1VQO1

The structure of ccpmn bound to the large ribosomal subunit haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
b'TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vqo100
1K9M2 1JJ2Y 3I56Z 3CCE1 1YITZ 1VQ6Z 2QA4Z 1YJWZ 1VQKZ 3CME1 2OTLZ 1VQL1 1M1K1 1N8R1 1VQ71 3I55Z 1M901 1M1K2 1K8A1 3CCM1 2QEXZ 1Q821 1YIJZ 1M902 3CCR1 3CCUZ 3CC4Z 3CD6Z 1S72Z 3CC2Z 3CCVZ 3CCSZ 1YI21 3CC7Z 1YIT1 2OTJZ 1VQM1 1YJW1 1VQPZ 1YJ9Z 3G711 1Q7Y1 1W2BY 1KQSZ 1Q7Y2 3I551 3G4S1 3CCJ1 1VQ81 1VQOZ 1YHQ1 1K731 3OW2Y 3CPWZ 1VQ5Z 3CD61 1K732 3G6EZ 1YJNZ 3CCQ1 1W2BZ 3CC21 3CCV1 1VQ4Z 3OW2Z 1KQSY 3I561 1QVGY 2OTJ1 3CMEZ 1VQ61 2QA41 1VQK1 3CCLZ 1Q812 1VQLZ 3CPWY 1VQ9Z 1VQ7Z 2OTL1 3CMAZ 3CCMZ 1QVGZ 3CCRZ 3CXCZ 1VQO1 3CC41 2QEX1 1VQ51 1YIJ1 1Q861 3CCU1 1NJI2 1Q862 1VQNZ 1S721 1KC81 1KD11 1KC82 1VQ41 1YI2Z 1KD12 3CCS1 1VQMZ 3CCEZ 3CC71 3G71Z 3CXCY 1Q811 1JJ2Z 1QVFY 1VQP1 3CCL1 1YJ91 1VQ91 3G4SZ 3CCJZ 1N8R2 3CMA1 1VQ8Z 1YHQZ 1K8A2 1Q822 1QVFZ 3CCQZ 1NJI1 1K9M1 1VQN1 3G6E1 1YJN1
chains in the Genus database with same CATH superfamily
2VPZA 3VMIA 3K7AI 4NB9A 2JMOA 4A3JI 4NBCA 1USPB 4MXUA 1VQ6Z 2QA4Z 4HGZA 2RT9A 4NBHA 1WJ2A 1VQL1 3GTLI 1M901 4NFRA 2KI7B 3CC2Z 1I3QI 2NVTI 1PFTA 4BXXI 3CCSZ 2RPRA 3J80b 2ZAEB 3CC7Z 4QTUA 1Y1VI 2OTJZ 1VQM1 1YJW1 2M6NA 3TE5B 3HOXI 3PO2I 1YUKA 3J81b 2RIQA 4A93I 4Y7NI 4HGYA 1KQSZ 1Q7Y2 1RO0A 3NH5A 2RHBA 2V45A 1VQOZ 1YHQ1 3BG0B 4E2YA 2IZ4A 1K732 2PK7A 3CCQ1 2LEXA 2HU9A 1ZB9A 2F4OA 4RVFA 1KQSY 2LIYA 1DL6A 3HOYI 5C4XI 3P5JB 3CCLZ 1VQLZ 1SIWA 3CMAZ 4RV9A 3VB9A 3CXCZ 3NH8A 1Y8CA 2K3RA 1Q861 2QEX1 1YIJ1 3CCU1 3GTPI 3FQQA 4A3DI 1S721 3S14I 1YUAA 5LL6f 4DK1A 2E9HA 1VQ41 1ZH1A 2NVQI 3GTQI 1Y1VS 2H85A 3H0GI 1RQFA 2BJOA 1VQMZ 1Z02A 1Q16A 4E30A 3CXCY 1JJ2Z 1QVFY 5D1OA 5CM2M 2OOYB 1YHQZ 1TWCI 3S16I 1Q822 4MD7A 4A3LI 2OOXB 3CCQZ 3NH4A 2O53A 2JA8I 1FDOA 1JJ2Y 3RZOI 3GKQA 2NVXI 2GU2A 1I50I 3PO3I 2M48A 3CCE1 1YITZ 2JNYA 2K5RA 4MONA 2Q51A 2VUGA 3S2DI 1N8R1 3GTMI 3QWUA 1VQ71 2NVYI 3I55Z 2EGTA 5IT9f 2WAQA 3VMHA 1M1K2 4A3FI 2QEXZ 3H3VJ 1YIJZ 3CCR1 3CCUZ 3RZDI 3ESWA 3CD6Z 4AYBA 1S72Z 5AN9F 2VUMI 2GTIA 3CQZI 4BY7I 1N2FA 2Y0SA 3HKZA 2JA5I 4A3BI 1Q7Y1 1P9NA 1W2BY 1TWAI 2V8IA 5IP7I 3CCJ1 1Z01A 1VQ81 4TNUA 2W04A 1K731 3OW2Y 1L1OC 1X3ZA 2JIOA 3CCV1 3VMGA 2O4HA 3PO3S 1WW9A 1Z03A 2JA6I 2JIRA 2V8KA 3JAMb 3I561 1QVGY 4CL1A 3HOZI 2J6AA 5T64A 3GTMS 4NBEA 1VQK1 3GTGI 1VQ9Z 1VQ7Z 2OTL1 1NUIA 2F4MA 2RBLA 3CCRZ 3Q87A 3CC41 1VQ51 2PMZA 1NJI2 3GTJI 4NH1C 1VQNZ 4E2ZA 4A3GI 2V3VA 1I6HI 2JS4A 1Q811 1VQP1 4MD9A 3NDIA 3CCJZ 1K83I 3M4OI 5IT9b 1VQ8Z 3FQMA 4X6AI 2WB1A 1QVFZ 2QRDB 3I4NI 2QREB 5C3EI 2DE7A 3D9XA 4NBFA 3I56Z 2G2KA 3HOVI 4RS4A 3NFZA 3EERA 1YJWZ 4E32A 1VQKZ 3CME1 2JIPA 2OTLZ 1KRLA 1M1K1 1TWGI 1WIIA 4NBAA 1K8A1 3CCM1 3CC4Z 2VPWA 4E2WA 5FLMI 2AYDA 5A2Qf 2R93I 1FDIA 1TWHI 5D1OB 2LFUA 3J80f 2DE5A 2R6MA 1VQPZ 3J81f 3D2LA 4QTTA 1RLYA 5C44I 3S15I 4Y52I 3G4S1 2VF1A 4BBSI 2GTHA 3GCFA 3S1MI 4S1TA 3CPWZ 1W2BZ 3IFUA 4NBGA 3CC21 1RO2A 3MZKB 4RVGA 3MONA 4RVDA 1VQ4Z 2E2HI 3IX0A 5T6BA 5FLXf 3OW2Z 2E2JI 1TFIA 4NBBA 4BBRI 2AKLA 3CMEZ 2OTJ1 4MRIA 1SFOI 3CPWY 4E31A 3TDHB 2VPYA 4E2XA 1USPA 1JWHC 2V8JA 3CCMZ 3FKII 1QVGZ 2YADA 1VQO1 2NAPA 4NBDA 4DQYB 1KC82 4RVHA 1TWFI 1KD12 3MZLB 3CCEZ 4BY1I 1QXFA 3D6WA 2PM9A 2JIQA 3IF8A 2Q4ZA 1R9TI 3CCL1 1YJ91 2E7ZA 3G4SZ 1N8R2 3CMA1 2R7ZI 2OZKA 2QRCB 5A2Qb 2VPXA 5C4JI 2JUBA 3G6E1 1YJN1 2YU9I 3HOWI 1K9M2 2IZ3A 2JA7I 5D1PA 2QKDA 2W03A 1LQLA 5T67A 2I3CA 3NDJA 3KIHA 2P28A 4HH4A 1X3WA 3S17I 1WZNA 3I07A 5IP9I 1Q821 1M902 4A3KI 3CCVZ 2JIMA 3LUSA 1AA6A 3F3PC 5FLXb 1YI21 2P3YA 2IV2X 3HOUI 1RNIA 4MH4A 1YIT1 1YJ9Z 3G711 2QLVB 4DGLA 4NB8A 3I551 2KPIA 3GTOI 3T4NB 3IR7A 3F3FC 1VQ5Z 3CD61 3G6EZ 1Y1WI 1YJNZ 3S1NI 1VLAA 3EEDA 4A3CI 3VTNA 2JR6A 3KIFA 2B63I 3JAMf 1VQ61 2QA41 1Q812 1ML8A 1NP6A 4EWCA 3S1QI 2QR1B 3U50C 1RO4A 4E33A 3S2HI 1Q862 3GTKI 1QF8A 1KC81 1KD11 1S7MA 4XX2A 2HF1A 1YI2Z 3CCS1 1QYPA 1WCMI 4A3II 2E2II 3CC71 3G71Z 4A3MI 3I4MI 4MD8A 3S1RI 1ZB8A 4A3EI 2R92I 1VQ91 1X0TA 3M3YI 1K8A2 3J7A4 1NJI1 4NOZA 1K9M1 1VQN1 3BG1B 2DE6A
chains in the Genus database with same CATH topology
3VMIA 3K7AI 4NB9A 2JMOA 4A3JI 4NBCA 1USPB 4MXUA 1VQ6Z 2QA4Z 4HGZA 2RT9A 4NBHA 1VQL1 3GTLI 1M901 4NFRA 2KI7B 3CC2Z 1I3QI 2NVTI 1PFTA 4BXXI 3CCSZ 2RPRA 3J80b 2ZAEB 3CC7Z 4QTUA 1Y1VI 2OTJZ 1VQM1 1YJW1 2M6NA 3TE5B 3HOXI 3PO2I 1YUKA 3J81b 2RIQA 4A93I 4Y7NI 4HGYA 1KQSZ 1Q7Y2 1RO0A 3NH5A 2RHBA 1YHQ1 1VQOZ 3BG0B 4E2YA 2IZ4A 1K732 2PK7A 3CCQ1 2HU9A 1ZB9A 2F4OA 4RVFA 1KQSY 2LIYA 1DL6A 3HOYI 5C4XI 3P5JB 3CCLZ 1VQLZ 3CMAZ 4RV9A 3VB9A 3CXCZ 3NH8A 2K3RA 1Q861 2QEX1 1YIJ1 3CCU1 3GTPI 3FQQA 4A3DI 1S721 3S14I 1YUAA 5LL6f 4DK1A 2E9HA 1VQ41 1ZH1A 2NVQI 3GTQI 1Y1VS 2H85A 3H0GI 1RQFA 2BJOA 1VQMZ 1Z02A 4E30A 3CXCY 1JJ2Z 1QVFY 5D1OA 5CM2M 2OOYB 1YHQZ 1TWCI 3S16I 1Q822 4MD7A 4A3LI 2OOXB 3NH4A 3CCQZ 2O53A 2JA8I 1JJ2Y 3RZOI 3GKQA 2NVXI 2GU2A 1I50I 3PO3I 2M48A 3CCE1 1YITZ 2JNYA 2K5RA 4MONA 2Q51A 2VUGA 3S2DI 1N8R1 3GTMI 3QWUA 1VQ71 2NVYI 3I55Z 2EGTA 5IT9f 2WAQA 3VMHA 1M1K2 4A3FI 2QEXZ 3H3VJ 1YIJZ 3CCR1 3CCUZ 3RZDI 3ESWA 3CD6Z 4AYBA 1S72Z 5AN9F 2VUMI 2GTIA 3CQZI 4BY7I 1N2FA 2Y0SA 3HKZA 2JA5I 4A3BI 1Q7Y1 1P9NA 1W2BY 1TWAI 2V8IA 5IP7I 3CCJ1 1Z01A 1VQ81 4TNUA 2W04A 1K731 3OW2Y 1L1OC 1X3ZA 3CCV1 3VMGA 2O4HA 3PO3S 1WW9A 1Z03A 2JA6I 2V8KA 3JAMb 3I561 1QVGY 4CL1A 3HOZI 2J6AA 5T64A 3GTMS 4NBEA 1VQK1 3GTGI 1VQ9Z 1VQ7Z 2OTL1 1NUIA 2F4MA 2RBLA 3CCRZ 3Q87A 3CC41 1VQ51 2PMZA 1NJI2 3GTJI 4NH1C 1VQNZ 4E2ZA 4A3GI 1I6HI 2JS4A 1Q811 1VQP1 4MD9A 3NDIA 3CCJZ 1K83I 3M4OI 5IT9b 1VQ8Z 3FQMA 4X6AI 2WB1A 1QVFZ 2QRDB 3I4NI 2QREB 5C3EI 2DE7A 3D9XA 4NBFA 3I56Z 2G2KA 3HOVI 4RS4A 3NFZA 3EERA 1YJWZ 4E32A 1VQKZ 3CME1 2OTLZ 1KRLA 1M1K1 1TWGI 1WIIA 4NBAA 1K8A1 3CCM1 3CC4Z 4E2WA 5FLMI 5A2Qf 2R93I 1TWHI 5D1OB 2LFUA 3J80f 2DE5A 2R6MA 1VQPZ 3J81f 4QTTA 1RLYA 5C44I 3S15I 4Y52I 3G4S1 2VF1A 4BBSI 2GTHA 3GCFA 3S1MI 4S1TA 3CPWZ 1W2BZ 3IFUA 4NBGA 3CC21 1RO2A 3MZKB 4RVGA 3MONA 4RVDA 1VQ4Z 2E2HI 3IX0A 5T6BA 5FLXf 3OW2Z 2E2JI 1TFIA 4NBBA 4BBRI 2AKLA 3CMEZ 2OTJ1 4MRIA 1SFOI 3CPWY 4E31A 3TDHB 4E2XA 1USPA 1JWHC 2V8JA 3CCMZ 3FKII 1QVGZ 2YADA 1VQO1 4NBDA 4DQYB 1KC82 4RVHA 1TWFI 1KD12 3MZLB 3CCEZ 4BY1I 3D6WA 2PM9A 3IF8A 2Q4ZA 1R9TI 3CCL1 1YJ91 3G4SZ 1N8R2 3CMA1 2R7ZI 2OZKA 2QRCB 5A2Qb 5C4JI 2JUBA 3G6E1 1YJN1 2YU9I 3HOWI 1K9M2 2IZ3A 2JA7I 5D1PA 2QKDA 2W03A 1LQLA 5T67A 2I3CA 3NDJA 3KIHA 2P28A 4HH4A 1X3WA 3S17I 3I07A 5IP9I 1Q821 1M902 4A3KI 3CCVZ 3LUSA 3F3PC 5FLXb 1YI21 2P3YA 3HOUI 1RNIA 4MH4A 1YIT1 1YJ9Z 3G711 2QLVB 4DGLA 4NB8A 3I551 2KPIA 3GTOI 3T4NB 3F3FC 1VQ5Z 3CD61 3G6EZ 1Y1WI 1YJNZ 3S1NI 1VLAA 3EEDA 4A3CI 3VTNA 2JR6A 3KIFA 2B63I 3JAMf 1VQ61 2QA41 1Q812 1ML8A 1NP6A 4EWCA 3S1QI 2QR1B 3U50C 1RO4A 4E33A 3S2HI 1Q862 3GTKI 1QF8A 1KC81 1KD11 1S7MA 4XX2A 2HF1A 1YI2Z 3CCS1 1QYPA 1WCMI 4A3II 2E2II 3CC71 3G71Z 4A3MI 3I4MI 4MD8A 3S1RI 1ZB8A 4A3EI 2R92I 1VQ91 1X0TA 3M3YI 1K8A2 3J7A4 1NJI1 4NOZA 1K9M1 1VQN1 3BG1B 2DE6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9M 2;  1JJ2 Y;  3I56 Z;  3CCE 1;  1YIT Z;  1VQ6 Z;  2QA4 Z;  1YJW Z;  1VQK Z;  3CME 1;  2OTL Z;  1VQL 1;  1M1K 1;  1N8R 1;  1VQ7 1;  3I55 Z;  1M90 1;  1M1K 2;  1K8A 1;  3CCM 1;  2QEX Z;  1Q82 1;  1YIJ Z;  1M90 2;  3CCR 1;  3CCU Z;  3CC4 Z;  3CD6 Z;  1S72 Z;  3CC2 Z;  3CCV Z;  3CCS Z;  1YI2 1;  3CC7 Z;  1YIT 1;  2OTJ Z;  1VQM 1;  1YJW 1;  1VQP Z;  1YJ9 Z;  3G71 1;  1Q7Y 1;  1W2B Y;  1KQS Z;  1Q7Y 2;  3I55 1;  3G4S 1;  3CCJ 1;  1VQ8 1;  1VQO Z;  1YHQ 1;  1K73 1;  3OW2 Y;  3CPW Z;  1VQ5 Z;  3CD6 1;  1K73 2;  3G6E Z;  1YJN Z;  3CCQ 1;  1W2B Z;  3CC2 1;  3CCV 1;  1VQ4 Z;  3OW2 Z;  1KQS Y;  3I56 1;  1QVG Y;  2OTJ 1;  3CME Z;  1VQ6 1;  2QA4 1;  1VQK 1;  3CCL Z;  1Q81 2;  1VQL Z;  3CPW Y;  1VQ9 Z;  1VQ7 Z;  2OTL 1;  3CMA Z;  3CCM Z;  1QVG Z;  3CCR Z;  3CXC Z;  1VQO 1;  3CC4 1;  2QEX 1;  1VQ5 1;  1YIJ 1;  1Q86 1;  3CCU 1;  1NJI 2;  1Q86 2;  1VQN Z;  1S72 1;  1KC8 1;  1KD1 1;  1KC8 2;  1VQ4 1;  1YI2 Z;  1KD1 2;  3CCS 1;  1VQM Z;  3CCE Z;  3CC7 1;  3G71 Z;  3CXC Y;  1Q81 1;  1JJ2 Z;  1QVF Y;  1VQP 1;  3CCL 1;  1YJ9 1;  1VQ9 1;  3G4S Z;  3CCJ Z;  1N8R 2;  3CMA 1;  1VQ8 Z;  1YHQ Z;  1K8A 2;  1Q82 2;  1QVF Z;  3CCQ Z;  1NJI 1;  1K9M 1;  1VQN 1;  3G6E 1;  1YJN 1; 
#chains in the Genus database with same CATH topology
 2VPZ A;  3VMI A;  3K7A I;  4NB9 A;  2JMO A;  4A3J I;  4NBC A;  1USP B;  4MXU A;  1VQ6 Z;  2QA4 Z;  4HGZ A;  2RT9 A;  4NBH A;  1WJ2 A;  1VQL 1;  3GTL I;  1M90 1;  4NFR A;  2KI7 B;  3CC2 Z;  1I3Q I;  2NVT I;  1PFT A;  4BXX I;  3CCS Z;  2RPR A;  3J80 b;  2ZAE B;  3CC7 Z;  4QTU A;  1Y1V I;  2OTJ Z;  1VQM 1;  1YJW 1;  2M6N A;  3TE5 B;  3HOX I;  3PO2 I;  1YUK A;  3J81 b;  2RIQ A;  4A93 I;  4Y7N I;  4HGY A;  1KQS Z;  1Q7Y 2;  1RO0 A;  3NH5 A;  2RHB A;  2V45 A;  1VQO Z;  1YHQ 1;  3BG0 B;  4E2Y A;  2IZ4 A;  1K73 2;  2PK7 A;  3CCQ 1;  2LEX A;  2HU9 A;  1ZB9 A;  2F4O A;  4RVF A;  1KQS Y;  2LIY A;  1DL6 A;  3HOY I;  5C4X I;  3P5J B;  3CCL Z;  1VQL Z;  1SIW A;  3CMA Z;  4RV9 A;  3VB9 A;  3CXC Z;  3NH8 A;  1Y8C A;  2K3R A;  1Q86 1;  2QEX 1;  1YIJ 1;  3CCU 1;  3GTP I;  3FQQ A;  4A3D I;  1S72 1;  3S14 I;  1YUA A;  5LL6 f;  4DK1 A;  2E9H A;  1VQ4 1;  1ZH1 A;  2NVQ I;  3GTQ I;  1Y1V S;  2H85 A;  3H0G I;  1RQF A;  2BJO A;  1VQM Z;  1Z02 A;  1Q16 A;  4E30 A;  3CXC Y;  1JJ2 Z;  1QVF Y;  5D1O A;  5CM2 M;  2OOY B;  1YHQ Z;  1TWC I;  3S16 I;  1Q82 2;  4MD7 A;  4A3L I;  2OOX B;  3CCQ Z;  3NH4 A;  2O53 A;  2JA8 I;  1FDO A;  1JJ2 Y;  3RZO I;  3GKQ A;  2NVX I;  2GU2 A;  1I50 I;  3PO3 I;  2M48 A;  3CCE 1;  1YIT Z;  2JNY A;  2K5R A;  4MON A;  2Q51 A;  2VUG A;  3S2D I;  1N8R 1;  3GTM I;  3QWU A;  1VQ7 1;  2NVY I;  3I55 Z;  2EGT A;  5IT9 f;  2WAQ A;  3VMH A;  1M1K 2;  4A3F I;  2QEX Z;  3H3V J;  1YIJ Z;  3CCR 1;  3CCU Z;  3RZD I;  3ESW A;  3CD6 Z;  4AYB A;  1S72 Z;  5AN9 F;  2VUM I;  2GTI A;  3CQZ I;  4BY7 I;  1N2F A;  2Y0S A;  3HKZ A;  2JA5 I;  4A3B I;  1Q7Y 1;  1P9N A;  1W2B Y;  1TWA I;  2V8I A;  5IP7 I;  3CCJ 1;  1Z01 A;  1VQ8 1;  4TNU A;  2W04 A;  1K73 1;  3OW2 Y;  1L1O C;  1X3Z A;  2JIO A;  3CCV 1;  3VMG A;  2O4H A;  3PO3 S;  1WW9 A;  1Z03 A;  2JA6 I;  2JIR A;  2V8K A;  3JAM b;  3I56 1;  1QVG Y;  4CL1 A;  3HOZ I;  2J6A A;  5T64 A;  3GTM S;  4NBE A;  1VQK 1;  3GTG I;  1VQ9 Z;  1VQ7 Z;  2OTL 1;  1NUI A;  2F4M A;  2RBL A;  3CCR Z;  3Q87 A;  3CC4 1;  1VQ5 1;  2PMZ A;  1NJI 2;  3GTJ I;  4NH1 C;  1VQN Z;  4E2Z A;  4A3G I;  2V3V A;  1I6H I;  2JS4 A;  1Q81 1;  1VQP 1;  4MD9 A;  3NDI A;  3CCJ Z;  1K83 I;  3M4O I;  5IT9 b;  1VQ8 Z;  3FQM A;  4X6A I;  2WB1 A;  1QVF Z;  2QRD B;  3I4N I;  2QRE B;  5C3E I;  2DE7 A;  3D9X A;  4NBF A;  3I56 Z;  2G2K A;  3HOV I;  4RS4 A;  3NFZ A;  3EER A;  1YJW Z;  4E32 A;  1VQK Z;  3CME 1;  2JIP A;  2OTL Z;  1KRL A;  1M1K 1;  1TWG I;  1WII A;  4NBA A;  1K8A 1;  3CCM 1;  3CC4 Z;  2VPW A;  4E2W A;  5FLM I;  2AYD A;  5A2Q f;  2R93 I;  1FDI A;  1TWH I;  5D1O B;  2LFU A;  3J80 f;  2DE5 A;  2R6M A;  1VQP Z;  3J81 f;  3D2L A;  4QTT A;  1RLY A;  5C44 I;  3S15 I;  4Y52 I;  3G4S 1;  2VF1 A;  4BBS I;  2GTH A;  3GCF A;  3S1M I;  4S1T A;  3CPW Z;  1W2B Z;  3IFU A;  4NBG A;  3CC2 1;  1RO2 A;  3MZK B;  4RVG A;  3MON A;  4RVD A;  1VQ4 Z;  2E2H I;  3IX0 A;  5T6B A;  5FLX f;  3OW2 Z;  2E2J I;  1TFI A;  4NBB A;  4BBR I;  2AKL A;  3CME Z;  2OTJ 1;  4MRI A;  1SFO I;  3CPW Y;  4E31 A;  3TDH B;  2VPY A;  4E2X A;  1USP A;  1JWH C;  2V8J A;  3CCM Z;  3FKI I;  1QVG Z;  2YAD A;  1VQO 1;  2NAP A;  4NBD A;  4DQY B;  1KC8 2;  4RVH A;  1TWF I;  1KD1 2;  3MZL B;  3CCE Z;  4BY1 I;  1QXF A;  3D6W A;  2PM9 A;  2JIQ A;  3IF8 A;  2Q4Z A;  1R9T I;  3CCL 1;  1YJ9 1;  2E7Z A;  3G4S Z;  1N8R 2;  3CMA 1;  2R7Z I;  2OZK A;  2QRC B;  5A2Q b;  2VPX A;  5C4J I;  2JUB A;  3G6E 1;  1YJN 1;  2YU9 I;  3HOW I;  1K9M 2;  2IZ3 A;  2JA7 I;  5D1P A;  2QKD A;  2W03 A;  1LQL A;  5T67 A;  2I3C A;  3NDJ A;  3KIH A;  2P28 A;  4HH4 A;  1X3W A;  3S17 I;  1WZN A;  3I07 A;  5IP9 I;  1Q82 1;  1M90 2;  4A3K I;  3CCV Z;  2JIM A;  3LUS A;  1AA6 A;  3F3P C;  5FLX b;  1YI2 1;  2P3Y A;  2IV2 X;  3HOU I;  1RNI A;  4MH4 A;  1YIT 1;  1YJ9 Z;  3G71 1;  2QLV B;  4DGL A;  4NB8 A;  3I55 1;  2KPI A;  3GTO I;  3T4N B;  3IR7 A;  3F3F C;  1VQ5 Z;  3CD6 1;  3G6E Z;  1Y1W I;  1YJN Z;  3S1N I;  1VLA A;  3EED A;  4A3C I;  3VTN A;  2JR6 A;  3KIF A;  2B63 I;  3JAM f;  1VQ6 1;  2QA4 1;  1Q81 2;  1ML8 A;  1NP6 A;  4EWC A;  3S1Q I;  2QR1 B;  3U50 C;  1RO4 A;  4E33 A;  3S2H I;  1Q86 2;  3GTK I;  1QF8 A;  1KC8 1;  1KD1 1;  1S7M A;  4XX2 A;  2HF1 A;  1YI2 Z;  3CCS 1;  1QYP A;  1WCM I;  4A3I I;  2E2I I;  3CC7 1;  3G71 Z;  4A3M I;  3I4M I;  4MD8 A;  3S1R I;  1ZB8 A;  4A3E I;  2R92 I;  1VQ9 1;  1X0T A;  3M3Y I;  1K8A 2;  3J7A 4;  1NJI 1;  4NOZ A;  1K9M 1;  1VQN 1;  3BG1 B;  2DE6 A; 
#chains in the Genus database with same CATH homology
 3VMI A;  3K7A I;  4NB9 A;  2JMO A;  4A3J I;  4NBC A;  1USP B;  4MXU A;  1VQ6 Z;  2QA4 Z;  4HGZ A;  2RT9 A;  4NBH A;  1VQL 1;  3GTL I;  1M90 1;  4NFR A;  2KI7 B;  3CC2 Z;  1I3Q I;  2NVT I;  1PFT A;  4BXX I;  3CCS Z;  2RPR A;  3J80 b;  2ZAE B;  3CC7 Z;  4QTU A;  1Y1V I;  2OTJ Z;  1VQM 1;  1YJW 1;  2M6N A;  3TE5 B;  3HOX I;  3PO2 I;  1YUK A;  3J81 b;  2RIQ A;  4A93 I;  4Y7N I;  4HGY A;  1KQS Z;  1Q7Y 2;  1RO0 A;  3NH5 A;  2RHB A;  1YHQ 1;  1VQO Z;  3BG0 B;  4E2Y A;  2IZ4 A;  1K73 2;  2PK7 A;  3CCQ 1;  2HU9 A;  1ZB9 A;  2F4O A;  4RVF A;  1KQS Y;  2LIY A;  1DL6 A;  3HOY I;  5C4X I;  3P5J B;  3CCL Z;  1VQL Z;  3CMA Z;  4RV9 A;  3VB9 A;  3CXC Z;  3NH8 A;  2K3R A;  1Q86 1;  2QEX 1;  1YIJ 1;  3CCU 1;  3GTP I;  3FQQ A;  4A3D I;  1S72 1;  3S14 I;  1YUA A;  5LL6 f;  4DK1 A;  2E9H A;  1VQ4 1;  1ZH1 A;  2NVQ I;  3GTQ I;  1Y1V S;  2H85 A;  3H0G I;  1RQF A;  2BJO A;  1VQM Z;  1Z02 A;  4E30 A;  3CXC Y;  1JJ2 Z;  1QVF Y;  5D1O A;  5CM2 M;  2OOY B;  1YHQ Z;  1TWC I;  3S16 I;  1Q82 2;  4MD7 A;  4A3L I;  2OOX B;  3NH4 A;  3CCQ Z;  2O53 A;  2JA8 I;  1JJ2 Y;  3RZO I;  3GKQ A;  2NVX I;  2GU2 A;  1I50 I;  3PO3 I;  2M48 A;  3CCE 1;  1YIT Z;  2JNY A;  2K5R A;  4MON A;  2Q51 A;  2VUG A;  3S2D I;  1N8R 1;  3GTM I;  3QWU A;  1VQ7 1;  2NVY I;  3I55 Z;  2EGT A;  5IT9 f;  2WAQ A;  3VMH A;  1M1K 2;  4A3F I;  2QEX Z;  3H3V J;  1YIJ Z;  3CCR 1;  3CCU Z;  3RZD I;  3ESW A;  3CD6 Z;  4AYB A;  1S72 Z;  5AN9 F;  2VUM I;  2GTI A;  3CQZ I;  4BY7 I;  1N2F A;  2Y0S A;  3HKZ A;  2JA5 I;  4A3B I;  1Q7Y 1;  1P9N A;  1W2B Y;  1TWA I;  2V8I A;  5IP7 I;  3CCJ 1;  1Z01 A;  1VQ8 1;  4TNU A;  2W04 A;  1K73 1;  3OW2 Y;  1L1O C;  1X3Z A;  3CCV 1;  3VMG A;  2O4H A;  3PO3 S;  1WW9 A;  1Z03 A;  2JA6 I;  2V8K A;  3JAM b;  3I56 1;  1QVG Y;  4CL1 A;  3HOZ I;  2J6A A;  5T64 A;  3GTM S;  4NBE A;  1VQK 1;  3GTG I;  1VQ9 Z;  1VQ7 Z;  2OTL 1;  1NUI A;  2F4M A;  2RBL A;  3CCR Z;  3Q87 A;  3CC4 1;  1VQ5 1;  2PMZ A;  1NJI 2;  3GTJ I;  4NH1 C;  1VQN Z;  4E2Z A;  4A3G I;  1I6H I;  2JS4 A;  1Q81 1;  1VQP 1;  4MD9 A;  3NDI A;  3CCJ Z;  1K83 I;  3M4O I;  5IT9 b;  1VQ8 Z;  3FQM A;  4X6A I;  2WB1 A;  1QVF Z;  2QRD B;  3I4N I;  2QRE B;  5C3E I;  2DE7 A;  3D9X A;  4NBF A;  3I56 Z;  2G2K A;  3HOV I;  4RS4 A;  3NFZ A;  3EER A;  1YJW Z;  4E32 A;  1VQK Z;  3CME 1;  2OTL Z;  1KRL A;  1M1K 1;  1TWG I;  1WII A;  4NBA A;  1K8A 1;  3CCM 1;  3CC4 Z;  4E2W A;  5FLM I;  5A2Q f;  2R93 I;  1TWH I;  5D1O B;  2LFU A;  3J80 f;  2DE5 A;  2R6M A;  1VQP Z;  3J81 f;  4QTT A;  1RLY A;  5C44 I;  3S15 I;  4Y52 I;  3G4S 1;  2VF1 A;  4BBS I;  2GTH A;  3GCF A;  3S1M I;  4S1T A;  3CPW Z;  1W2B Z;  3IFU A;  4NBG A;  3CC2 1;  1RO2 A;  3MZK B;  4RVG A;  3MON A;  4RVD A;  1VQ4 Z;  2E2H I;  3IX0 A;  5T6B A;  5FLX f;  3OW2 Z;  2E2J I;  1TFI A;  4NBB A;  4BBR I;  2AKL A;  3CME Z;  2OTJ 1;  4MRI A;  1SFO I;  3CPW Y;  4E31 A;  3TDH B;  4E2X A;  1USP A;  1JWH C;  2V8J A;  3CCM Z;  3FKI I;  1QVG Z;  2YAD A;  1VQO 1;  4NBD A;  4DQY B;  1KC8 2;  4RVH A;  1TWF I;  1KD1 2;  3MZL B;  3CCE Z;  4BY1 I;  3D6W A;  2PM9 A;  3IF8 A;  2Q4Z A;  1R9T I;  3CCL 1;  1YJ9 1;  3G4S Z;  1N8R 2;  3CMA 1;  2R7Z I;  2OZK A;  2QRC B;  5A2Q b;  5C4J I;  2JUB A;  3G6E 1;  1YJN 1;  2YU9 I;  3HOW I;  1K9M 2;  2IZ3 A;  2JA7 I;  5D1P A;  2QKD A;  2W03 A;  1LQL A;  5T67 A;  2I3C A;  3NDJ A;  3KIH A;  2P28 A;  4HH4 A;  1X3W A;  3S17 I;  3I07 A;  5IP9 I;  1Q82 1;  1M90 2;  4A3K I;  3CCV Z;  3LUS A;  3F3P C;  5FLX b;  1YI2 1;  2P3Y A;  3HOU I;  1RNI A;  4MH4 A;  1YIT 1;  1YJ9 Z;  3G71 1;  2QLV B;  4DGL A;  4NB8 A;  3I55 1;  2KPI A;  3GTO I;  3T4N B;  3F3F C;  1VQ5 Z;  3CD6 1;  3G6E Z;  1Y1W I;  1YJN Z;  3S1N I;  1VLA A;  3EED A;  4A3C I;  3VTN A;  2JR6 A;  3KIF A;  2B63 I;  3JAM f;  1VQ6 1;  2QA4 1;  1Q81 2;  1ML8 A;  1NP6 A;  4EWC A;  3S1Q I;  2QR1 B;  3U50 C;  1RO4 A;  4E33 A;  3S2H I;  1Q86 2;  3GTK I;  1QF8 A;  1KC8 1;  1KD1 1;  1S7M A;  4XX2 A;  2HF1 A;  1YI2 Z;  3CCS 1;  1QYP A;  1WCM I;  4A3I I;  2E2I I;  3CC7 1;  3G71 Z;  4A3M I;  3I4M I;  4MD8 A;  3S1R I;  1ZB8 A;  4A3E I;  2R92 I;  1VQ9 1;  1X0T A;  3M3Y I;  1K8A 2;  3J7A 4;  1NJI 1;  4NOZ A;  1K9M 1;  1VQN 1;  3BG1 B;  2DE6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...