1VQO1

The structure of ccpmn bound to the large ribosomal subunit haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vqo100
3I551 3CCLZ 1VQMZ 1VQ81 1K731 3CCS1 3OW2Z 1VQLZ 3G4S1 3CCRZ 1W2BZ 3CC71 1Q7Y2 1M902 1N8R1 1Q862 3CPWZ 3CME1 3CCUZ 1KQSZ 1VQO1 1VQ6Z 1YJWZ 2OTJ1 3CMAZ 1VQKZ 3G71Z 1Q811 1KD12 2QA4Z 1KC82 3OW2Y 1VQP1 1VQ8Z 1YI21 3CPWY 3CD6Z 3I56Z 3CCV1 1VQN1 1NJI1 3CC7Z 3CCJ1 1YIJZ 3CCQZ 3CXCY 1VQK1 3CMA1 1VQ9Z 2OTLZ 3CCMZ 1YI2Z 1YIT1 3CC4Z 1YJ91 3CD61 3G6E1 1NJI2 1VQL1 3CCQ1 3CCR1 1KC81 1QVFY 1QVGZ 1KD11 1Q812 1VQ4Z 3CCE1 1JJ2Y 1JJ2Z 3CMEZ 2OTL1 1Q861 3CCM1 3I55Z 3CCL1 1VQM1 1YJ9Z 1N8R2 1Q7Y1 1YHQZ 1M901 3CCSZ 3G711 1KQSY 1VQ71 1QVFZ 2QEXZ 1VQPZ 3CC21 1K732 1W2BY 1VQNZ 1Q821 3CCU1 3CXCZ 1K8A2 1YJNZ 1VQ61 3CCEZ 1S721 1M1K1 1QVGY 1VQ7Z 1YHQ1 1VQ51 2QEX1 3I561 3CCVZ 3CC2Z 3CCJZ 1YIJ1 1K9M1 1K9M2 3G4SZ 1YJN1 1S72Z 1VQ91 1M1K2 1VQOZ 3CC41 1YITZ 1VQ41 1YJW1 1K8A1 1VQ5Z 2OTJZ 3G6EZ 1Q822 2QA41
chains in the Genus database with same CATH superfamily
3CCLZ 3HKZA 4S1TA 3IF8A 5C4XI 2F4OA 1VQLZ 3CC71 2NVQI 1YUKA 1KQSZ 2OTJ1 3J7A4 1RNIA 1X0TA 2H85A 4RS4A 1Y1VS 4NBGA 3S1RI 1VQP1 4RVGA 2LIYA 3P5JB 3CC7Z 1TWGI 1ZB9A 1RO2A 3GTKI 3Q87A 1L1OC 2VUGA 4NBHA 3NFZA 2F4MA 2NVTI 1P9NA 2BJOA 1VQ9Z 1WCMI 3BG1B 1Y1VI 1YI2Z 3HOXI 3T4NB 1YJ91 3LUSA 2DE7A 1SIWA 5D1OA 1VQL1 1QVFY 3S2DI 4A3JI 2E7ZA 1VQ4Z 3CCE1 2YU9I 1JJ2Y 3CMEZ 1Z03A 2QR1B 2JIQA 1YJ9Z 4MD8A 2LEXA 4BBSI 1VQPZ 3GTLI 5C44I 2P3YA 1YJNZ 2E9HA 3HOUI 4A3GI 1SFOI 5T64A 5CM2M 3S1NI 2V3VA 1FDIA 3KIHA 3IR7A 3CCVZ 4NBFA 4RVHA 1DL6A 1WIIA 2JMOA 4EWCA 1K83I 5AN9F 1I6HI 4HGYA 4NBCA 4A3KI 2AKLA 2HU9A 1YJN1 4A3DI 3S2HI 4QTUA 2NAPA 1VQ91 2E2II 1QYPA 4E2ZA 2EGTA 1I3QI 3TE5B 5T6BA 2Q4ZA 1Q822 2JUBA 1VQ81 2JA6I 1K731 2QREB 2GU2A 3RZDI 2R92I 1Q7Y2 1M902 2IZ3A 1TFIA 2R93I 3CME1 3CQZI 2DE6A 3GTMI 1VQO1 4E30A 3EERA 3VMHA 4A3MI 1RQFA 1USPA 1KC82 3M3YI 4CL1A 2VF1A 3VTNA 3GTOI 2V8KA 3CPWY 3CD6Z 3I56Z 4BY7I 4X6AI 1S7MA 3CCV1 1NJI1 2W03A 4MONA 4E2XA 3CCQZ 3FQMA 3CXCY 3BG0B 3NDJA 2JIOA 1RO4A 3F3FC 1Q16A 3D9XA 1YIT1 2JR6A 3CD61 4A93I 1TWHI 2J6AA 3GCFA 3I07A 3J80f 4BY1I 1N2FA 2QLVB 4Y7NI 3CCQ1 1ML8A 2RHBA 3GTPI 4MRIA 2V8IA 3S15I 5IT9b 3D6WA 3TDHB 2VPXA 3GTGI 1JJ2Z 1Q861 2R6MA 4A3EI 1VQM1 5D1OB 1YUAA 3VB9A 3I55Z 4NBDA 1VQ71 3CCSZ 3GKQA 4A3FI 3CC21 2M6NA 2G2KA 1VQNZ 5A2Qf 3CCU1 3CXCZ 1VQ61 3CCEZ 2PM9A 1WJ2A 3MZKB 3K7AI 1VQ51 3JAMb 3I561 5FLXf 3CC2Z 2LFUA 5IP9I 4MH4A 3VMIA 1YIJ1 1K9M1 2JA8I 3G4SZ 2VUMI 1AA6A 3MZLB 4A3LI 4NBAA 1M1K2 1JWHC 4DQYB 2PMZA 1YITZ 1YJW1 1K8A1 4A3II 1Z01A 2O53A 3NH4A 3I551 1VQMZ 3CCS1 4QTTA 3OW2Z 4Y52I 3S14I 4DK1A 3CCRZ 3H3VJ 2OZKA 3KIFA 2B63I 4TNUA 2Q51A 3J81f 1N8R1 2ZAEB 3QWUA 1WZNA 2K3RA 3NDIA 3CCUZ 1ZH1A 1VQ6Z 1YJWZ 1VQKZ 3G71Z 1Q811 1KD12 2OOYB 2NVYI 2HF1A 1VLAA 1VQ8Z 4E33A 3S1QI 1RO0A 2RPRA 1VQN1 4NFRA 1YIJZ 3FKII 3HOVI 2GTIA 3D2LA 1VQK1 1X3WA 2OTLZ 3J81b 1ZB8A 4E2WA 3CC4Z 4XX2A 3EEDA 5IT9f 3H0GI 4AYBA 4E31A 3CCR1 4NOZA 1KD11 2KI7B 1Q812 1NP6A 2JIMA 3M4OI 3S17I 3ESWA 1N8R2 1YHQZ 1QVFZ 3G711 3S1MI 2VPZA 4RVDA 4E2YA 2OOXB 4NB9A 4RVFA 3NH5A 1W2BY 4A3CI 3IFUA 1K8A2 4HH4A 2K5RA 2E2JI 1M1K1 2PK7A 1VQ7Z 3CCJZ 5C4JI 4MD7A 1K9M2 3VMGA 4RV9A 4NBEA 2IZ4A 3PO3S 3GTQI 5IP7I 2YADA 3CC41 2DE5A 2JA5I 1VQ5Z 3G6EZ 2QA41 3HOZI 2RIQA 3G4S1 2W04A 2GTHA 1LQLA 1W2BZ 2M48A 5FLXb 3U50C 3JAMf 5D1PA 5T67A 1Q862 3CPWZ 2O4HA 1QF8A 1X3ZA 3HOYI 1Y8CA 2QKDA 3CMAZ 2I3CA 3RZOI 1Z02A 2QA4Z 3OW2Y 3F3PC 1YI21 3I4NI 2WAQA 1KRLA 3GTJI 3CCJ1 2JNYA 2VPYA 1PFTA 1RLYA 4HGZA 2JS4A 3IX0A 5FLMI 3CMA1 2RBLA 2KPIA 2Y0SA 4NB8A 2JIPA 3CCMZ 1FDOA 2NVXI 1TWCI 3G6E1 4NBBA 1NJI2 1I50I 2E2HI 3NH8A 3GTMS 2RT9A 5C3EI 1KC81 2AYDA 1QVGZ 1R9TI 4MD9A 2OTL1 2V8JA 3CCM1 4A3BI 3CCL1 1M901 1KQSY 1Q7Y1 2QEXZ 2JA7I 1USPB 1NUIA 1TWAI 4MXUA 1K732 2IV2X 1Q821 3PO3I 4DGLA 2WB1A 5A2Qb 3HOWI 1S721 2R7ZI 4BXXI 2VPWA 1QVGY 1WW9A 1YHQ1 1QXFA 4NH1C 2QRDB 2QEX1 3I4MI 5LL6f 3PO2I 1Y1WI 1S72Z 2P28A 4E32A 3FQQA 3J80b 3MONA 2V45A 3S16I 4BBRI 2JIRA 1VQOZ 1VQ41 2OTJZ 2QRCB 1TWFI
chains in the Genus database with same CATH topology
3CCLZ 3HKZA 4S1TA 3IF8A 5C4XI 2F4OA 1VQLZ 3CC71 2NVQI 1YUKA 1KQSZ 2OTJ1 3J7A4 1RNIA 1X0TA 2H85A 4RS4A 1Y1VS 4NBGA 3S1RI 1VQP1 4RVGA 2LIYA 3P5JB 3CC7Z 1TWGI 1ZB9A 1RO2A 3GTKI 3Q87A 1L1OC 2VUGA 4NBHA 3NFZA 2F4MA 2NVTI 1P9NA 2BJOA 1VQ9Z 1WCMI 3BG1B 1Y1VI 1YI2Z 3HOXI 3T4NB 1YJ91 3LUSA 2DE7A 5D1OA 1VQL1 1QVFY 3S2DI 4A3JI 1VQ4Z 3CCE1 2YU9I 1JJ2Y 3CMEZ 1Z03A 2QR1B 1YJ9Z 4MD8A 4BBSI 1VQPZ 3GTLI 5C44I 2P3YA 1YJNZ 2E9HA 3HOUI 4A3GI 1SFOI 5T64A 5CM2M 3S1NI 3KIHA 3CCVZ 4NBFA 4RVHA 1DL6A 1WIIA 2JMOA 4EWCA 1K83I 5AN9F 1I6HI 4HGYA 4NBCA 4A3KI 2AKLA 2HU9A 1YJN1 4A3DI 3S2HI 4QTUA 1VQ91 2E2II 1QYPA 4E2ZA 2EGTA 1I3QI 3TE5B 5T6BA 2Q4ZA 1Q822 2JUBA 1VQ81 2JA6I 1K731 2QREB 2GU2A 3RZDI 2R92I 1Q7Y2 1M902 2IZ3A 1TFIA 2R93I 3CME1 3CQZI 2DE6A 3GTMI 1VQO1 4E30A 3EERA 3VMHA 4A3MI 1RQFA 1USPA 1KC82 3M3YI 4CL1A 2VF1A 3VTNA 3GTOI 2V8KA 3CPWY 3CD6Z 3I56Z 4BY7I 4X6AI 1S7MA 3CCV1 1NJI1 2W03A 4MONA 4E2XA 3CCQZ 3FQMA 3CXCY 3BG0B 3NDJA 1RO4A 3F3FC 3D9XA 1YIT1 2JR6A 3CD61 4A93I 1TWHI 2J6AA 3GCFA 3I07A 3J80f 4BY1I 1N2FA 2QLVB 4Y7NI 3CCQ1 1ML8A 2RHBA 3GTPI 4MRIA 2V8IA 3S15I 5IT9b 3D6WA 3TDHB 3GTGI 1JJ2Z 1Q861 2R6MA 4A3EI 1VQM1 5D1OB 3VB9A 1YUAA 3I55Z 4NBDA 1VQ71 3CCSZ 3GKQA 4A3FI 3CC21 2M6NA 2G2KA 1VQNZ 5A2Qf 3CCU1 3CXCZ 1VQ61 3CCEZ 2PM9A 3MZKB 3K7AI 3JAMb 1VQ51 3I561 5FLXf 3CC2Z 2LFUA 5IP9I 4MH4A 3VMIA 1YIJ1 1K9M1 2JA8I 3G4SZ 2VUMI 3MZLB 4A3LI 4NBAA 1M1K2 1JWHC 4DQYB 2PMZA 1YITZ 1YJW1 1K8A1 4A3II 1Z01A 2O53A 3NH4A 3I551 1VQMZ 3CCS1 4QTTA 3OW2Z 4Y52I 3S14I 4DK1A 3CCRZ 3H3VJ 2OZKA 3KIFA 2B63I 4TNUA 2Q51A 3J81f 1N8R1 2ZAEB 3QWUA 3CCUZ 2K3RA 3NDIA 1ZH1A 1VQ6Z 1YJWZ 1VQKZ 3G71Z 1Q811 1KD12 2OOYB 2NVYI 2HF1A 1VLAA 1VQ8Z 4E33A 3S1QI 1RO0A 2RPRA 1VQN1 4NFRA 1YIJZ 3FKII 3HOVI 2GTIA 1VQK1 1X3WA 2OTLZ 3J81b 1ZB8A 4E2WA 3CC4Z 4XX2A 3EEDA 5IT9f 3H0GI 4AYBA 4E31A 3CCR1 4NOZA 1KD11 2KI7B 1Q812 1NP6A 3M4OI 3S17I 3ESWA 1N8R2 1YHQZ 1QVFZ 3G711 3S1MI 4RVDA 4E2YA 2OOXB 4NB9A 4RVFA 3NH5A 1W2BY 4A3CI 3IFUA 1K8A2 4HH4A 2K5RA 2E2JI 1M1K1 2PK7A 1VQ7Z 3CCJZ 5C4JI 4MD7A 1K9M2 3VMGA 4RV9A 4NBEA 2IZ4A 3PO3S 3GTQI 5IP7I 2YADA 3CC41 2DE5A 2JA5I 1VQ5Z 3G6EZ 2QA41 3HOZI 2RIQA 3G4S1 2W04A 2GTHA 1LQLA 1W2BZ 2M48A 5FLXb 3U50C 3JAMf 5D1PA 5T67A 1Q862 3CPWZ 2O4HA 1QF8A 1X3ZA 3HOYI 2QKDA 3CMAZ 2I3CA 3RZOI 1Z02A 2QA4Z 3OW2Y 3F3PC 1YI21 3I4NI 2WAQA 1KRLA 3GTJI 3CCJ1 2JNYA 1PFTA 1RLYA 4HGZA 2JS4A 3IX0A 5FLMI 3CMA1 2RBLA 2KPIA 2Y0SA 4NB8A 3CCMZ 2NVXI 1TWCI 3G6E1 4NBBA 1NJI2 1I50I 2E2HI 3NH8A 3GTMS 2RT9A 5C3EI 1KC81 1QVGZ 1R9TI 4MD9A 2OTL1 2V8JA 3CCM1 4A3BI 3CCL1 1M901 1KQSY 1Q7Y1 2QEXZ 2JA7I 1USPB 1NUIA 1TWAI 4MXUA 1K732 1Q821 3PO3I 4DGLA 2WB1A 5A2Qb 3HOWI 1S721 2R7ZI 4BXXI 1QVGY 1WW9A 1YHQ1 4NH1C 2QRDB 2QEX1 3I4MI 5LL6f 3PO2I 1Y1WI 1S72Z 2P28A 4E32A 3FQQA 3J80b 3MONA 3S16I 4BBRI 1VQOZ 1VQ41 2OTJZ 2QRCB 1TWFI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I55 1;  3CCL Z;  1VQM Z;  1VQ8 1;  1K73 1;  3CCS 1;  3OW2 Z;  1VQL Z;  3G4S 1;  3CCR Z;  1W2B Z;  3CC7 1;  1Q7Y 2;  1M90 2;  1N8R 1;  1Q86 2;  3CPW Z;  3CME 1;  3CCU Z;  1KQS Z;  1VQO 1;  1VQ6 Z;  1YJW Z;  2OTJ 1;  3CMA Z;  1VQK Z;  3G71 Z;  1Q81 1;  1KD1 2;  2QA4 Z;  1KC8 2;  3OW2 Y;  1VQP 1;  1VQ8 Z;  1YI2 1;  3CPW Y;  3CD6 Z;  3I56 Z;  3CCV 1;  1VQN 1;  1NJI 1;  3CC7 Z;  3CCJ 1;  1YIJ Z;  3CCQ Z;  3CXC Y;  1VQK 1;  3CMA 1;  1VQ9 Z;  2OTL Z;  3CCM Z;  1YI2 Z;  1YIT 1;  3CC4 Z;  1YJ9 1;  3CD6 1;  3G6E 1;  1NJI 2;  1VQL 1;  3CCQ 1;  3CCR 1;  1KC8 1;  1QVF Y;  1QVG Z;  1KD1 1;  1Q81 2;  1VQ4 Z;  3CCE 1;  1JJ2 Y;  1JJ2 Z;  3CME Z;  2OTL 1;  1Q86 1;  3CCM 1;  3I55 Z;  3CCL 1;  1VQM 1;  1YJ9 Z;  1N8R 2;  1Q7Y 1;  1YHQ Z;  1M90 1;  3CCS Z;  3G71 1;  1KQS Y;  1VQ7 1;  1QVF Z;  2QEX Z;  1VQP Z;  3CC2 1;  1K73 2;  1W2B Y;  1VQN Z;  1Q82 1;  3CCU 1;  3CXC Z;  1K8A 2;  1YJN Z;  1VQ6 1;  3CCE Z;  1S72 1;  1M1K 1;  1QVG Y;  1VQ7 Z;  1YHQ 1;  1VQ5 1;  2QEX 1;  3I56 1;  3CCV Z;  3CC2 Z;  3CCJ Z;  1YIJ 1;  1K9M 1;  1K9M 2;  3G4S Z;  1YJN 1;  1S72 Z;  1VQ9 1;  1M1K 2;  1VQO Z;  3CC4 1;  1YIT Z;  1VQ4 1;  1YJW 1;  1K8A 1;  1VQ5 Z;  2OTJ Z;  3G6E Z;  1Q82 2;  2QA4 1; 
#chains in the Genus database with same CATH topology
 3CCL Z;  3HKZ A;  4S1T A;  3IF8 A;  5C4X I;  2F4O A;  1VQL Z;  3CC7 1;  2NVQ I;  1YUK A;  1KQS Z;  2OTJ 1;  3J7A 4;  1RNI A;  1X0T A;  2H85 A;  4RS4 A;  1Y1V S;  4NBG A;  3S1R I;  1VQP 1;  4RVG A;  2LIY A;  3P5J B;  3CC7 Z;  1TWG I;  1ZB9 A;  1RO2 A;  3GTK I;  3Q87 A;  1L1O C;  2VUG A;  4NBH A;  3NFZ A;  2F4M A;  2NVT I;  1P9N A;  2BJO A;  1VQ9 Z;  1WCM I;  3BG1 B;  1Y1V I;  1YI2 Z;  3HOX I;  3T4N B;  1YJ9 1;  3LUS A;  2DE7 A;  1SIW A;  5D1O A;  1VQL 1;  1QVF Y;  3S2D I;  4A3J I;  2E7Z A;  1VQ4 Z;  3CCE 1;  2YU9 I;  1JJ2 Y;  3CME Z;  1Z03 A;  2QR1 B;  2JIQ A;  1YJ9 Z;  4MD8 A;  2LEX A;  4BBS I;  1VQP Z;  3GTL I;  5C44 I;  2P3Y A;  1YJN Z;  2E9H A;  3HOU I;  4A3G I;  1SFO I;  5T64 A;  5CM2 M;  3S1N I;  2V3V A;  1FDI A;  3KIH A;  3IR7 A;  3CCV Z;  4NBF A;  4RVH A;  1DL6 A;  1WII A;  2JMO A;  4EWC A;  1K83 I;  5AN9 F;  1I6H I;  4HGY A;  4NBC A;  4A3K I;  2AKL A;  2HU9 A;  1YJN 1;  4A3D I;  3S2H I;  4QTU A;  2NAP A;  1VQ9 1;  2E2I I;  1QYP A;  4E2Z A;  2EGT A;  1I3Q I;  3TE5 B;  5T6B A;  2Q4Z A;  1Q82 2;  2JUB A;  1VQ8 1;  2JA6 I;  1K73 1;  2QRE B;  2GU2 A;  3RZD I;  2R92 I;  1Q7Y 2;  1M90 2;  2IZ3 A;  1TFI A;  2R93 I;  3CME 1;  3CQZ I;  2DE6 A;  3GTM I;  1VQO 1;  4E30 A;  3EER A;  3VMH A;  4A3M I;  1RQF A;  1USP A;  1KC8 2;  3M3Y I;  4CL1 A;  2VF1 A;  3VTN A;  3GTO I;  2V8K A;  3CPW Y;  3CD6 Z;  3I56 Z;  4BY7 I;  4X6A I;  1S7M A;  3CCV 1;  1NJI 1;  2W03 A;  4MON A;  4E2X A;  3CCQ Z;  3FQM A;  3CXC Y;  3BG0 B;  3NDJ A;  2JIO A;  1RO4 A;  3F3F C;  1Q16 A;  3D9X A;  1YIT 1;  2JR6 A;  3CD6 1;  4A93 I;  1TWH I;  2J6A A;  3GCF A;  3I07 A;  3J80 f;  4BY1 I;  1N2F A;  2QLV B;  4Y7N I;  3CCQ 1;  1ML8 A;  2RHB A;  3GTP I;  4MRI A;  2V8I A;  3S15 I;  5IT9 b;  3D6W A;  3TDH B;  2VPX A;  3GTG I;  1JJ2 Z;  1Q86 1;  2R6M A;  4A3E I;  1VQM 1;  5D1O B;  1YUA A;  3VB9 A;  3I55 Z;  4NBD A;  1VQ7 1;  3CCS Z;  3GKQ A;  4A3F I;  3CC2 1;  2M6N A;  2G2K A;  1VQN Z;  5A2Q f;  3CCU 1;  3CXC Z;  1VQ6 1;  3CCE Z;  2PM9 A;  1WJ2 A;  3MZK B;  3K7A I;  1VQ5 1;  3JAM b;  3I56 1;  5FLX f;  3CC2 Z;  2LFU A;  5IP9 I;  4MH4 A;  3VMI A;  1YIJ 1;  1K9M 1;  2JA8 I;  3G4S Z;  2VUM I;  1AA6 A;  3MZL B;  4A3L I;  4NBA A;  1M1K 2;  1JWH C;  4DQY B;  2PMZ A;  1YIT Z;  1YJW 1;  1K8A 1;  4A3I I;  1Z01 A;  2O53 A;  3NH4 A;  3I55 1;  1VQM Z;  3CCS 1;  4QTT A;  3OW2 Z;  4Y52 I;  3S14 I;  4DK1 A;  3CCR Z;  3H3V J;  2OZK A;  3KIF A;  2B63 I;  4TNU A;  2Q51 A;  3J81 f;  1N8R 1;  2ZAE B;  3QWU A;  1WZN A;  2K3R A;  3NDI A;  3CCU Z;  1ZH1 A;  1VQ6 Z;  1YJW Z;  1VQK Z;  3G71 Z;  1Q81 1;  1KD1 2;  2OOY B;  2NVY I;  2HF1 A;  1VLA A;  1VQ8 Z;  4E33 A;  3S1Q I;  1RO0 A;  2RPR A;  1VQN 1;  4NFR A;  1YIJ Z;  3FKI I;  3HOV I;  2GTI A;  3D2L A;  1VQK 1;  1X3W A;  2OTL Z;  3J81 b;  1ZB8 A;  4E2W A;  3CC4 Z;  4XX2 A;  3EED A;  5IT9 f;  3H0G I;  4AYB A;  4E31 A;  3CCR 1;  4NOZ A;  1KD1 1;  2KI7 B;  1Q81 2;  1NP6 A;  2JIM A;  3M4O I;  3S17 I;  3ESW A;  1N8R 2;  1YHQ Z;  1QVF Z;  3G71 1;  3S1M I;  2VPZ A;  4RVD A;  4E2Y A;  2OOX B;  4NB9 A;  4RVF A;  3NH5 A;  1W2B Y;  4A3C I;  3IFU A;  1K8A 2;  4HH4 A;  2K5R A;  2E2J I;  1M1K 1;  2PK7 A;  1VQ7 Z;  3CCJ Z;  5C4J I;  4MD7 A;  1K9M 2;  3VMG A;  4RV9 A;  4NBE A;  2IZ4 A;  3PO3 S;  3GTQ I;  5IP7 I;  2YAD A;  3CC4 1;  2DE5 A;  2JA5 I;  1VQ5 Z;  3G6E Z;  2QA4 1;  3HOZ I;  2RIQ A;  3G4S 1;  2W04 A;  2GTH A;  1LQL A;  1W2B Z;  2M48 A;  5FLX b;  3U50 C;  3JAM f;  5D1P A;  5T67 A;  1Q86 2;  3CPW Z;  2O4H A;  1QF8 A;  1X3Z A;  3HOY I;  1Y8C A;  2QKD A;  3CMA Z;  2I3C A;  3RZO I;  1Z02 A;  2QA4 Z;  3OW2 Y;  3F3P C;  1YI2 1;  3I4N I;  2WAQ A;  1KRL A;  3GTJ I;  3CCJ 1;  2JNY A;  2VPY A;  1PFT A;  1RLY A;  4HGZ A;  2JS4 A;  3IX0 A;  5FLM I;  3CMA 1;  2RBL A;  2KPI A;  2Y0S A;  4NB8 A;  2JIP A;  3CCM Z;  1FDO A;  2NVX I;  1TWC I;  3G6E 1;  4NBB A;  1NJI 2;  1I50 I;  2E2H I;  3NH8 A;  3GTM S;  2RT9 A;  5C3E I;  1KC8 1;  2AYD A;  1QVG Z;  1R9T I;  4MD9 A;  2OTL 1;  2V8J A;  3CCM 1;  4A3B I;  3CCL 1;  1M90 1;  1KQS Y;  1Q7Y 1;  2QEX Z;  2JA7 I;  1USP B;  1NUI A;  1TWA I;  4MXU A;  1K73 2;  2IV2 X;  1Q82 1;  3PO3 I;  4DGL A;  2WB1 A;  5A2Q b;  3HOW I;  1S72 1;  2R7Z I;  4BXX I;  2VPW A;  1QVG Y;  1WW9 A;  1YHQ 1;  1QXF A;  4NH1 C;  2QRD B;  2QEX 1;  3I4M I;  5LL6 f;  3PO2 I;  1Y1W I;  1S72 Z;  2P28 A;  4E32 A;  3FQQ A;  3J80 b;  3MON A;  2V45 A;  3S16 I;  4BBR I;  2JIR A;  1VQO Z;  1VQ4 1;  2OTJ Z;  2QRC B;  1TWF I; 
#chains in the Genus database with same CATH homology
 3CCL Z;  3HKZ A;  4S1T A;  3IF8 A;  5C4X I;  2F4O A;  1VQL Z;  3CC7 1;  2NVQ I;  1YUK A;  1KQS Z;  2OTJ 1;  3J7A 4;  1RNI A;  1X0T A;  2H85 A;  4RS4 A;  1Y1V S;  4NBG A;  3S1R I;  1VQP 1;  4RVG A;  2LIY A;  3P5J B;  3CC7 Z;  1TWG I;  1ZB9 A;  1RO2 A;  3GTK I;  3Q87 A;  1L1O C;  2VUG A;  4NBH A;  3NFZ A;  2F4M A;  2NVT I;  1P9N A;  2BJO A;  1VQ9 Z;  1WCM I;  3BG1 B;  1Y1V I;  1YI2 Z;  3HOX I;  3T4N B;  1YJ9 1;  3LUS A;  2DE7 A;  5D1O A;  1VQL 1;  1QVF Y;  3S2D I;  4A3J I;  1VQ4 Z;  3CCE 1;  2YU9 I;  1JJ2 Y;  3CME Z;  1Z03 A;  2QR1 B;  1YJ9 Z;  4MD8 A;  4BBS I;  1VQP Z;  3GTL I;  5C44 I;  2P3Y A;  1YJN Z;  2E9H A;  3HOU I;  4A3G I;  1SFO I;  5T64 A;  5CM2 M;  3S1N I;  3KIH A;  3CCV Z;  4NBF A;  4RVH A;  1DL6 A;  1WII A;  2JMO A;  4EWC A;  1K83 I;  5AN9 F;  1I6H I;  4HGY A;  4NBC A;  4A3K I;  2AKL A;  2HU9 A;  1YJN 1;  4A3D I;  3S2H I;  4QTU A;  1VQ9 1;  2E2I I;  1QYP A;  4E2Z A;  2EGT A;  1I3Q I;  3TE5 B;  5T6B A;  2Q4Z A;  1Q82 2;  2JUB A;  1VQ8 1;  2JA6 I;  1K73 1;  2QRE B;  2GU2 A;  3RZD I;  2R92 I;  1Q7Y 2;  1M90 2;  2IZ3 A;  1TFI A;  2R93 I;  3CME 1;  3CQZ I;  2DE6 A;  3GTM I;  1VQO 1;  4E30 A;  3EER A;  3VMH A;  4A3M I;  1RQF A;  1USP A;  1KC8 2;  3M3Y I;  4CL1 A;  2VF1 A;  3VTN A;  3GTO I;  2V8K A;  3CPW Y;  3CD6 Z;  3I56 Z;  4BY7 I;  4X6A I;  1S7M A;  3CCV 1;  1NJI 1;  2W03 A;  4MON A;  4E2X A;  3CCQ Z;  3FQM A;  3CXC Y;  3BG0 B;  3NDJ A;  1RO4 A;  3F3F C;  3D9X A;  1YIT 1;  2JR6 A;  3CD6 1;  4A93 I;  1TWH I;  2J6A A;  3GCF A;  3I07 A;  3J80 f;  4BY1 I;  1N2F A;  2QLV B;  4Y7N I;  3CCQ 1;  1ML8 A;  2RHB A;  3GTP I;  4MRI A;  2V8I A;  3S15 I;  5IT9 b;  3D6W A;  3TDH B;  3GTG I;  1JJ2 Z;  1Q86 1;  2R6M A;  4A3E I;  1VQM 1;  5D1O B;  3VB9 A;  1YUA A;  3I55 Z;  4NBD A;  1VQ7 1;  3CCS Z;  3GKQ A;  4A3F I;  3CC2 1;  2M6N A;  2G2K A;  1VQN Z;  5A2Q f;  3CCU 1;  3CXC Z;  1VQ6 1;  3CCE Z;  2PM9 A;  3MZK B;  3K7A I;  3JAM b;  1VQ5 1;  3I56 1;  5FLX f;  3CC2 Z;  2LFU A;  5IP9 I;  4MH4 A;  3VMI A;  1YIJ 1;  1K9M 1;  2JA8 I;  3G4S Z;  2VUM I;  3MZL B;  4A3L I;  4NBA A;  1M1K 2;  1JWH C;  4DQY B;  2PMZ A;  1YIT Z;  1YJW 1;  1K8A 1;  4A3I I;  1Z01 A;  2O53 A;  3NH4 A;  3I55 1;  1VQM Z;  3CCS 1;  4QTT A;  3OW2 Z;  4Y52 I;  3S14 I;  4DK1 A;  3CCR Z;  3H3V J;  2OZK A;  3KIF A;  2B63 I;  4TNU A;  2Q51 A;  3J81 f;  1N8R 1;  2ZAE B;  3QWU A;  3CCU Z;  2K3R A;  3NDI A;  1ZH1 A;  1VQ6 Z;  1YJW Z;  1VQK Z;  3G71 Z;  1Q81 1;  1KD1 2;  2OOY B;  2NVY I;  2HF1 A;  1VLA A;  1VQ8 Z;  4E33 A;  3S1Q I;  1RO0 A;  2RPR A;  1VQN 1;  4NFR A;  1YIJ Z;  3FKI I;  3HOV I;  2GTI A;  1VQK 1;  1X3W A;  2OTL Z;  3J81 b;  1ZB8 A;  4E2W A;  3CC4 Z;  4XX2 A;  3EED A;  5IT9 f;  3H0G I;  4AYB A;  4E31 A;  3CCR 1;  4NOZ A;  1KD1 1;  2KI7 B;  1Q81 2;  1NP6 A;  3M4O I;  3S17 I;  3ESW A;  1N8R 2;  1YHQ Z;  1QVF Z;  3G71 1;  3S1M I;  4RVD A;  4E2Y A;  2OOX B;  4NB9 A;  4RVF A;  3NH5 A;  1W2B Y;  4A3C I;  3IFU A;  1K8A 2;  4HH4 A;  2K5R A;  2E2J I;  1M1K 1;  2PK7 A;  1VQ7 Z;  3CCJ Z;  5C4J I;  4MD7 A;  1K9M 2;  3VMG A;  4RV9 A;  4NBE A;  2IZ4 A;  3PO3 S;  3GTQ I;  5IP7 I;  2YAD A;  3CC4 1;  2DE5 A;  2JA5 I;  1VQ5 Z;  3G6E Z;  2QA4 1;  3HOZ I;  2RIQ A;  3G4S 1;  2W04 A;  2GTH A;  1LQL A;  1W2B Z;  2M48 A;  5FLX b;  3U50 C;  3JAM f;  5D1P A;  5T67 A;  1Q86 2;  3CPW Z;  2O4H A;  1QF8 A;  1X3Z A;  3HOY I;  2QKD A;  3CMA Z;  2I3C A;  3RZO I;  1Z02 A;  2QA4 Z;  3OW2 Y;  3F3P C;  1YI2 1;  3I4N I;  2WAQ A;  1KRL A;  3GTJ I;  3CCJ 1;  2JNY A;  1PFT A;  1RLY A;  4HGZ A;  2JS4 A;  3IX0 A;  5FLM I;  3CMA 1;  2RBL A;  2KPI A;  2Y0S A;  4NB8 A;  3CCM Z;  2NVX I;  1TWC I;  3G6E 1;  4NBB A;  1NJI 2;  1I50 I;  2E2H I;  3NH8 A;  3GTM S;  2RT9 A;  5C3E I;  1KC8 1;  1QVG Z;  1R9T I;  4MD9 A;  2OTL 1;  2V8J A;  3CCM 1;  4A3B I;  3CCL 1;  1M90 1;  1KQS Y;  1Q7Y 1;  2QEX Z;  2JA7 I;  1USP B;  1NUI A;  1TWA I;  4MXU A;  1K73 2;  1Q82 1;  3PO3 I;  4DGL A;  2WB1 A;  5A2Q b;  3HOW I;  1S72 1;  2R7Z I;  4BXX I;  1QVG Y;  1WW9 A;  1YHQ 1;  4NH1 C;  2QRD B;  2QEX 1;  3I4M I;  5LL6 f;  3PO2 I;  1Y1W I;  1S72 Z;  2P28 A;  4E32 A;  3FQQ A;  3J80 b;  3MON A;  3S16 I;  4BBR I;  1VQO Z;  1VQ4 1;  2OTJ Z;  2QRC B;  1TWF I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...