1VQO1

The structure of ccpmn bound to the large ribosomal subunit haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vqo100
1YIJZ 1VQ51 1YI21 3G4S1 3G6EZ 3CME1 1VQ41 3CC71 1Q811 1KD11 1YJ91 1VQ8Z 1VQ91 1VQLZ 3CC41 3CCE1 3CCJ1 3I551 1KC82 3CCVZ 1YITZ 1VQK1 3G71Z 2OTJ1 3CCM1 1M902 3CCL1 1M1K1 1Q7Y1 1N8R1 1K731 1VQM1 2QA41 1YJWZ 1S72Z 1K9M1 1YHQZ 1M1K2 3CCS1 2QEX1 1Q7Y2 2OTL1 3CD61 3CCU1 1VQO1 3CMAZ 1NJI1 1YJNZ 1Q821 1KQSY 3G6E1 1Q812 1KD12 1Q861 1YI2Z 1VQ5Z 1VQP1 3G4SZ 1VQL1 1VQ71 3CCV1 1Q862 3OW2Y 1VQ9Z 3CC2Z 3CCEZ 3CCJZ 1QVFY 3CCR1 1VQKZ 1N8R2 1K732 3CCQZ 1YJW1 2OTJZ 3CPWY 1VQNZ 1S721 1K9M2 1YIJ1 1VQ6Z 3CPWZ 3I56Z 3CMA1 1NJI2 1KQSZ 1YJN1 1VQ81 3CD6Z 1Q822 3CMEZ 1QVGY 1VQ4Z 1VQOZ 3CC7Z 1YIT1 3G711 1YJ9Z 3CC4Z 1QVGZ 3I55Z 1W2BY 1KC81 3CXCY 3OW2Z 1VQPZ 3CC21 3CCMZ 1VQ7Z 1QVFZ 1YHQ1 1M901 1W2BZ 3CCLZ 3CXCZ 3CCQ1 1VQMZ 2QA4Z 1K8A1 1VQN1 3CCSZ 2QEXZ 3CCRZ 1VQ61 1JJ2Y 2OTLZ 1K8A2 3I561 3CCUZ 1JJ2Z
chains in the Genus database with same CATH superfamily
4NH1C 3S2DI 1I6HI 3G6EZ 1ZB8A 1S7MA 2PM9A 1YJ91 2QRCB 5C4XI 3CCE1 1TWCI 3CCVZ 2O4HA 2OTJ1 4NBEA 1WZNA 2OOYB 2E7ZA 3D2LA 3S1MI 3VMHA 1K9M1 3CCS1 2OTL1 2JIQA 1VLAA 5D1OA 3VTNA 1Z03A 2RPRA 3HOZI 3S2HI 2B63I 1YJNZ 1KQSY 1Q861 2JS4A 1YI2Z 1VQ71 3PO3I 2E2JI 2JIRA 1VQ9Z 3CCJZ 2JIPA 2R92I 1YJW1 1K9M2 1KRLA 1Q16A 1X3ZA 2VPWA 4MH4A 2JA6I 3I56Z 1QF8A 1TFIA 3IR7A 2G2KA 4A3II 4NBGA 1VQ81 3BG1B 1VQOZ 3S1QI 3CC7Z 1I50I 2HU9A 2JR6A 2K3RA 1NUIA 2R7ZI 3CC4Z 1QVGZ 3I55Z 1KC81 3S14I 3OW2Z 4NB9A 3EERA 3CC21 1QVFZ 3CCQ1 1VQMZ 3I07A 2HF1A 4E32A 3GTJI 3EEDA 3F3PC 4E2WA 2QEXZ 4A3DI 1JJ2Y 4NBBA 3NH5A 2NVTI 1YIJZ 1VQ51 4NBDA 3RZOI 1USPA 3VMIA 3CME1 1VQ41 1KD11 2JMOA 2IZ3A 4A3JI 4DK1A 2J6AA 4MRIA 1VQLZ 3ESWA 3U50C 4BBSI 1TWGI 3P5JB 4NB8A 1R9TI 1YUKA 1KC82 1Y1WI 4XX2A 3CCM1 3Q87A 4A3EI 3CCL1 2E9HA 1K731 2RIQA 3D6WA 2IZ4A 2DE6A 3K7AI 5IT9f 1FDOA 4E2XA 3TDHB 2E2HI 3CD61 3I4MI 1LQLA 3CCU1 2WAQA 3KIHA 3IFUA 3RZDI 1Q821 3PO2I 3G6E1 1KD12 3TE5B 3NH8A 1RLYA 1X3WA 2BJOA 5FLMI 3CCV1 2OOXB 2IV2X 1QXFA 3GTQI 1N2FA 3KIFA 2VPXA 3CCEZ 1WCMI 3CCR1 5AN9F 1K732 2RBLA 2OTJZ 3CPWY 2NAPA 2PK7A 1YUAA 2R6MA 1RO0A 4BY1I 4MONA 4AYBA 3GTOI 2P3YA 4Y52I 2Q4ZA 2EGTA 2KPIA 1TWAI 1YJN1 1Q822 1P9NA 4HH4A 1YIT1 3S15I 3G711 3IX0A 1NP6A 4QTTA 4BXXI 2GU2A 2QREB 5CM2M 2NVQI 3FQQA 5IT9b 2QR1B 4MXUA 4RV9A 5A2Qb 5T67A 1ZH1A 1VQ7Z 2JNYA 1YHQ1 1M901 4NBHA 4E33A 1ML8A 2QA4Z 4EWCA 1JWHC 2VF1A 2I3CA 2JIOA 3HKZA 1Y1VS 4Y7NI 3I561 2LFUA 3GTGI 1DL6A 1JJ2Z 3G4S1 3M3YI 3HOUI 4A3MI 3MZLB 3VMGA 2YU9I 1RO4A 3CC71 1Q811 4E2YA 4X6AI 2AYDA 1VQ8Z 4DGLA 3GTMS 3CC41 1L1OC 3MONA 4RVGA 4BBRI 3I551 2R93I 1VQK1 2Y0SA 2RHBA 2F4OA 1M902 1VQM1 3NDIA 4RVDA 5FLXf 3S16I 1S72Z 4MD7A 2QLVB 2P28A 1Q7Y2 2QEX1 1M1K2 1K83I 3GTMI 2F4MA 4NFRA 2V8KA 3CMAZ 1Q812 2OZKA 1VQ5Z 1VQP1 4RS4A 1VQL1 1RNIA 2DE5A 3OW2Y 3FKII 4RVFA 4TNUA 2M6NA 2V3VA 1QVFY 5C3EI 5A2Qf 5D1OB 3GCFA 2W04A 1VQNZ 4DQYB 1VQ6Z 5IP9I 3CPWZ 4E2ZA 1KQSZ 3CD6Z 4A93I 1YJ9Z 2E2II 2PMZA 1W2BY 5FLXb 3CXCY 1SIWA 5C4JI 4NBFA 2JA5I 3D9XA 3CQZI 3J81f 5LL6f 4BY7I 1TWFI 1WW9A 2AKLA 1Z01A 4A3CI 1WJ2A 3CCSZ 3F3FC 3CCRZ 3J80b 2OTLZ 1K8A2 3HOXI 3QWUA 2NVXI 3PO3S 1YI21 3HOYI 3S17I 2VUGA 2K5RA 2GTHA 1X0TA 1TWHI 1VQ91 2O53A 1SFOI 3CCJ1 3JAMf 2YADA 4E31A 1YITZ 3J7A4 3G71Z 3HOWI 4MD9A 3GTLI 3VB9A 3S1RI 2JUBA 2W03A 1FDIA 1M1K1 1Q7Y1 3GTKI 1N8R1 4A3KI 2QA41 1YJWZ 2V8IA 4S1TA 2H85A 2ZAEB 4NBCA 1YHQZ 1AA6A 4MD8A 2RT9A 1RQFA 1PFTA 2LIYA 1USPB 4NBAA 1VQO1 2NVYI 1NJI1 1I3QI 3HOVI 3J81b 2M48A 3G4SZ 1Y1VI 4HGZA 2LEXA 2WB1A 1Q862 2GTIA 4CL1A 3CC2Z 4A3FI 3FQMA 3M4OI 2QKDA 1VQKZ 1N8R2 2JIMA 3CCQZ 1RO2A 4E30A 1S721 2VUMI 3H3VJ 3NDJA 3MZKB 1YIJ1 1ZB9A 3I4NI 4HGYA 5C44I 2VPYA 3J80f 2JA8I 5D1PA 5T64A 3JAMb 3CMA1 1NJI2 1Z02A 3BG0B 3T4NB 1Y8CA 3CMEZ 3LUSA 5IP7I 1QVGY 1VQ4Z 4A3GI 3NFZA 3S1NI 4A3LI 3NH4A 4A3BI 2Q51A 5T6BA 2QRDB 1VQPZ 4QTUA 3CCMZ 1W2BZ 3CCLZ 3CXCZ 2V8JA 1QYPA 3IF8A 1K8A1 3GTPI 1VQN1 2KI7B 2VPZA 3H0GI 2JA7I 1VQ61 2DE7A 3GKQA 1WIIA 2V45A 4RVHA 3CCUZ 4NOZA
chains in the Genus database with same CATH topology
4NH1C 3S2DI 1I6HI 3G6EZ 1ZB8A 1S7MA 2PM9A 1YJ91 2QRCB 5C4XI 3CCE1 1TWCI 3CCVZ 2O4HA 2OTJ1 4NBEA 2OOYB 3S1MI 3VMHA 1K9M1 3CCS1 2OTL1 1VLAA 5D1OA 3VTNA 1Z03A 2RPRA 3HOZI 3S2HI 2B63I 1YJNZ 1KQSY 1Q861 2JS4A 1YI2Z 1VQ71 3PO3I 2E2JI 1VQ9Z 3CCJZ 2R92I 1YJW1 1K9M2 1KRLA 1X3ZA 4MH4A 2JA6I 3I56Z 1QF8A 1TFIA 2G2KA 4A3II 4NBGA 1VQ81 3BG1B 1VQOZ 3S1QI 3CC7Z 1I50I 2HU9A 2JR6A 2K3RA 1NUIA 2R7ZI 3CC4Z 1QVGZ 3I55Z 1KC81 3S14I 3OW2Z 4NB9A 3EERA 3CC21 1QVFZ 3CCQ1 1VQMZ 3I07A 2HF1A 4E32A 3GTJI 3EEDA 3F3PC 4E2WA 2QEXZ 4A3DI 1JJ2Y 4NBBA 3NH5A 2NVTI 1YIJZ 1VQ51 4NBDA 3RZOI 1USPA 3VMIA 3CME1 1VQ41 1KD11 2JMOA 2IZ3A 4A3JI 4DK1A 2J6AA 4MRIA 1VQLZ 3ESWA 3U50C 4BBSI 1TWGI 3P5JB 4NB8A 1R9TI 1YUKA 1KC82 1Y1WI 4XX2A 3CCM1 3Q87A 4A3EI 3CCL1 2E9HA 1K731 2RIQA 3D6WA 2IZ4A 2DE6A 3K7AI 5IT9f 4E2XA 3TDHB 2E2HI 3CD61 3I4MI 1LQLA 3CCU1 2WAQA 3KIHA 3IFUA 3RZDI 1Q821 3PO2I 3G6E1 1KD12 3TE5B 3NH8A 1RLYA 1X3WA 2BJOA 5FLMI 3CCV1 2OOXB 3GTQI 1N2FA 3KIFA 3CCEZ 1WCMI 3CCR1 5AN9F 1K732 2RBLA 2OTJZ 3CPWY 2PK7A 1YUAA 2R6MA 1RO0A 4BY1I 4MONA 4AYBA 3GTOI 2P3YA 4Y52I 2Q4ZA 2EGTA 2KPIA 1TWAI 1YJN1 1Q822 1P9NA 4HH4A 1YIT1 3S15I 3G711 3IX0A 1NP6A 4QTTA 4BXXI 2GU2A 2QREB 5CM2M 2NVQI 3FQQA 5IT9b 2QR1B 4MXUA 4RV9A 5A2Qb 5T67A 1ZH1A 1VQ7Z 2JNYA 1YHQ1 1M901 4NBHA 4E33A 1ML8A 2QA4Z 4EWCA 1JWHC 2VF1A 2I3CA 3HKZA 1Y1VS 4Y7NI 3I561 2LFUA 3GTGI 1DL6A 1JJ2Z 3G4S1 3M3YI 3HOUI 4A3MI 3MZLB 3VMGA 2YU9I 1RO4A 3CC71 1Q811 4E2YA 4X6AI 1VQ8Z 3GTMS 4DGLA 3CC41 1L1OC 3MONA 4RVGA 4BBRI 3I551 2R93I 1VQK1 2Y0SA 2RHBA 2F4OA 1M902 1VQM1 3NDIA 4RVDA 5FLXf 3S16I 1S72Z 4MD7A 2QLVB 2P28A 1Q7Y2 2QEX1 1M1K2 1K83I 3GTMI 2F4MA 4NFRA 2V8KA 3CMAZ 1Q812 2OZKA 1VQ5Z 1VQP1 4RS4A 1VQL1 1RNIA 2DE5A 3OW2Y 3FKII 4RVFA 4TNUA 2M6NA 1QVFY 5C3EI 5A2Qf 5D1OB 3GCFA 2W04A 1VQNZ 4DQYB 1VQ6Z 5IP9I 3CPWZ 4E2ZA 1KQSZ 3CD6Z 4A93I 1YJ9Z 2E2II 2PMZA 1W2BY 5FLXb 3CXCY 5C4JI 4NBFA 2JA5I 3D9XA 3CQZI 3J81f 5LL6f 4BY7I 1TWFI 1WW9A 2AKLA 1Z01A 4A3CI 3CCSZ 3F3FC 3CCRZ 3J80b 2OTLZ 1K8A2 3HOXI 3QWUA 2NVXI 3PO3S 1YI21 3HOYI 3S17I 2VUGA 2K5RA 2GTHA 1X0TA 1TWHI 1VQ91 2O53A 1SFOI 3CCJ1 3JAMf 2YADA 4E31A 1YITZ 3J7A4 3G71Z 3HOWI 4MD9A 3GTLI 3VB9A 3S1RI 2JUBA 2W03A 1M1K1 1Q7Y1 3GTKI 1N8R1 4A3KI 2QA41 1YJWZ 2V8IA 4S1TA 2H85A 2ZAEB 4NBCA 1YHQZ 4MD8A 2RT9A 1RQFA 1PFTA 2LIYA 1USPB 4NBAA 1VQO1 2NVYI 1NJI1 1I3QI 3HOVI 3J81b 2M48A 3G4SZ 1Y1VI 4HGZA 2WB1A 1Q862 2GTIA 4CL1A 3CC2Z 4A3FI 3FQMA 3M4OI 2QKDA 1VQKZ 1N8R2 3CCQZ 1RO2A 4E30A 1S721 2VUMI 3H3VJ 3NDJA 3MZKB 1YIJ1 1ZB9A 3I4NI 4HGYA 5C44I 2JA8I 3J80f 5D1PA 5T64A 3JAMb 3CMA1 1NJI2 1Z02A 3BG0B 3T4NB 3CMEZ 3LUSA 5IP7I 1QVGY 1VQ4Z 4A3GI 3NFZA 3S1NI 4A3LI 3NH4A 4A3BI 2Q51A 5T6BA 2QRDB 1VQPZ 4QTUA 3CCMZ 1W2BZ 3CCLZ 3CXCZ 2V8JA 1QYPA 3IF8A 1K8A1 3GTPI 1VQN1 2KI7B 3H0GI 2JA7I 1VQ61 2DE7A 3GKQA 1WIIA 4RVHA 3CCUZ 4NOZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIJ Z;  1VQ5 1;  1YI2 1;  3G4S 1;  3G6E Z;  3CME 1;  1VQ4 1;  3CC7 1;  1Q81 1;  1KD1 1;  1YJ9 1;  1VQ8 Z;  1VQ9 1;  1VQL Z;  3CC4 1;  3CCE 1;  3CCJ 1;  3I55 1;  1KC8 2;  3CCV Z;  1YIT Z;  1VQK 1;  3G71 Z;  2OTJ 1;  3CCM 1;  1M90 2;  3CCL 1;  1M1K 1;  1Q7Y 1;  1N8R 1;  1K73 1;  1VQM 1;  2QA4 1;  1YJW Z;  1S72 Z;  1K9M 1;  1YHQ Z;  1M1K 2;  3CCS 1;  2QEX 1;  1Q7Y 2;  2OTL 1;  3CD6 1;  3CCU 1;  1VQO 1;  3CMA Z;  1NJI 1;  1YJN Z;  1Q82 1;  1KQS Y;  3G6E 1;  1Q81 2;  1KD1 2;  1Q86 1;  1YI2 Z;  1VQ5 Z;  1VQP 1;  3G4S Z;  1VQL 1;  1VQ7 1;  3CCV 1;  1Q86 2;  3OW2 Y;  1VQ9 Z;  3CC2 Z;  3CCE Z;  3CCJ Z;  1QVF Y;  3CCR 1;  1VQK Z;  1N8R 2;  1K73 2;  3CCQ Z;  1YJW 1;  2OTJ Z;  3CPW Y;  1VQN Z;  1S72 1;  1K9M 2;  1YIJ 1;  1VQ6 Z;  3CPW Z;  3I56 Z;  3CMA 1;  1NJI 2;  1KQS Z;  1YJN 1;  1VQ8 1;  3CD6 Z;  1Q82 2;  3CME Z;  1QVG Y;  1VQ4 Z;  1VQO Z;  3CC7 Z;  1YIT 1;  3G71 1;  1YJ9 Z;  3CC4 Z;  1QVG Z;  3I55 Z;  1W2B Y;  1KC8 1;  3CXC Y;  3OW2 Z;  1VQP Z;  3CC2 1;  3CCM Z;  1VQ7 Z;  1QVF Z;  1YHQ 1;  1M90 1;  1W2B Z;  3CCL Z;  3CXC Z;  3CCQ 1;  1VQM Z;  2QA4 Z;  1K8A 1;  1VQN 1;  3CCS Z;  2QEX Z;  3CCR Z;  1VQ6 1;  1JJ2 Y;  2OTL Z;  1K8A 2;  3I56 1;  3CCU Z;  1JJ2 Z; 
#chains in the Genus database with same CATH topology
 4NH1 C;  3S2D I;  1I6H I;  3G6E Z;  1ZB8 A;  1S7M A;  2PM9 A;  1YJ9 1;  2QRC B;  5C4X I;  3CCE 1;  1TWC I;  3CCV Z;  2O4H A;  2OTJ 1;  4NBE A;  1WZN A;  2OOY B;  2E7Z A;  3D2L A;  3S1M I;  3VMH A;  1K9M 1;  3CCS 1;  2OTL 1;  2JIQ A;  1VLA A;  5D1O A;  3VTN A;  1Z03 A;  2RPR A;  3HOZ I;  3S2H I;  2B63 I;  1YJN Z;  1KQS Y;  1Q86 1;  2JS4 A;  1YI2 Z;  1VQ7 1;  3PO3 I;  2E2J I;  2JIR A;  1VQ9 Z;  3CCJ Z;  2JIP A;  2R92 I;  1YJW 1;  1K9M 2;  1KRL A;  1Q16 A;  1X3Z A;  2VPW A;  4MH4 A;  2JA6 I;  3I56 Z;  1QF8 A;  1TFI A;  3IR7 A;  2G2K A;  4A3I I;  4NBG A;  1VQ8 1;  3BG1 B;  1VQO Z;  3S1Q I;  3CC7 Z;  1I50 I;  2HU9 A;  2JR6 A;  2K3R A;  1NUI A;  2R7Z I;  3CC4 Z;  1QVG Z;  3I55 Z;  1KC8 1;  3S14 I;  3OW2 Z;  4NB9 A;  3EER A;  3CC2 1;  1QVF Z;  3CCQ 1;  1VQM Z;  3I07 A;  2HF1 A;  4E32 A;  3GTJ I;  3EED A;  3F3P C;  4E2W A;  2QEX Z;  4A3D I;  1JJ2 Y;  4NBB A;  3NH5 A;  2NVT I;  1YIJ Z;  1VQ5 1;  4NBD A;  3RZO I;  1USP A;  3VMI A;  3CME 1;  1VQ4 1;  1KD1 1;  2JMO A;  2IZ3 A;  4A3J I;  4DK1 A;  2J6A A;  4MRI A;  1VQL Z;  3ESW A;  3U50 C;  4BBS I;  1TWG I;  3P5J B;  4NB8 A;  1R9T I;  1YUK A;  1KC8 2;  1Y1W I;  4XX2 A;  3CCM 1;  3Q87 A;  4A3E I;  3CCL 1;  2E9H A;  1K73 1;  2RIQ A;  3D6W A;  2IZ4 A;  2DE6 A;  3K7A I;  5IT9 f;  1FDO A;  4E2X A;  3TDH B;  2E2H I;  3CD6 1;  3I4M I;  1LQL A;  3CCU 1;  2WAQ A;  3KIH A;  3IFU A;  3RZD I;  1Q82 1;  3PO2 I;  3G6E 1;  1KD1 2;  3TE5 B;  3NH8 A;  1RLY A;  1X3W A;  2BJO A;  5FLM I;  3CCV 1;  2OOX B;  2IV2 X;  1QXF A;  3GTQ I;  1N2F A;  3KIF A;  2VPX A;  3CCE Z;  1WCM I;  3CCR 1;  5AN9 F;  1K73 2;  2RBL A;  2OTJ Z;  3CPW Y;  2NAP A;  2PK7 A;  1YUA A;  2R6M A;  1RO0 A;  4BY1 I;  4MON A;  4AYB A;  3GTO I;  2P3Y A;  4Y52 I;  2Q4Z A;  2EGT A;  2KPI A;  1TWA I;  1YJN 1;  1Q82 2;  1P9N A;  4HH4 A;  1YIT 1;  3S15 I;  3G71 1;  3IX0 A;  1NP6 A;  4QTT A;  4BXX I;  2GU2 A;  2QRE B;  5CM2 M;  2NVQ I;  3FQQ A;  5IT9 b;  2QR1 B;  4MXU A;  4RV9 A;  5A2Q b;  5T67 A;  1ZH1 A;  1VQ7 Z;  2JNY A;  1YHQ 1;  1M90 1;  4NBH A;  4E33 A;  1ML8 A;  2QA4 Z;  4EWC A;  1JWH C;  2VF1 A;  2I3C A;  2JIO A;  3HKZ A;  1Y1V S;  4Y7N I;  3I56 1;  2LFU A;  3GTG I;  1DL6 A;  1JJ2 Z;  3G4S 1;  3M3Y I;  3HOU I;  4A3M I;  3MZL B;  3VMG A;  2YU9 I;  1RO4 A;  3CC7 1;  1Q81 1;  4E2Y A;  4X6A I;  2AYD A;  1VQ8 Z;  4DGL A;  3GTM S;  3CC4 1;  1L1O C;  3MON A;  4RVG A;  4BBR I;  3I55 1;  2R93 I;  1VQK 1;  2Y0S A;  2RHB A;  2F4O A;  1M90 2;  1VQM 1;  3NDI A;  4RVD A;  5FLX f;  3S16 I;  1S72 Z;  4MD7 A;  2QLV B;  2P28 A;  1Q7Y 2;  2QEX 1;  1M1K 2;  1K83 I;  3GTM I;  2F4M A;  4NFR A;  2V8K A;  3CMA Z;  1Q81 2;  2OZK A;  1VQ5 Z;  1VQP 1;  4RS4 A;  1VQL 1;  1RNI A;  2DE5 A;  3OW2 Y;  3FKI I;  4RVF A;  4TNU A;  2M6N A;  2V3V A;  1QVF Y;  5C3E I;  5A2Q f;  5D1O B;  3GCF A;  2W04 A;  1VQN Z;  4DQY B;  1VQ6 Z;  5IP9 I;  3CPW Z;  4E2Z A;  1KQS Z;  3CD6 Z;  4A93 I;  1YJ9 Z;  2E2I I;  2PMZ A;  1W2B Y;  5FLX b;  3CXC Y;  1SIW A;  5C4J I;  4NBF A;  2JA5 I;  3D9X A;  3CQZ I;  3J81 f;  5LL6 f;  4BY7 I;  1TWF I;  1WW9 A;  2AKL A;  1Z01 A;  4A3C I;  1WJ2 A;  3CCS Z;  3F3F C;  3CCR Z;  3J80 b;  2OTL Z;  1K8A 2;  3HOX I;  3QWU A;  2NVX I;  3PO3 S;  1YI2 1;  3HOY I;  3S17 I;  2VUG A;  2K5R A;  2GTH A;  1X0T A;  1TWH I;  1VQ9 1;  2O53 A;  1SFO I;  3CCJ 1;  3JAM f;  2YAD A;  4E31 A;  1YIT Z;  3J7A 4;  3G71 Z;  3HOW I;  4MD9 A;  3GTL I;  3VB9 A;  3S1R I;  2JUB A;  2W03 A;  1FDI A;  1M1K 1;  1Q7Y 1;  3GTK I;  1N8R 1;  4A3K I;  2QA4 1;  1YJW Z;  2V8I A;  4S1T A;  2H85 A;  2ZAE B;  4NBC A;  1YHQ Z;  1AA6 A;  4MD8 A;  2RT9 A;  1RQF A;  1PFT A;  2LIY A;  1USP B;  4NBA A;  1VQO 1;  2NVY I;  1NJI 1;  1I3Q I;  3HOV I;  3J81 b;  2M48 A;  3G4S Z;  1Y1V I;  4HGZ A;  2LEX A;  2WB1 A;  1Q86 2;  2GTI A;  4CL1 A;  3CC2 Z;  4A3F I;  3FQM A;  3M4O I;  2QKD A;  1VQK Z;  1N8R 2;  2JIM A;  3CCQ Z;  1RO2 A;  4E30 A;  1S72 1;  2VUM I;  3H3V J;  3NDJ A;  3MZK B;  1YIJ 1;  1ZB9 A;  3I4N I;  4HGY A;  5C44 I;  2VPY A;  3J80 f;  2JA8 I;  5D1P A;  5T64 A;  3JAM b;  3CMA 1;  1NJI 2;  1Z02 A;  3BG0 B;  3T4N B;  1Y8C A;  3CME Z;  3LUS A;  5IP7 I;  1QVG Y;  1VQ4 Z;  4A3G I;  3NFZ A;  3S1N I;  4A3L I;  3NH4 A;  4A3B I;  2Q51 A;  5T6B A;  2QRD B;  1VQP Z;  4QTU A;  3CCM Z;  1W2B Z;  3CCL Z;  3CXC Z;  2V8J A;  1QYP A;  3IF8 A;  1K8A 1;  3GTP I;  1VQN 1;  2KI7 B;  2VPZ A;  3H0G I;  2JA7 I;  1VQ6 1;  2DE7 A;  3GKQ A;  1WII A;  2V45 A;  4RVH A;  3CCU Z;  4NOZ A; 
#chains in the Genus database with same CATH homology
 4NH1 C;  3S2D I;  1I6H I;  3G6E Z;  1ZB8 A;  1S7M A;  2PM9 A;  1YJ9 1;  2QRC B;  5C4X I;  3CCE 1;  1TWC I;  3CCV Z;  2O4H A;  2OTJ 1;  4NBE A;  2OOY B;  3S1M I;  3VMH A;  1K9M 1;  3CCS 1;  2OTL 1;  1VLA A;  5D1O A;  3VTN A;  1Z03 A;  2RPR A;  3HOZ I;  3S2H I;  2B63 I;  1YJN Z;  1KQS Y;  1Q86 1;  2JS4 A;  1YI2 Z;  1VQ7 1;  3PO3 I;  2E2J I;  1VQ9 Z;  3CCJ Z;  2R92 I;  1YJW 1;  1K9M 2;  1KRL A;  1X3Z A;  4MH4 A;  2JA6 I;  3I56 Z;  1QF8 A;  1TFI A;  2G2K A;  4A3I I;  4NBG A;  1VQ8 1;  3BG1 B;  1VQO Z;  3S1Q I;  3CC7 Z;  1I50 I;  2HU9 A;  2JR6 A;  2K3R A;  1NUI A;  2R7Z I;  3CC4 Z;  1QVG Z;  3I55 Z;  1KC8 1;  3S14 I;  3OW2 Z;  4NB9 A;  3EER A;  3CC2 1;  1QVF Z;  3CCQ 1;  1VQM Z;  3I07 A;  2HF1 A;  4E32 A;  3GTJ I;  3EED A;  3F3P C;  4E2W A;  2QEX Z;  4A3D I;  1JJ2 Y;  4NBB A;  3NH5 A;  2NVT I;  1YIJ Z;  1VQ5 1;  4NBD A;  3RZO I;  1USP A;  3VMI A;  3CME 1;  1VQ4 1;  1KD1 1;  2JMO A;  2IZ3 A;  4A3J I;  4DK1 A;  2J6A A;  4MRI A;  1VQL Z;  3ESW A;  3U50 C;  4BBS I;  1TWG I;  3P5J B;  4NB8 A;  1R9T I;  1YUK A;  1KC8 2;  1Y1W I;  4XX2 A;  3CCM 1;  3Q87 A;  4A3E I;  3CCL 1;  2E9H A;  1K73 1;  2RIQ A;  3D6W A;  2IZ4 A;  2DE6 A;  3K7A I;  5IT9 f;  4E2X A;  3TDH B;  2E2H I;  3CD6 1;  3I4M I;  1LQL A;  3CCU 1;  2WAQ A;  3KIH A;  3IFU A;  3RZD I;  1Q82 1;  3PO2 I;  3G6E 1;  1KD1 2;  3TE5 B;  3NH8 A;  1RLY A;  1X3W A;  2BJO A;  5FLM I;  3CCV 1;  2OOX B;  3GTQ I;  1N2F A;  3KIF A;  3CCE Z;  1WCM I;  3CCR 1;  5AN9 F;  1K73 2;  2RBL A;  2OTJ Z;  3CPW Y;  2PK7 A;  1YUA A;  2R6M A;  1RO0 A;  4BY1 I;  4MON A;  4AYB A;  3GTO I;  2P3Y A;  4Y52 I;  2Q4Z A;  2EGT A;  2KPI A;  1TWA I;  1YJN 1;  1Q82 2;  1P9N A;  4HH4 A;  1YIT 1;  3S15 I;  3G71 1;  3IX0 A;  1NP6 A;  4QTT A;  4BXX I;  2GU2 A;  2QRE B;  5CM2 M;  2NVQ I;  3FQQ A;  5IT9 b;  2QR1 B;  4MXU A;  4RV9 A;  5A2Q b;  5T67 A;  1ZH1 A;  1VQ7 Z;  2JNY A;  1YHQ 1;  1M90 1;  4NBH A;  4E33 A;  1ML8 A;  2QA4 Z;  4EWC A;  1JWH C;  2VF1 A;  2I3C A;  3HKZ A;  1Y1V S;  4Y7N I;  3I56 1;  2LFU A;  3GTG I;  1DL6 A;  1JJ2 Z;  3G4S 1;  3M3Y I;  3HOU I;  4A3M I;  3MZL B;  3VMG A;  2YU9 I;  1RO4 A;  3CC7 1;  1Q81 1;  4E2Y A;  4X6A I;  1VQ8 Z;  3GTM S;  4DGL A;  3CC4 1;  1L1O C;  3MON A;  4RVG A;  4BBR I;  3I55 1;  2R93 I;  1VQK 1;  2Y0S A;  2RHB A;  2F4O A;  1M90 2;  1VQM 1;  3NDI A;  4RVD A;  5FLX f;  3S16 I;  1S72 Z;  4MD7 A;  2QLV B;  2P28 A;  1Q7Y 2;  2QEX 1;  1M1K 2;  1K83 I;  3GTM I;  2F4M A;  4NFR A;  2V8K A;  3CMA Z;  1Q81 2;  2OZK A;  1VQ5 Z;  1VQP 1;  4RS4 A;  1VQL 1;  1RNI A;  2DE5 A;  3OW2 Y;  3FKI I;  4RVF A;  4TNU A;  2M6N A;  1QVF Y;  5C3E I;  5A2Q f;  5D1O B;  3GCF A;  2W04 A;  1VQN Z;  4DQY B;  1VQ6 Z;  5IP9 I;  3CPW Z;  4E2Z A;  1KQS Z;  3CD6 Z;  4A93 I;  1YJ9 Z;  2E2I I;  2PMZ A;  1W2B Y;  5FLX b;  3CXC Y;  5C4J I;  4NBF A;  2JA5 I;  3D9X A;  3CQZ I;  3J81 f;  5LL6 f;  4BY7 I;  1TWF I;  1WW9 A;  2AKL A;  1Z01 A;  4A3C I;  3CCS Z;  3F3F C;  3CCR Z;  3J80 b;  2OTL Z;  1K8A 2;  3HOX I;  3QWU A;  2NVX I;  3PO3 S;  1YI2 1;  3HOY I;  3S17 I;  2VUG A;  2K5R A;  2GTH A;  1X0T A;  1TWH I;  1VQ9 1;  2O53 A;  1SFO I;  3CCJ 1;  3JAM f;  2YAD A;  4E31 A;  1YIT Z;  3J7A 4;  3G71 Z;  3HOW I;  4MD9 A;  3GTL I;  3VB9 A;  3S1R I;  2JUB A;  2W03 A;  1M1K 1;  1Q7Y 1;  3GTK I;  1N8R 1;  4A3K I;  2QA4 1;  1YJW Z;  2V8I A;  4S1T A;  2H85 A;  2ZAE B;  4NBC A;  1YHQ Z;  4MD8 A;  2RT9 A;  1RQF A;  1PFT A;  2LIY A;  1USP B;  4NBA A;  1VQO 1;  2NVY I;  1NJI 1;  1I3Q I;  3HOV I;  3J81 b;  2M48 A;  3G4S Z;  1Y1V I;  4HGZ A;  2WB1 A;  1Q86 2;  2GTI A;  4CL1 A;  3CC2 Z;  4A3F I;  3FQM A;  3M4O I;  2QKD A;  1VQK Z;  1N8R 2;  3CCQ Z;  1RO2 A;  4E30 A;  1S72 1;  2VUM I;  3H3V J;  3NDJ A;  3MZK B;  1YIJ 1;  1ZB9 A;  3I4N I;  4HGY A;  5C44 I;  2JA8 I;  3J80 f;  5D1P A;  5T64 A;  3JAM b;  3CMA 1;  1NJI 2;  1Z02 A;  3BG0 B;  3T4N B;  3CME Z;  3LUS A;  5IP7 I;  1QVG Y;  1VQ4 Z;  4A3G I;  3NFZ A;  3S1N I;  4A3L I;  3NH4 A;  4A3B I;  2Q51 A;  5T6B A;  2QRD B;  1VQP Z;  4QTU A;  3CCM Z;  1W2B Z;  3CCL Z;  3CXC Z;  2V8J A;  1QYP A;  3IF8 A;  1K8A 1;  3GTP I;  1VQN 1;  2KI7 B;  3H0G I;  2JA7 I;  1VQ6 1;  2DE7 A;  3GKQ A;  1WII A;  4RVH A;  3CCU Z;  4NOZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...