1VQO1

The structure of ccpmn bound to the large ribosomal subunit haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vqo100
1QVFY 3CC71 1VQNZ 1YHQZ 3CCQ1 1VQP1 3OW2Z 1Q7Y2 1K9M1 1S721 3I551 1W2BY 3CPWY 2QEXZ 1KC82 3G4S1 3CC21 1YJN1 1VQ8Z 1KQSY 1M901 3CCM1 1Q7Y1 1KD12 1M902 3G711 3CCVZ 3CXCY 1YHQ1 1VQ71 3G4SZ 1YIJZ 2OTJZ 2QA41 3CCJZ 2OTLZ 1VQM1 3CC41 1KD11 3CCLZ 1VQ4Z 3CCMZ 1K9M2 3CME1 3CCS1 1VQ91 1N8R2 3CCV1 1VQMZ 1NJI2 1M1K2 3I56Z 3CMEZ 3CCUZ 3CPWZ 1JJ2Z 1YI2Z 1VQ61 3G71Z 1QVGZ 3CD61 1S72Z 1YJNZ 1VQ7Z 2QA4Z 3CD6Z 1YIJ1 1K731 3CCJ1 1VQ41 3CCE1 3CC2Z 1K732 3CXCZ 1YJW1 1QVFZ 1VQ6Z 3CCSZ 1VQ9Z 3I55Z 3CCU1 3CCEZ 1VQLZ 3CCQZ 1KC81 1VQOZ 1VQ81 1VQPZ 3OW2Y 1Q861 1Q821 1JJ2Y 1VQL1 1Q812 1W2BZ 3CC7Z 3CCR1 1VQ5Z 1VQKZ 1YJWZ 3CCL1 3I561 1K8A2 1K8A1 3CC4Z 3G6E1 1YIT1 3CMA1 1KQSZ 3CCRZ 1VQ51 1VQK1 2OTJ1 3CMAZ 1YJ91 1QVGY 2QEX1 1YJ9Z 1M1K1 1NJI1 1N8R1 1YI21 1Q811 1VQN1 3G6EZ 1YITZ 1Q822 1Q862 1VQO1 2OTL1
chains in the Genus database with same CATH superfamily
2Q51A 3T4NB 1QVFY 2JA6I 4A3GI 3M4OI 1Q16A 4AYBA 1VQNZ 2W04A 1Y1VI 2LFUA 1VQP1 3MZLB 3OW2Z 2F4MA 1YUKA 2OOYB 2GTHA 4NBHA 5D1OB 4NBCA 5A2Qf 1VQ8Z 1PFTA 4NB8A 3HOYI 4DGLA 1ML8A 1AA6A 3CCM1 2JIPA 3S14I 1KD12 2RBLA 2K3RA 3CCVZ 1WIIA 3I4MI 1TFIA 4NBAA 4E31A 3G4SZ 2O4HA 2QA41 4RS4A 2NVYI 1WZNA 2M48A 1WJ2A 1VQ4Z 1QYPA 4HH4A 4DK1A 2IZ4A 4S1TA 1ZB8A 3CME1 3CCS1 1VQ91 1VQMZ 1RO2A 3S1NI 3CCUZ 1SIWA 1JJ2Z 4HGZA 4A3KI 4A3MI 2VUGA 3HOXI 1YJNZ 1I50I 3PO2I 2NVTI 1VQ7Z 3CD6Z 3Q87A 2I3CA 1K731 4NBEA 1P9NA 2EGTA 2V8JA 1N2FA 1Y1VS 1WW9A 1K732 4E32A 3HOVI 1Z01A 4E33A 3QWUA 2GTIA 3S2HI 5A2Qb 5AN9F 3JAMf 3NDIA 1VQ81 1VQPZ 1Q821 1JJ2Y 3JAMb 2LIYA 5C4XI 3CCR1 2VPXA 2VF1A 1YJWZ 1RO4A 4NH1C 1K8A1 1KRLA 3NH4A 1KQSZ 1VQK1 3P5JB 2V3VA 4XX2A 3GTGI 2E7ZA 3HOUI 5IT9b 1USPB 2PM9A 4NBGA 1YI21 3VB9A 1YITZ 1Q822 4A3II 1Z02A 1FDOA 3GTQI 2RIQA 3FQMA 4BXXI 4A93I 5C44I 4BBSI 1TWGI 3J81b 4A3LI 3PO3S 3I551 2QEXZ 2JIRA 2NVQI 2JNYA 3EEDA 3HOWI 1YJN1 1TWAI 2IZ3A 5T64A 1QF8A 4MXUA 1Q7Y1 3VMHA 3G711 3ESWA 2E2HI 1YIJZ 3HKZA 3F3FC 3CC41 1KD11 2RT9A 4NB9A 2WB1A 2IV2X 1QXFA 4CL1A 1NJI2 1NP6A 5IT9f 3CCV1 2QRCB 2AYDA 2QR1B 1TWFI 2OZKA 1I6HI 5IP7I 2Y0SA 3NDJA 4RV9A 5T67A 1YI2Z 1Y1WI 2PK7A 1DL6A 2JIOA 3CD61 1S72Z 3KIFA 1YIJ1 2O53A 3K7AI 5FLMI 3CCJ1 2JR6A 1YUAA 3GTLI 2NVXI 2LEXA 5C3EI 1VLAA 1QVFZ 3M3YI 1TWCI 1VQ6Z 3CCSZ 1VQ9Z 3J7A4 4X6AI 3GTOI 3NH8A 1Z03A 3CCQZ 3OW2Y 1Q861 2YU9I 3IFUA 1USPA 3CC7Z 5IP9I 3J81f 3KIHA 3G6E1 4E2WA 4BY1I 2OTJ1 5LL6f 3MONA 2R6MA 1N8R1 4MD8A 5D1OA 4E2YA 4A3CI 1VQO1 1L1OC 3VTNA 3CC71 2DE5A 3TDHB 4A3EI 2F4OA 2NAPA 2QLVB 4MH4A 1YHQZ 2E2JI 4RVDA 3CCQ1 4MD7A 3PO3I 4NBFA 1Q7Y2 2P3YA 2QKDA 5C4JI 1S721 3CPWY 2AKLA 1I3QI 1KC82 3H0GI 3G4S1 3GTJI 4A3BI 3CC21 3FKII 2P28A 3GTMS 1KQSY 3MZKB 4A3FI 1M901 2JA7I 2WAQA 1M902 2YADA 4QTTA 2E2II 1NUIA 4RVGA 3S1QI 2RPRA 1X3WA 2OTLZ 4Y52I 3CCLZ 3S17I 4A3JI 3HOZI 4EWCA 4BY7I 1M1K2 2B63I 3FQQA 3CMEZ 3RZOI 3CPWZ 3GTMI 2HU9A 1VQ61 3G71Z 1QVGZ 2HF1A 3GTPI 2QA4Z 4NBDA 4MONA 4E30A 2M6NA 3CCE1 3CC2Z 2VPYA 3VMGA 3D9XA 1RQFA 3CXCZ 3BG1B 2QRDB 4QTUA 3CCEZ 1JWHC 2PMZA 1VQLZ 1KC81 4A3DI 2J6AA 1Q812 2VPZA 1VQKZ 1ZB9A 2JIQA 3I07A 3CCL1 2ZAEB 1WCMI 2DE7A 5D1PA 1K8A2 1Y8CA 2DE6A 2V45A 3CMA1 3EERA 4MD9A 2Q4ZA 4TNUA 3CCRZ 1LQLA 3S1MI 3CMAZ 2QEX1 4NFRA 3D6WA 1RO0A 5T6BA 1RLYA 1M1K1 3CQZI 1Q811 1SFOI 1RNIA 3G6EZ 3S15I 3IF8A 2OTL1 3H3VJ 1ZH1A 2R92I 2VUMI 1K9M1 1W2BY 2G2KA 2W03A 2KPIA 2OOXB 3GKQA 3IX0A 3J80f 3S2DI 1K83I 2QREB 2RHBA 3GTKI 3F3PC 3S1RI 2JUBA 4HGYA 3CXCY 1YHQ1 3NFZA 1R9TI 2OTJZ 3CCJZ 4Y7NI 4NBBA 1VQM1 1TWHI 2JIMA 3CCMZ 1K9M2 4NOZA 2JMOA 5FLXf 1N8R2 3I56Z 4BBRI 4RVFA 3D2LA 2K5RA 1X0TA 4E2ZA 3RZDI 1S7MA 4E2XA 2V8IA 3U50C 2JA8I 2BJOA 1VQ41 1YJW1 2E9HA 4MRIA 4RVHA 3I55Z 3CCU1 4DQYB 1VQOZ 3J80b 1VQL1 1W2BZ 2R93I 2JA5I 3BG0B 1VQ5Z 2GU2A 3GCFA 3I561 3NH5A 3IR7A 3CC4Z 3VMIA 1YIT1 2V8KA 1VQ51 3S16I 2JS4A 1YJ91 1QVGY 5CM2M 1X3ZA 2KI7B 3I4NI 1YJ9Z 1FDIA 1NJI1 5FLXb 2R7ZI 2VPWA 3TE5B 2H85A 1VQN1 3LUSA 1VQ71 1Q862
chains in the Genus database with same CATH topology
2Q51A 3T4NB 1QVFY 2JA6I 4A3GI 3M4OI 4AYBA 1VQNZ 2W04A 1Y1VI 2LFUA 1VQP1 3MZLB 3OW2Z 2F4MA 1YUKA 2OOYB 2GTHA 4NBHA 5D1OB 4NBCA 5A2Qf 1VQ8Z 1PFTA 4NB8A 3HOYI 4DGLA 1ML8A 3CCM1 3S14I 1KD12 2RBLA 2K3RA 3CCVZ 1WIIA 3I4MI 1TFIA 4NBAA 4E31A 3G4SZ 2O4HA 2QA41 4RS4A 2NVYI 2M48A 1VQ4Z 1QYPA 4HH4A 4DK1A 2IZ4A 4S1TA 1ZB8A 3CME1 3CCS1 1VQ91 1VQMZ 1RO2A 3S1NI 3CCUZ 1JJ2Z 4HGZA 4A3KI 4A3MI 2VUGA 3HOXI 1YJNZ 1I50I 3PO2I 2NVTI 1VQ7Z 3CD6Z 3Q87A 2I3CA 1K731 4NBEA 1P9NA 2EGTA 2V8JA 1N2FA 1Y1VS 1WW9A 1K732 4E32A 3HOVI 1Z01A 4E33A 3QWUA 2GTIA 3S2HI 5A2Qb 5AN9F 3JAMf 3NDIA 1VQ81 1VQPZ 1Q821 1JJ2Y 3JAMb 2LIYA 5C4XI 3CCR1 2VF1A 1YJWZ 1RO4A 4NH1C 1K8A1 1KRLA 3NH4A 1KQSZ 1VQK1 3P5JB 4XX2A 3GTGI 3HOUI 5IT9b 1USPB 2PM9A 4NBGA 1YI21 3VB9A 1YITZ 1Q822 4A3II 1Z02A 3GTQI 2RIQA 3FQMA 4BXXI 4A93I 5C44I 4BBSI 1TWGI 3J81b 4A3LI 3PO3S 3I551 2QEXZ 2NVQI 2JNYA 3EEDA 3HOWI 1YJN1 1TWAI 2IZ3A 5T64A 1QF8A 4MXUA 1Q7Y1 3VMHA 3G711 3ESWA 2E2HI 1YIJZ 3HKZA 3F3FC 3CC41 1KD11 2RT9A 4NB9A 2WB1A 4CL1A 1NJI2 1NP6A 5IT9f 3CCV1 2QRCB 2QR1B 1TWFI 2OZKA 1I6HI 5IP7I 2Y0SA 3NDJA 4RV9A 5T67A 1YI2Z 1Y1WI 2PK7A 1DL6A 3CD61 1S72Z 3KIFA 1YIJ1 2O53A 3K7AI 5FLMI 3CCJ1 2JR6A 1YUAA 3GTLI 2NVXI 5C3EI 1VLAA 1QVFZ 3M3YI 1TWCI 1VQ6Z 3CCSZ 1VQ9Z 3J7A4 4X6AI 3GTOI 3NH8A 1Z03A 3CCQZ 3OW2Y 1Q861 2YU9I 3IFUA 1USPA 3CC7Z 5IP9I 3J81f 3KIHA 3G6E1 4E2WA 4BY1I 2OTJ1 5LL6f 3MONA 2R6MA 1N8R1 4MD8A 5D1OA 4E2YA 4A3CI 1VQO1 1L1OC 3VTNA 3CC71 2DE5A 3TDHB 4A3EI 2F4OA 2QLVB 4MH4A 1YHQZ 2E2JI 4RVDA 3CCQ1 4MD7A 3PO3I 4NBFA 1Q7Y2 2P3YA 2QKDA 5C4JI 1S721 3CPWY 2AKLA 1I3QI 1KC82 3H0GI 3G4S1 3GTJI 4A3BI 3CC21 3FKII 2P28A 3GTMS 1KQSY 3MZKB 4A3FI 1M901 2JA7I 2WAQA 1M902 2YADA 4QTTA 2E2II 1NUIA 4RVGA 3S1QI 2RPRA 1X3WA 2OTLZ 4Y52I 3CCLZ 3S17I 4A3JI 3HOZI 4EWCA 4BY7I 1M1K2 2B63I 3FQQA 3CMEZ 3RZOI 3CPWZ 3GTMI 2HU9A 1VQ61 3G71Z 1QVGZ 2HF1A 3GTPI 2QA4Z 4NBDA 4MONA 4E30A 2M6NA 3CCE1 3CC2Z 3VMGA 3CXCZ 3D9XA 1RQFA 3BG1B 2QRDB 4QTUA 3CCEZ 1JWHC 2PMZA 1VQLZ 1KC81 4A3DI 2J6AA 1Q812 1VQKZ 1ZB9A 3I07A 3CCL1 2ZAEB 1WCMI 2DE7A 5D1PA 1K8A2 2DE6A 3CMA1 3EERA 4MD9A 2Q4ZA 4TNUA 3CCRZ 1LQLA 3S1MI 3CMAZ 2QEX1 4NFRA 3D6WA 1RO0A 5T6BA 1RLYA 1M1K1 3CQZI 1Q811 1SFOI 1RNIA 3G6EZ 3S15I 3IF8A 2OTL1 3H3VJ 1ZH1A 2R92I 2VUMI 1K9M1 1W2BY 2G2KA 2W03A 2KPIA 2OOXB 3GKQA 3IX0A 3J80f 3S2DI 1K83I 2QREB 2RHBA 3GTKI 3F3PC 3S1RI 2JUBA 4HGYA 3CXCY 1YHQ1 3NFZA 1R9TI 2OTJZ 3CCJZ 4Y7NI 4NBBA 1VQM1 1TWHI 3CCMZ 1K9M2 4NOZA 2JMOA 5FLXf 1N8R2 3I56Z 4BBRI 4RVFA 2K5RA 1X0TA 4E2ZA 3RZDI 1S7MA 4E2XA 2V8IA 3U50C 2JA8I 2BJOA 1VQ41 1YJW1 2E9HA 4MRIA 4RVHA 3I55Z 3CCU1 4DQYB 1VQOZ 3J80b 1VQL1 1W2BZ 2R93I 2JA5I 3BG0B 1VQ5Z 2GU2A 3GCFA 3I561 3NH5A 3CC4Z 3VMIA 1YIT1 2V8KA 1VQ51 3S16I 2JS4A 1YJ91 1QVGY 1X3ZA 2KI7B 5CM2M 3I4NI 1YJ9Z 1NJI1 5FLXb 2R7ZI 3TE5B 2H85A 1VQN1 3LUSA 1VQ71 1Q862
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVF Y;  3CC7 1;  1VQN Z;  1YHQ Z;  3CCQ 1;  1VQP 1;  3OW2 Z;  1Q7Y 2;  1K9M 1;  1S72 1;  3I55 1;  1W2B Y;  3CPW Y;  2QEX Z;  1KC8 2;  3G4S 1;  3CC2 1;  1YJN 1;  1VQ8 Z;  1KQS Y;  1M90 1;  3CCM 1;  1Q7Y 1;  1KD1 2;  1M90 2;  3G71 1;  3CCV Z;  3CXC Y;  1YHQ 1;  1VQ7 1;  3G4S Z;  1YIJ Z;  2OTJ Z;  2QA4 1;  3CCJ Z;  2OTL Z;  1VQM 1;  3CC4 1;  1KD1 1;  3CCL Z;  1VQ4 Z;  3CCM Z;  1K9M 2;  3CME 1;  3CCS 1;  1VQ9 1;  1N8R 2;  3CCV 1;  1VQM Z;  1NJI 2;  1M1K 2;  3I56 Z;  3CME Z;  3CCU Z;  3CPW Z;  1JJ2 Z;  1YI2 Z;  1VQ6 1;  3G71 Z;  1QVG Z;  3CD6 1;  1S72 Z;  1YJN Z;  1VQ7 Z;  2QA4 Z;  3CD6 Z;  1YIJ 1;  1K73 1;  3CCJ 1;  1VQ4 1;  3CCE 1;  3CC2 Z;  1K73 2;  3CXC Z;  1YJW 1;  1QVF Z;  1VQ6 Z;  3CCS Z;  1VQ9 Z;  3I55 Z;  3CCU 1;  3CCE Z;  1VQL Z;  3CCQ Z;  1KC8 1;  1VQO Z;  1VQ8 1;  1VQP Z;  3OW2 Y;  1Q86 1;  1Q82 1;  1JJ2 Y;  1VQL 1;  1Q81 2;  1W2B Z;  3CC7 Z;  3CCR 1;  1VQ5 Z;  1VQK Z;  1YJW Z;  3CCL 1;  3I56 1;  1K8A 2;  1K8A 1;  3CC4 Z;  3G6E 1;  1YIT 1;  3CMA 1;  1KQS Z;  3CCR Z;  1VQ5 1;  1VQK 1;  2OTJ 1;  3CMA Z;  1YJ9 1;  1QVG Y;  2QEX 1;  1YJ9 Z;  1M1K 1;  1NJI 1;  1N8R 1;  1YI2 1;  1Q81 1;  1VQN 1;  3G6E Z;  1YIT Z;  1Q82 2;  1Q86 2;  1VQO 1;  2OTL 1; 
#chains in the Genus database with same CATH topology
 2Q51 A;  3T4N B;  1QVF Y;  2JA6 I;  4A3G I;  3M4O I;  1Q16 A;  4AYB A;  1VQN Z;  2W04 A;  1Y1V I;  2LFU A;  1VQP 1;  3MZL B;  3OW2 Z;  2F4M A;  1YUK A;  2OOY B;  2GTH A;  4NBH A;  5D1O B;  4NBC A;  5A2Q f;  1VQ8 Z;  1PFT A;  4NB8 A;  3HOY I;  4DGL A;  1ML8 A;  1AA6 A;  3CCM 1;  2JIP A;  3S14 I;  1KD1 2;  2RBL A;  2K3R A;  3CCV Z;  1WII A;  3I4M I;  1TFI A;  4NBA A;  4E31 A;  3G4S Z;  2O4H A;  2QA4 1;  4RS4 A;  2NVY I;  1WZN A;  2M48 A;  1WJ2 A;  1VQ4 Z;  1QYP A;  4HH4 A;  4DK1 A;  2IZ4 A;  4S1T A;  1ZB8 A;  3CME 1;  3CCS 1;  1VQ9 1;  1VQM Z;  1RO2 A;  3S1N I;  3CCU Z;  1SIW A;  1JJ2 Z;  4HGZ A;  4A3K I;  4A3M I;  2VUG A;  3HOX I;  1YJN Z;  1I50 I;  3PO2 I;  2NVT I;  1VQ7 Z;  3CD6 Z;  3Q87 A;  2I3C A;  1K73 1;  4NBE A;  1P9N A;  2EGT A;  2V8J A;  1N2F A;  1Y1V S;  1WW9 A;  1K73 2;  4E32 A;  3HOV I;  1Z01 A;  4E33 A;  3QWU A;  2GTI A;  3S2H I;  5A2Q b;  5AN9 F;  3JAM f;  3NDI A;  1VQ8 1;  1VQP Z;  1Q82 1;  1JJ2 Y;  3JAM b;  2LIY A;  5C4X I;  3CCR 1;  2VPX A;  2VF1 A;  1YJW Z;  1RO4 A;  4NH1 C;  1K8A 1;  1KRL A;  3NH4 A;  1KQS Z;  1VQK 1;  3P5J B;  2V3V A;  4XX2 A;  3GTG I;  2E7Z A;  3HOU I;  5IT9 b;  1USP B;  2PM9 A;  4NBG A;  1YI2 1;  3VB9 A;  1YIT Z;  1Q82 2;  4A3I I;  1Z02 A;  1FDO A;  3GTQ I;  2RIQ A;  3FQM A;  4BXX I;  4A93 I;  5C44 I;  4BBS I;  1TWG I;  3J81 b;  4A3L I;  3PO3 S;  3I55 1;  2QEX Z;  2JIR A;  2NVQ I;  2JNY A;  3EED A;  3HOW I;  1YJN 1;  1TWA I;  2IZ3 A;  5T64 A;  1QF8 A;  4MXU A;  1Q7Y 1;  3VMH A;  3G71 1;  3ESW A;  2E2H I;  1YIJ Z;  3HKZ A;  3F3F C;  3CC4 1;  1KD1 1;  2RT9 A;  4NB9 A;  2WB1 A;  2IV2 X;  1QXF A;  4CL1 A;  1NJI 2;  1NP6 A;  5IT9 f;  3CCV 1;  2QRC B;  2AYD A;  2QR1 B;  1TWF I;  2OZK A;  1I6H I;  5IP7 I;  2Y0S A;  3NDJ A;  4RV9 A;  5T67 A;  1YI2 Z;  1Y1W I;  2PK7 A;  1DL6 A;  2JIO A;  3CD6 1;  1S72 Z;  3KIF A;  1YIJ 1;  2O53 A;  3K7A I;  5FLM I;  3CCJ 1;  2JR6 A;  1YUA A;  3GTL I;  2NVX I;  2LEX A;  5C3E I;  1VLA A;  1QVF Z;  3M3Y I;  1TWC I;  1VQ6 Z;  3CCS Z;  1VQ9 Z;  3J7A 4;  4X6A I;  3GTO I;  3NH8 A;  1Z03 A;  3CCQ Z;  3OW2 Y;  1Q86 1;  2YU9 I;  3IFU A;  1USP A;  3CC7 Z;  5IP9 I;  3J81 f;  3KIH A;  3G6E 1;  4E2W A;  4BY1 I;  2OTJ 1;  5LL6 f;  3MON A;  2R6M A;  1N8R 1;  4MD8 A;  5D1O A;  4E2Y A;  4A3C I;  1VQO 1;  1L1O C;  3VTN A;  3CC7 1;  2DE5 A;  3TDH B;  4A3E I;  2F4O A;  2NAP A;  2QLV B;  4MH4 A;  1YHQ Z;  2E2J I;  4RVD A;  3CCQ 1;  4MD7 A;  3PO3 I;  4NBF A;  1Q7Y 2;  2P3Y A;  2QKD A;  5C4J I;  1S72 1;  3CPW Y;  2AKL A;  1I3Q I;  1KC8 2;  3H0G I;  3G4S 1;  3GTJ I;  4A3B I;  3CC2 1;  3FKI I;  2P28 A;  3GTM S;  1KQS Y;  3MZK B;  4A3F I;  1M90 1;  2JA7 I;  2WAQ A;  1M90 2;  2YAD A;  4QTT A;  2E2I I;  1NUI A;  4RVG A;  3S1Q I;  2RPR A;  1X3W A;  2OTL Z;  4Y52 I;  3CCL Z;  3S17 I;  4A3J I;  3HOZ I;  4EWC A;  4BY7 I;  1M1K 2;  2B63 I;  3FQQ A;  3CME Z;  3RZO I;  3CPW Z;  3GTM I;  2HU9 A;  1VQ6 1;  3G71 Z;  1QVG Z;  2HF1 A;  3GTP I;  2QA4 Z;  4NBD A;  4MON A;  4E30 A;  2M6N A;  3CCE 1;  3CC2 Z;  2VPY A;  3VMG A;  3D9X A;  1RQF A;  3CXC Z;  3BG1 B;  2QRD B;  4QTU A;  3CCE Z;  1JWH C;  2PMZ A;  1VQL Z;  1KC8 1;  4A3D I;  2J6A A;  1Q81 2;  2VPZ A;  1VQK Z;  1ZB9 A;  2JIQ A;  3I07 A;  3CCL 1;  2ZAE B;  1WCM I;  2DE7 A;  5D1P A;  1K8A 2;  1Y8C A;  2DE6 A;  2V45 A;  3CMA 1;  3EER A;  4MD9 A;  2Q4Z A;  4TNU A;  3CCR Z;  1LQL A;  3S1M I;  3CMA Z;  2QEX 1;  4NFR A;  3D6W A;  1RO0 A;  5T6B A;  1RLY A;  1M1K 1;  3CQZ I;  1Q81 1;  1SFO I;  1RNI A;  3G6E Z;  3S15 I;  3IF8 A;  2OTL 1;  3H3V J;  1ZH1 A;  2R92 I;  2VUM I;  1K9M 1;  1W2B Y;  2G2K A;  2W03 A;  2KPI A;  2OOX B;  3GKQ A;  3IX0 A;  3J80 f;  3S2D I;  1K83 I;  2QRE B;  2RHB A;  3GTK I;  3F3P C;  3S1R I;  2JUB A;  4HGY A;  3CXC Y;  1YHQ 1;  3NFZ A;  1R9T I;  2OTJ Z;  3CCJ Z;  4Y7N I;  4NBB A;  1VQM 1;  1TWH I;  2JIM A;  3CCM Z;  1K9M 2;  4NOZ A;  2JMO A;  5FLX f;  1N8R 2;  3I56 Z;  4BBR I;  4RVF A;  3D2L A;  2K5R A;  1X0T A;  4E2Z A;  3RZD I;  1S7M A;  4E2X A;  2V8I A;  3U50 C;  2JA8 I;  2BJO A;  1VQ4 1;  1YJW 1;  2E9H A;  4MRI A;  4RVH A;  3I55 Z;  3CCU 1;  4DQY B;  1VQO Z;  3J80 b;  1VQL 1;  1W2B Z;  2R93 I;  2JA5 I;  3BG0 B;  1VQ5 Z;  2GU2 A;  3GCF A;  3I56 1;  3NH5 A;  3IR7 A;  3CC4 Z;  3VMI A;  1YIT 1;  2V8K A;  1VQ5 1;  3S16 I;  2JS4 A;  1YJ9 1;  1QVG Y;  5CM2 M;  1X3Z A;  2KI7 B;  3I4N I;  1YJ9 Z;  1FDI A;  1NJI 1;  5FLX b;  2R7Z I;  2VPW A;  3TE5 B;  2H85 A;  1VQN 1;  3LUS A;  1VQ7 1;  1Q86 2; 
#chains in the Genus database with same CATH homology
 2Q51 A;  3T4N B;  1QVF Y;  2JA6 I;  4A3G I;  3M4O I;  4AYB A;  1VQN Z;  2W04 A;  1Y1V I;  2LFU A;  1VQP 1;  3MZL B;  3OW2 Z;  2F4M A;  1YUK A;  2OOY B;  2GTH A;  4NBH A;  5D1O B;  4NBC A;  5A2Q f;  1VQ8 Z;  1PFT A;  4NB8 A;  3HOY I;  4DGL A;  1ML8 A;  3CCM 1;  3S14 I;  1KD1 2;  2RBL A;  2K3R A;  3CCV Z;  1WII A;  3I4M I;  1TFI A;  4NBA A;  4E31 A;  3G4S Z;  2O4H A;  2QA4 1;  4RS4 A;  2NVY I;  2M48 A;  1VQ4 Z;  1QYP A;  4HH4 A;  4DK1 A;  2IZ4 A;  4S1T A;  1ZB8 A;  3CME 1;  3CCS 1;  1VQ9 1;  1VQM Z;  1RO2 A;  3S1N I;  3CCU Z;  1JJ2 Z;  4HGZ A;  4A3K I;  4A3M I;  2VUG A;  3HOX I;  1YJN Z;  1I50 I;  3PO2 I;  2NVT I;  1VQ7 Z;  3CD6 Z;  3Q87 A;  2I3C A;  1K73 1;  4NBE A;  1P9N A;  2EGT A;  2V8J A;  1N2F A;  1Y1V S;  1WW9 A;  1K73 2;  4E32 A;  3HOV I;  1Z01 A;  4E33 A;  3QWU A;  2GTI A;  3S2H I;  5A2Q b;  5AN9 F;  3JAM f;  3NDI A;  1VQ8 1;  1VQP Z;  1Q82 1;  1JJ2 Y;  3JAM b;  2LIY A;  5C4X I;  3CCR 1;  2VF1 A;  1YJW Z;  1RO4 A;  4NH1 C;  1K8A 1;  1KRL A;  3NH4 A;  1KQS Z;  1VQK 1;  3P5J B;  4XX2 A;  3GTG I;  3HOU I;  5IT9 b;  1USP B;  2PM9 A;  4NBG A;  1YI2 1;  3VB9 A;  1YIT Z;  1Q82 2;  4A3I I;  1Z02 A;  3GTQ I;  2RIQ A;  3FQM A;  4BXX I;  4A93 I;  5C44 I;  4BBS I;  1TWG I;  3J81 b;  4A3L I;  3PO3 S;  3I55 1;  2QEX Z;  2NVQ I;  2JNY A;  3EED A;  3HOW I;  1YJN 1;  1TWA I;  2IZ3 A;  5T64 A;  1QF8 A;  4MXU A;  1Q7Y 1;  3VMH A;  3G71 1;  3ESW A;  2E2H I;  1YIJ Z;  3HKZ A;  3F3F C;  3CC4 1;  1KD1 1;  2RT9 A;  4NB9 A;  2WB1 A;  4CL1 A;  1NJI 2;  1NP6 A;  5IT9 f;  3CCV 1;  2QRC B;  2QR1 B;  1TWF I;  2OZK A;  1I6H I;  5IP7 I;  2Y0S A;  3NDJ A;  4RV9 A;  5T67 A;  1YI2 Z;  1Y1W I;  2PK7 A;  1DL6 A;  3CD6 1;  1S72 Z;  3KIF A;  1YIJ 1;  2O53 A;  3K7A I;  5FLM I;  3CCJ 1;  2JR6 A;  1YUA A;  3GTL I;  2NVX I;  5C3E I;  1VLA A;  1QVF Z;  3M3Y I;  1TWC I;  1VQ6 Z;  3CCS Z;  1VQ9 Z;  3J7A 4;  4X6A I;  3GTO I;  3NH8 A;  1Z03 A;  3CCQ Z;  3OW2 Y;  1Q86 1;  2YU9 I;  3IFU A;  1USP A;  3CC7 Z;  5IP9 I;  3J81 f;  3KIH A;  3G6E 1;  4E2W A;  4BY1 I;  2OTJ 1;  5LL6 f;  3MON A;  2R6M A;  1N8R 1;  4MD8 A;  5D1O A;  4E2Y A;  4A3C I;  1VQO 1;  1L1O C;  3VTN A;  3CC7 1;  2DE5 A;  3TDH B;  4A3E I;  2F4O A;  2QLV B;  4MH4 A;  1YHQ Z;  2E2J I;  4RVD A;  3CCQ 1;  4MD7 A;  3PO3 I;  4NBF A;  1Q7Y 2;  2P3Y A;  2QKD A;  5C4J I;  1S72 1;  3CPW Y;  2AKL A;  1I3Q I;  1KC8 2;  3H0G I;  3G4S 1;  3GTJ I;  4A3B I;  3CC2 1;  3FKI I;  2P28 A;  3GTM S;  1KQS Y;  3MZK B;  4A3F I;  1M90 1;  2JA7 I;  2WAQ A;  1M90 2;  2YAD A;  4QTT A;  2E2I I;  1NUI A;  4RVG A;  3S1Q I;  2RPR A;  1X3W A;  2OTL Z;  4Y52 I;  3CCL Z;  3S17 I;  4A3J I;  3HOZ I;  4EWC A;  4BY7 I;  1M1K 2;  2B63 I;  3FQQ A;  3CME Z;  3RZO I;  3CPW Z;  3GTM I;  2HU9 A;  1VQ6 1;  3G71 Z;  1QVG Z;  2HF1 A;  3GTP I;  2QA4 Z;  4NBD A;  4MON A;  4E30 A;  2M6N A;  3CCE 1;  3CC2 Z;  3VMG A;  3CXC Z;  3D9X A;  1RQF A;  3BG1 B;  2QRD B;  4QTU A;  3CCE Z;  1JWH C;  2PMZ A;  1VQL Z;  1KC8 1;  4A3D I;  2J6A A;  1Q81 2;  1VQK Z;  1ZB9 A;  3I07 A;  3CCL 1;  2ZAE B;  1WCM I;  2DE7 A;  5D1P A;  1K8A 2;  2DE6 A;  3CMA 1;  3EER A;  4MD9 A;  2Q4Z A;  4TNU A;  3CCR Z;  1LQL A;  3S1M I;  3CMA Z;  2QEX 1;  4NFR A;  3D6W A;  1RO0 A;  5T6B A;  1RLY A;  1M1K 1;  3CQZ I;  1Q81 1;  1SFO I;  1RNI A;  3G6E Z;  3S15 I;  3IF8 A;  2OTL 1;  3H3V J;  1ZH1 A;  2R92 I;  2VUM I;  1K9M 1;  1W2B Y;  2G2K A;  2W03 A;  2KPI A;  2OOX B;  3GKQ A;  3IX0 A;  3J80 f;  3S2D I;  1K83 I;  2QRE B;  2RHB A;  3GTK I;  3F3P C;  3S1R I;  2JUB A;  4HGY A;  3CXC Y;  1YHQ 1;  3NFZ A;  1R9T I;  2OTJ Z;  3CCJ Z;  4Y7N I;  4NBB A;  1VQM 1;  1TWH I;  3CCM Z;  1K9M 2;  4NOZ A;  2JMO A;  5FLX f;  1N8R 2;  3I56 Z;  4BBR I;  4RVF A;  2K5R A;  1X0T A;  4E2Z A;  3RZD I;  1S7M A;  4E2X A;  2V8I A;  3U50 C;  2JA8 I;  2BJO A;  1VQ4 1;  1YJW 1;  2E9H A;  4MRI A;  4RVH A;  3I55 Z;  3CCU 1;  4DQY B;  1VQO Z;  3J80 b;  1VQL 1;  1W2B Z;  2R93 I;  2JA5 I;  3BG0 B;  1VQ5 Z;  2GU2 A;  3GCF A;  3I56 1;  3NH5 A;  3CC4 Z;  3VMI A;  1YIT 1;  2V8K A;  1VQ5 1;  3S16 I;  2JS4 A;  1YJ9 1;  1QVG Y;  1X3Z A;  2KI7 B;  5CM2 M;  3I4N I;  1YJ9 Z;  1NJI 1;  5FLX b;  2R7Z I;  3TE5 B;  2H85 A;  1VQN 1;  3LUS A;  1VQ7 1;  1Q86 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...