QWUA 3M4OI 1R9TI 1JWHC 2VUGA 3GKQA 1ZB9A 2P3YA 2QEX1 4NBBA 1QF8A 3H3VJ 2KI7B 3J81b 2R93I 1RO4A 4DQYB 3S1QI 1KRLA 1Y1WI 4RS4A 1K83I 3KIHA 4DGLA 1YJ91 1YJ9Z 1VQ71 2LFUA 1YHQZ 3ESWA 3S2DI 1VQK1 1Q812 3CMA1 3S1MI 1VQLZ 4NBHA 2E9HA 2G2KA 2JA5I 2M48A 1VQ5Z 4NB8A 3CCM1 4A3KI 1YJN1 5FLXf 1VQ41 3CCEZ 4MH4A 1Q822 1LQLA 5FLXb 1VQ4Z 2E2JI 1ZH1A 1YIT1 2JA6I 1Z03A 1WCMI 4E2YA 3GCFA 1VQ81 1K9M2 1K732 2PMZA 1I50I 1W2BZ 1K8A1 2R92I 4A3DI 4A3II 4E30A 3VMHA 3J80f 4BBRI 3CQZI 3HOXI 5IP7I 3EEDA 3J80b 4MONA 4E2ZA 2OOYB 2J6AA 2F4OA 4HGZA 3BG1B 1M901 1NP6A 2DE5A 3D6WA 1I6HI 3PO3I 1NUIA 4NBFA 4A3JI 3CC71 1JJ2Z 1USPA 3HOUI 5A2Qf 2LIYA 4A93I 1Y1VS 2JNYA 3J7A4 1M1K2 5A2Qb 1N8R1 1N2FA 2K5RA 3CC21 3CC41 3NH8A 3CCV1 2HU9A 1Y1VI 2Y0SA 3CCU1 4A3FI 4MD9A 1VQ61 1VQPZ 3VMGA 1TWCI 3G4S1 5D1PA 1VQ9Z 4NBEA 3F3FC 1YI2Z 3M3YI 3FQMA 2GTHA 3CME1 4EWCA 3CMEZ 4E33A 1PFTA 2Q51A 2Q4ZA 1KQSZ 3I4MI 3I551 3IF8A 2QEXZ 3TE5B 1X0TA 5AN9F 2YADA 2E2HI 4XX2A 3Q87A 2VUMI 4E31A 4A3LI 1NJI2 3G711 1VQN1 3I07A 3IX0A 4MRIA 1VQNZ 1Q7Y2 2IZ4A 1S721 1VQO1 3HOVI 4NBGA 5T67A 3VB9A 1Q811 3GTKI 2QKDA 1Z01A 2O4HA 1QVGY 1VQ7Z 3MONA 1TWFI 2QA41 1VQKZ 3TDHB 3CMAZ 1Q821 2ZAEB 2QA4Z 2V8IA 2V8KA 3CCMZ 1YJNZ 2W04A 2I3CA 3S2HI 2BJOA 3CCS1 3I561 1W2BY 1K9M1 3K7AI 3GTLI 2DE6A 2KPIA 1YITZ 3FQQA 3BG0B 1KC82 1YUAA 5IP9I 5D1OA 1VQ8Z 4S1TA 2OZKA 3FKII 3CCJ1 3LUSA 4NBAA 3U50C 4BY7I 1TFIA 5C3EI 2JS4A 3JAMf 4A3EI 2NVQI 3CCR1 3PO3S 5C44I 2OOXB 3JAMb 2JMOA 4RVGA 3HOZI 2WAQA 2OTL1 3IFUA 2VF1A 3S15I 3VTNA 1JJ2Y 4BBSI 3GTQI 3MZKB 4RVHA 1DL6A 1RNIA 1VQM1 1YIJ1 3GTGI 2AKLA 3CPWZ 2QR1B 3NH4A 1M1K1 4Y7NI 2NVXI 3CC7Z 3CCQ1 3OW2Z 1KD12 3CCQZ 2QRDB 2RHBA 3KIFA 3T4NB 1RO2A 1ML8A 3S14I 3GTJI 3G6E1 3GTMI 3HKZA 1QVFZ 2HF1A 3HOYI 2WB1A 2R6MA 3CC2Z 3CC4Z 4NH1C 1TWAI 4A3BI 3CCVZ 3CCUZ 4NOZA 3NFZA 3CCL1 1VQ6Z 3F3PC 1TWHI 3G4SZ 4A3GI 1KQSY 3CXCZ 4X6AI 1Z02A 1N8R2 3HOWI 2E2II 4MXUA 1YJW1 3CD61 1VLAA 1YJWZ 1S7MA 4QTTA 5IT9f 2YU9I 1X3WA 3I55Z 1L1OC 4BXXI 5IT9b 2H85A 5T64A 3G71Z 2OTJ1 2EGTA 2P28A 4NBCA 2OTJZ 4DK1A 1Q862 4Y52I 1S72Z 2RIQA 1VQOZ 1RO0A 4AYBA 3J81f 1TWGI 3NDIA 2W03A 2PM9A 3MZLB 1SFOI 4E32A 4QTUA 2JA7I 5D1OB 2RPRA 5FLMI 4RV9A 1WW9A 3I4NI 4MD8A 4E2XA 1KC81 1K731 1X3ZA 4CL1A 3RZOI 3CCSZ 3I56Z 1YHQ1 3S1NI 4BY1I 4TNUA 1YUKA 1VQL1 4NBDA 2GU2A 2K3RA 1VQ51 1ZB8A 3NH5A 2PK7A 3VMIA 4E2WA 1I3QI 1WIIA 3CCE1 3CCJZ 3RZDI 4MD7A 1QYPA 2IZ3A 1QVGZ 4NB9A 3S1RI 2F4MA 2NVTI 3CCRZ 3GTPI 1USPB 2B63I 3CPWY 1RLYA 2OTLZ 5T6BA 2RT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DGL A;  4MD9 A;  2M48 A;  1RQF A;  3EED A;  4MD8 A;  4MD7 A;  2M6N A;  2R6M A;  1JWH C;  2JMO A;  4NH1 C;  1QF8 A;  2RT9 A; 
#chains in the Genus database with same CATH topology
 2JR6 A;  3OW2 Y;  2JUB A;  1K8A 2;  2NVY I;  1VQM Z;  2VPW A;  1KD1 1;  1YIJ Z;  3S17 I;  5C4X I;  2DE7 A;  4A3C I;  4A3M I;  3NDJ A;  3GTM S;  2QRE B;  4RVF A;  2VPY A;  4RVD A;  1QVF Y;  2JA8 I;  2V8J A;  1M90 2;  2M6N A;  3G6E Z;  1WJ2 A;  4HH4 A;  5C4J I;  2JIM A;  3CXC Y;  2QLV B;  2RBL A;  2GTI A;  1AA6 A;  3PO2 I;  3GTO I;  3D9X A;  3EER A;  4HGY A;  3CCL Z;  1RQF A;  2JIO A;  5LL6 f;  1NJI 1;  5CM2 M;  1VQP 1;  1P9N A;  3CD6 Z;  4NFR A;  1VQ9 1;  3P5J B;  2R7Z I;  3S16 I;  2O53 A;  1YI2 1;  1Q7Y 1;  2QRC B;  1Q86 1;  1Y8C A;  3H0G I;  3QWU A;  3M4O I;  1R9T I;  1JWH C;  2VUG A;  3GKQ A;  1ZB9 A;  2VPX A;  2P3Y A;  2QEX 1;  4NBB A;  1QF8 A;  3H3V J;  2KI7 B;  3J81 b;  2R93 I;  1RO4 A;  4DQY B;  2E7Z A;  3S1Q I;  1KRL A;  2LEX A;  2JIQ A;  1Y1W I;  4RS4 A;  1K83 I;  3KIH A;  4DGL A;  1YJ9 1;  1YJ9 Z;  1VQ7 1;  2LFU A;  1YHQ Z;  3ESW A;  3S2D I;  1VQK 1;  1Q81 2;  3CMA 1;  3S1M I;  1VQL Z;  4NBH A;  2E9H A;  2G2K A;  2JA5 I;  2M48 A;  1VQ5 Z;  4NB8 A;  3CCM 1;  4A3K I;  1YJN 1;  5FLX f;  1VQ4 1;  3CCE Z;  4MH4 A;  1Q82 2;  1LQL A;  5FLX b;  1VQ4 Z;  2E2J I;  1ZH1 A;  1YIT 1;  2JA6 I;  1Z03 A;  1WCM I;  4E2Y A;  3GCF A;  1VQ8 1;  1K9M 2;  1K73 2;  2PMZ A;  1I50 I;  1W2B Z;  1K8A 1;  2R92 I;  4A3D I;  4A3I I;  4E30 A;  3VMH A;  3J80 f;  4BBR I;  3CQZ I;  3HOX I;  5IP7 I;  3EED A;  3J80 b;  4MON A;  4E2Z A;  2OOY B;  2J6A A;  2F4O A;  4HGZ A;  3BG1 B;  1M90 1;  1NP6 A;  2DE5 A;  3D6W A;  1I6H I;  3PO3 I;  1NUI A;  4NBF A;  4A3J I;  3CC7 1;  1JJ2 Z;  1USP A;  3HOU I;  5A2Q f;  2LIY A;  2V45 A;  4A93 I;  1Y1V S;  2JNY A;  2JIP A;  3J7A 4;  1M1K 2;  5A2Q b;  1N8R 1;  1N2F A;  2K5R A;  3CC2 1;  3CC4 1;  3NH8 A;  3CCV 1;  2HU9 A;  1Y1V I;  2Y0S A;  3CCU 1;  2JIR A;  4A3F I;  4MD9 A;  1VQ6 1;  1VQP Z;  3VMG A;  1TWC I;  3G4S 1;  5D1P A;  1VQ9 Z;  4NBE A;  3F3F C;  1YI2 Z;  3M3Y I;  3D2L A;  3FQM A;  2GTH A;  3CME 1;  4EWC A;  3CME Z;  1Q16 A;  4E33 A;  1PFT A;  2NAP A;  2Q51 A;  2Q4Z A;  1KQS Z;  3I4M I;  3I55 1;  3IF8 A;  2QEX Z;  3TE5 B;  1X0T A;  5AN9 F;  2YAD A;  2E2H I;  4XX2 A;  3Q87 A;  2VUM I;  4E31 A;  4A3L I;  1NJI 2;  3G71 1;  1VQN 1;  3I07 A;  3IX0 A;  4MRI A;  1VQN Z;  1Q7Y 2;  2IZ4 A;  1S72 1;  1VQO 1;  3HOV I;  4NBG A;  5T67 A;  3VB9 A;  1Q81 1;  3GTK I;  2QKD A;  1Z01 A;  2O4H A;  1QVG Y;  1VQ7 Z;  3MON A;  1TWF I;  2QA4 1;  1VQK Z;  3TDH B;  3CMA Z;  1Q82 1;  2ZAE B;  2QA4 Z;  2V8I A;  2V8K A;  3CCM Z;  1YJN Z;  2W04 A;  2I3C A;  3S2H I;  2BJO A;  3CCS 1;  3I56 1;  1W2B Y;  1K9M 1;  3K7A I;  3GTL I;  2DE6 A;  2KPI A;  1YIT Z;  3FQQ A;  3BG0 B;  1KC8 2;  1YUA A;  5IP9 I;  5D1O A;  1VQ8 Z;  4S1T A;  2OZK A;  3FKI I;  3CCJ 1;  3LUS A;  4NBA A;  3U50 C;  4BY7 I;  1TFI A;  5C3E I;  2JS4 A;  3JAM f;  4A3E I;  2NVQ I;  3CCR 1;  3PO3 S;  5C44 I;  2OOX B;  3JAM b;  2JMO A;  4RVG A;  3HOZ I;  2WAQ A;  2OTL 1;  3IFU A;  2AYD A;  2VF1 A;  3S15 I;  3VTN A;  1JJ2 Y;  4BBS I;  3GTQ I;  3MZK B;  4RVH A;  1DL6 A;  1RNI A;  1VQM 1;  1YIJ 1;  3GTG I;  2AKL A;  3CPW Z;  2QR1 B;  3NH4 A;  1M1K 1;  4Y7N I;  2NVX I;  3CC7 Z;  3CCQ 1;  3OW2 Z;  1KD1 2;  3CCQ Z;  2QRD B;  2RHB A;  3KIF A;  3T4N B;  1RO2 A;  1ML8 A;  3S14 I;  3GTJ I;  3G6E 1;  3GTM I;  3HKZ A;  1QVF Z;  2HF1 A;  3HOY I;  2WB1 A;  2R6M A;  3CC2 Z;  3CC4 Z;  4NH1 C;  1TWA I;  4A3B I;  3CCV Z;  3CCU Z;  4NOZ A;  1SIW A;  3NFZ A;  2V3V A;  3CCL 1;  1VQ6 Z;  3F3P C;  1TWH I;  3G4S Z;  1QXF A;  4A3G I;  1KQS Y;  3CXC Z;  4X6A I;  1Z02 A;  1N8R 2;  3HOW I;  2E2I I;  4MXU A;  1YJW 1;  1WZN A;  3CD6 1;  1VLA A;  1YJW Z;  1S7M A;  4QTT A;  5IT9 f;  2YU9 I;  1X3W A;  3IR7 A;  3I55 Z;  1L1O C;  4BXX I;  5IT9 b;  2H85 A;  5T64 A;  3G71 Z;  2OTJ 1;  2EGT A;  2P28 A;  4NBC A;  2OTJ Z;  4DK1 A;  1Q86 2;  4Y52 I;  1S72 Z;  2RIQ A;  1VQO Z;  1RO0 A;  4AYB A;  3J81 f;  1TWG I;  3NDI A;  2W03 A;  2PM9 A;  1FDO A;  3MZL B;  1SFO I;  4E32 A;  4QTU A;  2JA7 I;  5D1O B;  2RPR A;  5FLM I;  4RV9 A;  1WW9 A;  3I4N I;  4MD8 A;  4E2X A;  1KC8 1;  1K73 1;  1X3Z A;  4CL1 A;  3RZO I;  3CCS Z;  3I56 Z;  1YHQ 1;  3S1N I;  4BY1 I;  4TNU A;  1YUK A;  1VQL 1;  4NBD A;  2GU2 A;  2K3R A;  1VQ5 1;  2IV2 X;  1ZB8 A;  2VPZ A;  3NH5 A;  2PK7 A;  3VMI A;  4E2W A;  1I3Q I;  1WII A;  3CCE 1;  3CCJ Z;  3RZD I;  4MD7 A;  1QYP A;  2IZ3 A;  1QVG Z;  4NB9 A;  1FDI A;  3S1R I;  2F4M A;  2NVT I;  3CCR Z;  3GTP I;  1USP B;  2B63 I;  3CPW Y;  1RLY A;  2OTL Z;  5T6B A;  2RT9 A; 
#chains in the Genus database with same CATH homology
 2JR6 A;  3OW2 Y;  2JUB A;  1K8A 2;  2NVY I;  1VQM Z;  1KD1 1;  1YIJ Z;  3S17 I;  5C4X I;  2DE7 A;  4A3C I;  4A3M I;  3NDJ A;  3GTM S;  2QRE B;  4RVF A;  4RVD A;  1QVF Y;  2JA8 I;  2V8J A;  1M90 2;  2M6N A;  3G6E Z;  4HH4 A;  5C4J I;  3CXC Y;  2QLV B;  2RBL A;  2GTI A;  3PO2 I;  3GTO I;  3D9X A;  3EER A;  4HGY A;  3CCL Z;  1RQF A;  5LL6 f;  1NJI 1;  5CM2 M;  1VQP 1;  1P9N A;  3CD6 Z;  4NFR A;  1VQ9 1;  3P5J B;  2R7Z I;  3S16 I;  2O53 A;  1YI2 1;  1Q7Y 1;  2QRC B;  1Q86 1;  3H0G I;  3QWU A;  3M4O I;  1R9T I;  1JWH C;  2VUG A;  3GKQ A;  1ZB9 A;  2P3Y A;  2QEX 1;  4NBB A;  1QF8 A;  3H3V J;  2KI7 B;  3J81 b;  2R93 I;  1RO4 A;  4DQY B;  3S1Q I;  1KRL A;  1Y1W I;  4RS4 A;  1K83 I;  3KIH A;  4DGL A;  1YJ9 1;  1YJ9 Z;  1VQ7 1;  2LFU A;  1YHQ Z;  3ESW A;  3S2D I;  1VQK 1;  1Q81 2;  3CMA 1;  3S1M I;  1VQL Z;  4NBH A;  2E9H A;  2G2K A;  2JA5 I;  2M48 A;  1VQ5 Z;  4NB8 A;  3CCM 1;  4A3K I;  1YJN 1;  5FLX f;  1VQ4 1;  3CCE Z;  4MH4 A;  1Q82 2;  1LQL A;  5FLX b;  1VQ4 Z;  2E2J I;  1ZH1 A;  1YIT 1;  2JA6 I;  1Z03 A;  1WCM I;  4E2Y A;  3GCF A;  1VQ8 1;  1K9M 2;  1K73 2;  2PMZ A;  1I50 I;  1W2B Z;  1K8A 1;  2R92 I;  4A3D I;  4A3I I;  4E30 A;  3VMH A;  3J80 f;  4BBR I;  3CQZ I;  3HOX I;  5IP7 I;  3EED A;  3J80 b;  4MON A;  4E2Z A;  2OOY B;  2J6A A;  2F4O A;  4HGZ A;  3BG1 B;  1M90 1;  1NP6 A;  2DE5 A;  3D6W A;  1I6H I;  3PO3 I;  1NUI A;  4NBF A;  4A3J I;  3CC7 1;  1JJ2 Z;  1USP A;  3HOU I;  5A2Q f;  2LIY A;  4A93 I;  1Y1V S;  2JNY A;  3J7A 4;  1M1K 2;  5A2Q b;  1N8R 1;  1N2F A;  2K5R A;  3CC2 1;  3CC4 1;  3NH8 A;  3CCV 1;  2HU9 A;  1Y1V I;  2Y0S A;  3CCU 1;  4A3F I;  4MD9 A;  1VQ6 1;  1VQP Z;  3VMG A;  1TWC I;  3G4S 1;  5D1P A;  1VQ9 Z;  4NBE A;  3F3F C;  1YI2 Z;  3M3Y I;  3FQM A;  2GTH A;  3CME 1;  4EWC A;  3CME Z;  4E33 A;  1PFT A;  2Q51 A;  2Q4Z A;  1KQS Z;  3I4M I;  3I55 1;  3IF8 A;  2QEX Z;  3TE5 B;  1X0T A;  5AN9 F;  2YAD A;  2E2H I;  4XX2 A;  3Q87 A;  2VUM I;  4E31 A;  4A3L I;  1NJI 2;  3G71 1;  1VQN 1;  3I07 A;  3IX0 A;  4MRI A;  1VQN Z;  1Q7Y 2;  2IZ4 A;  1S72 1;  1VQO 1;  3HOV I;  4NBG A;  5T67 A;  3VB9 A;  1Q81 1;  3GTK I;  2QKD A;  1Z01 A;  2O4H A;  1QVG Y;  1VQ7 Z;  3MON A;  1TWF I;  2QA4 1;  1VQK Z;  3TDH B;  3CMA Z;  1Q82 1;  2ZAE B;  2QA4 Z;  2V8I A;  2V8K A;  3CCM Z;  1YJN Z;  2W04 A;  2I3C A;  3S2H I;  2BJO A;  3CCS 1;  3I56 1;  1W2B Y;  1K9M 1;  3K7A I;  3GTL I;  2DE6 A;  2KPI A;  1YIT Z;  3FQQ A;  3BG0 B;  1KC8 2;  1YUA A;  5IP9 I;  5D1O A;  1VQ8 Z;  4S1T A;  2OZK A;  3FKI I;  3CCJ 1;  3LUS A;  4NBA A;  3U50 C;  4BY7 I;  1TFI A;  5C3E I;  2JS4 A;  3JAM f;  4A3E I;  2NVQ I;  3CCR 1;  3PO3 S;  5C44 I;  2OOX B;  3JAM b;  2JMO A;  4RVG A;  3HOZ I;  2WAQ A;  2OTL 1;  3IFU A;  2VF1 A;  3S15 I;  3VTN A;  1JJ2 Y;  4BBS I;  3GTQ I;  3MZK B;  4RVH A;  1DL6 A;  1RNI A;  1VQM 1;  1YIJ 1;  3GTG I;  2AKL A;  3CPW Z;  2QR1 B;  3NH4 A;  1M1K 1;  4Y7N I;  2NVX I;  3CC7 Z;  3CCQ 1;  3OW2 Z;  1KD1 2;  3CCQ Z;  2QRD B;  2RHB A;  3KIF A;  3T4N B;  1RO2 A;  1ML8 A;  3S14 I;  3GTJ I;  3G6E 1;  3GTM I;  3HKZ A;  1QVF Z;  2HF1 A;  3HOY I;  2WB1 A;  2R6M A;  3CC2 Z;  3CC4 Z;  4NH1 C;  1TWA I;  4A3B I;  3CCV Z;  3CCU Z;  4NOZ A;  3NFZ A;  3CCL 1;  1VQ6 Z;  3F3P C;  1TWH I;  3G4S Z;  4A3G I;  1KQS Y;  3CXC Z;  4X6A I;  1Z02 A;  1N8R 2;  3HOW I;  2E2I I;  4MXU A;  1YJW 1;  3CD6 1;  1VLA A;  1YJW Z;  1S7M A;  4QTT A;  5IT9 f;  2YU9 I;  1X3W A;  3I55 Z;  1L1O C;  4BXX I;  5IT9 b;  2H85 A;  5T64 A;  3G71 Z;  2OTJ 1;  2EGT A;  2P28 A;  4NBC A;  2OTJ Z;  4DK1 A;  1Q86 2;  4Y52 I;  1S72 Z;  2RIQ A;  1VQO Z;  1RO0 A;  4AYB A;  3J81 f;  1TWG I;  3NDI A;  2W03 A;  2PM9 A;  3MZL B;  1SFO I;  4E32 A;  4QTU A;  2JA7 I;  5D1O B;  2RPR A;  5FLM I;  4RV9 A;  1WW9 A;  3I4N I;  4MD8 A;  4E2X A;  1KC8 1;  1K73 1;  1X3Z A;  4CL1 A;  3RZO I;  3CCS Z;  3I56 Z;  1YHQ 1;  3S1N I;  4BY1 I;  4TNU A;  1YUK A;  1VQL 1;  4NBD A;  2GU2 A;  2K3R A;  1VQ5 1;  1ZB8 A;  3NH5 A;  2PK7 A;  3VMI A;  4E2W A;  1I3Q I;  1WII A;  3CCE 1;  3CCJ Z;  3RZD I;  4MD7 A;  1QYP A;  2IZ3 A;  1QVG Z;  4NB9 A;  3S1R I;  2F4M A;  2NVT I;  3CCR Z;  3GTP I;  1USP B;  2B63 I;  3CPW Y;  1RLY A;  2OTL Z;  5T6B A;  2RT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...