3J81b

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
81
structure length
81
Chain Sequence
VLVQDLLHPTAASEARKHKLKTLVQSPRSHFLDVKCPGCLNITTVFSHAQTAVTCESCSTVLCTPTGGKAKLSEGTSFRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
molecule keywords 18S rRNA
total genus 5
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
b PF01667 Ribosomal_S27e Ribosomal protein S27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.640 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3j81b00
3JAMb 5LL6f 5FLXb 5A2Qb 3J81b 3J80b 3J7A4 5IT9b
chains in the Genus database with same CATH superfamily
1TFIA 3BG0B 2DE5A 3OW2Z 2M48A 3J80b 2LFUA 3S1RI 2NAPA 3Q87A 5FLMI 4E2XA 1QVFZ 3D6WA 3IF8A 2JA6I 5AN9F 3EERA 2OOXB 1W2BZ 3TE5B 4QTUA 1USPB 1SFOI 4A3JI 3MZKB 4MONA 1Y8CA 3CMEZ 2YADA 1Y1VS 3K7AI 1Q822 3GTMI 1M1K2 3FQQA 3HOXI 3CXCY 2AYDA 4NBGA 1YIJ1 1NJI1 4MXUA 2R7ZI 1QVGY 1L1OC 2OTJ1 1YJN1 1VQ9Z 3CMAZ 3NFZA 1K83I 3S16I 4A3KI 1X0TA 3HKZA 3NH4A 1ZB9A 1Q7Y1 2IZ3A 1YJW1 2V45A 4HGZA 4BY1I 5D1OB 3CCEZ 3MONA 1M1K1 2OTJZ 1VQ91 2JR6A 1WJ2A 3H0GI 1YHQ1 1VQK1 1VQ4Z 3LUSA 3GTOI 4RVFA 4TNUA 3D2LA 1RLYA 2VPZA 2HU9A 3I55Z 3CME1 3GTQI 1KQSY 3S1MI 4Y7NI 1NP6A 4NH1C 2OZKA 1SIWA 3J81f 1N8R1 1FDIA 2QA4Z 3PO3I 2P3YA 2R92I 1YUAA 3F3FC 1K732 5C4XI 3VMIA 1YI2Z 2KPIA 1KRLA 1Q821 4NOZA 2E2II 3I551 3J80f 2M6NA 3T4NB 4MH4A 1K8A1 1N2FA 1KC82 4DGLA 1X3WA 1VQ7Z 3G6EZ 1Q861 2R93I 2V3VA 1Q811 1YIT1 2BJOA 1QXFA 3CPWZ 4NBFA 1VQO1 2OOYB 1WW9A 3GTJI 1Z03A 1QVFY 2JNYA 4HH4A 5IT9f 1KD11 3S15I 2E7ZA 3CCSZ 2QLVB 1VQP1 1VQ6Z 4NFRA 2V8KA 5LL6f 1Z02A 4A3LI 2E2HI 2OTL1 3G6E1 2VF1A 1YJ91 3CC21 2NVQI 1S721 2VUGA 4RVDA 1VQNZ 5C4JI 2O4HA 1YIJZ 3JAMb 1VQOZ 4RVHA 3IFUA 3PO2I 3M4OI 3KIHA 2QRCB 2DE6A 1VQPZ 1TWGI 3D9XA 1VQ61 2JS4A 3CCRZ 1Y1WI 1RQFA 2VPXA 2WAQA 3P5JB 1QF8A 4XX2A 3JAMf 1YJ9Z 4MD9A 5CM2M 3I56Z 1WCMI 4BBRI 2GTIA 2PM9A 2JIPA 2JA8I 3CCVZ 5IP7I 2JIRA 2F4OA 1YHQZ 2NVYI 3HOWI 2VPYA 1RO4A 2R6MA 4HGYA 1JJ2Z 2V8JA 1S7MA 2RPRA 3RZDI 3BG1B 2I3CA 2Q51A 2F4MA 5C44I 4DQYB 3RZOI 2W03A 4NBDA 1M901 4NB8A 4RVGA 5A2Qf 3CCJ1 2JMOA 1VQLZ 4BY7I 1ZB8A 2K5RA 1VQN1 1I50I 4DK1A 2LEXA 1FDOA 4Y52I 4E31A 4A3DI 1JWHC 3HOUI 1X3ZA 4A3II 1WZNA 2JUBA 5C3EI 3FQMA 4A3CI 3G4S1 3HOVI 3J81b 4MRIA 1I6HI 4MD7A 3OW2Y 4MD8A 2VUMI 3CCJZ 1VQ5Z 1VQL1 2NVTI 1KC81 3ESWA 1TWAI 2G2KA 3I4NI 3CCQ1 2QKDA 4A3GI 3NDJA 2DE7A 2QR1B 4AYBA 3KIFA 2ZAEB 1K9M2 1N8R2 3CCMZ 2LIYA 5D1PA 2OTLZ 1YJWZ 1QYPA 2KI7B 5D1OA 1S72Z 2RHBA 3CCU1 3CCE1 4NBHA 1Q16A 2QREB 3VB9A 3PO3S 2O53A 3CQZI 3HOZI 4E32A 4BBSI 1QVGZ 1VQ41 1I3QI 2Q4ZA 1W2BY 1R9TI 4E2WA 3S2HI 3QWUA 2PK7A 4E30A 1Q7Y2 4E2YA 4NBAA 3S17I 4RV9A 3GCFA 4EWCA 2E9HA 1VLAA 3CXCZ 4A93I 3CCV1 3GTGI 3VTNA 1K8A2 2GU2A 2QRDB 4BXXI 4A3EI 1ZH1A 1K9M1 3CCM1 2YU9I 2AKLA 3IR7A 5T67A 3I07A 4NBBA 1DL6A 3S1NI 1JJ2Y 3CCUZ 2WB1A 2HF1A 1RO2A 2RBLA 2GTHA 3GTMS 5A2Qb 3G4SZ 2JIMA 4E33A 3CC71 2K3RA 3CC2Z 2RT9A 3H3VJ 5IT9b 2EGTA 3HOYI 5T64A 1VQMZ 3MZLB 3NH5A 1KD12 2JA7I 1TWFI 2QA41 3CCLZ 3I4MI 1NUIA 3CC41 1RNIA 3U50C 1PFTA 3S14I 1USPA 1VQ81 1Y1VI 2H85A 1TWHI 1YUKA 3NH8A 2IZ4A 2QEX1 4NBEA 3GTKI 3M3YI 1VQ71 1P9NA 4E2ZA 5FLXb 1VQM1 3I561 1YITZ 2IV2X 1RO0A 3G711 1K731 1YJNZ 1M902 4A3MI 3CCS1 3GTPI 2B63I 3CD61 3TDHB 2RIQA 2QEXZ 3EEDA 4A3BI 3IX0A 1Q812 3VMHA 3VMGA 3GTLI 3CC7Z 4A3FI 4QTTA 3S1QI 3FKII 4S1TA 1WIIA 2NVXI 4NB9A 1AA6A 3CD6Z 3CCL1 1VQKZ 3CCR1 1TWCI 2Y0SA 2JIOA 1KQSZ 2E2JI 5FLXf 3CC4Z 3S2DI 3CPWY 3GKQA 1VQ8Z 1ML8A 2J6AA 5T6BA 3J7A4 4X6AI 5IP9I 3NDIA 1VQ51 1LQLA 2W04A 4RS4A 1Q862 3CCQZ 2VPWA 3CMA1 3G71Z 4CL1A 1Z01A 3F3PC 1NJI2 2JA5I 1YI21 2P28A 2V8IA 2PMZA 2JIQA 4NBCA
chains in the Genus database with same CATH topology
1TFIA 3BG0B 2DE5A 3OW2Z 2M48A 3J80b 2LFUA 3S1RI 3Q87A 5FLMI 4E2XA 1QVFZ 3D6WA 3IF8A 2JA6I 5AN9F 3EERA 2OOXB 1W2BZ 3TE5B 4QTUA 1USPB 1SFOI 4A3JI 3MZKB 4MONA 3CMEZ 2YADA 1Y1VS 3K7AI 1Q822 3GTMI 1M1K2 3FQQA 3HOXI 3CXCY 4NBGA 1YIJ1 1NJI1 4MXUA 2R7ZI 1QVGY 1L1OC 2OTJ1 1YJN1 1VQ9Z 3CMAZ 3NFZA 1K83I 3S16I 4A3KI 1X0TA 3HKZA 3NH4A 1ZB9A 1Q7Y1 2IZ3A 1YJW1 4HGZA 4BY1I 5D1OB 3CCEZ 3MONA 1M1K1 2OTJZ 1VQ91 2JR6A 3H0GI 1YHQ1 1VQK1 1VQ4Z 3LUSA 3GTOI 4RVFA 4TNUA 1RLYA 2HU9A 3I55Z 3CME1 3GTQI 1KQSY 3S1MI 4Y7NI 1NP6A 4NH1C 2OZKA 3J81f 1N8R1 2QA4Z 3PO3I 2P3YA 2R92I 1YUAA 3F3FC 1K732 5C4XI 3VMIA 1YI2Z 2KPIA 1KRLA 1Q821 4NOZA 2E2II 3I551 3J80f 2M6NA 3T4NB 4MH4A 1K8A1 1N2FA 1KC82 4DGLA 1X3WA 1VQ7Z 3G6EZ 1Q861 2R93I 1Q811 1YIT1 2BJOA 3CPWZ 4NBFA 1VQO1 2OOYB 1WW9A 3GTJI 1Z03A 1QVFY 2JNYA 4HH4A 5IT9f 1KD11 3S15I 3CCSZ 2QLVB 1VQP1 1VQ6Z 4NFRA 2V8KA 5LL6f 1Z02A 4A3LI 2E2HI 2OTL1 3G6E1 2VF1A 1YJ91 3CC21 2NVQI 1S721 2VUGA 4RVDA 1VQNZ 5C4JI 2O4HA 1YIJZ 3JAMb 1VQOZ 4RVHA 3IFUA 3PO2I 3M4OI 3KIHA 2QRCB 2DE6A 1VQPZ 1TWGI 3D9XA 1VQ61 2JS4A 3CCRZ 1Y1WI 1RQFA 2WAQA 3P5JB 1QF8A 4XX2A 3JAMf 1YJ9Z 4MD9A 5CM2M 3I56Z 1WCMI 4BBRI 2GTIA 2PM9A 2JA8I 3CCVZ 5IP7I 2F4OA 1YHQZ 2NVYI 3HOWI 1RO4A 2R6MA 4HGYA 1JJ2Z 2V8JA 1S7MA 2RPRA 3RZDI 3BG1B 2I3CA 2Q51A 2F4MA 5C44I 4DQYB 3RZOI 2W03A 4NBDA 1M901 4NB8A 4RVGA 5A2Qf 3CCJ1 2JMOA 1VQLZ 4BY7I 1ZB8A 2K5RA 1VQN1 1I50I 4DK1A 4Y52I 4E31A 4A3DI 1JWHC 3HOUI 1X3ZA 4A3II 2JUBA 5C3EI 3FQMA 4A3CI 3G4S1 3HOVI 3J81b 4MRIA 1I6HI 4MD7A 3OW2Y 4MD8A 2VUMI 3CCJZ 1VQ5Z 1VQL1 2NVTI 1KC81 3ESWA 1TWAI 2G2KA 3I4NI 3CCQ1 2QKDA 4A3GI 3NDJA 2DE7A 2QR1B 4AYBA 3KIFA 2ZAEB 1K9M2 1N8R2 3CCMZ 2LIYA 5D1PA 2OTLZ 1YJWZ 1QYPA 2KI7B 5D1OA 1S72Z 2RHBA 3CCU1 3CCE1 4NBHA 2QREB 3VB9A 3PO3S 2O53A 3CQZI 3HOZI 4E32A 4BBSI 1QVGZ 1VQ41 1I3QI 2Q4ZA 1W2BY 1R9TI 4E2WA 3S2HI 3QWUA 2PK7A 4E30A 1Q7Y2 4E2YA 4NBAA 3S17I 4RV9A 3GCFA 4EWCA 2E9HA 1VLAA 3CXCZ 4A93I 3CCV1 3GTGI 3VTNA 1K8A2 2GU2A 2QRDB 4BXXI 4A3EI 1ZH1A 1K9M1 3CCM1 2YU9I 2AKLA 5T67A 3I07A 4NBBA 1DL6A 3S1NI 1JJ2Y 3CCUZ 2WB1A 2HF1A 1RO2A 2RBLA 2GTHA 3GTMS 5A2Qb 3G4SZ 4E33A 3CC71 2K3RA 3CC2Z 2RT9A 3H3VJ 5IT9b 2EGTA 3HOYI 5T64A 1VQMZ 3MZLB 3NH5A 1KD12 2JA7I 1TWFI 2QA41 3CCLZ 3I4MI 1NUIA 3CC41 1RNIA 3U50C 1PFTA 3S14I 1USPA 1VQ81 1Y1VI 2H85A 1TWHI 1YUKA 3NH8A 2IZ4A 2QEX1 4NBEA 3GTKI 3M3YI 1VQ71 1P9NA 4E2ZA 5FLXb 1VQM1 3I561 1YITZ 1RO0A 3G711 1K731 1YJNZ 1M902 4A3MI 3CCS1 3GTPI 2B63I 3CD61 3TDHB 2RIQA 2QEXZ 3EEDA 4A3BI 3IX0A 1Q812 3VMHA 3VMGA 3GTLI 3CC7Z 4A3FI 4QTTA 3S1QI 3FKII 4S1TA 1WIIA 2NVXI 4NB9A 3CD6Z 3CCL1 1VQKZ 3CCR1 1TWCI 2Y0SA 1KQSZ 2E2JI 5FLXf 3CC4Z 3S2DI 3CPWY 3GKQA 1VQ8Z 1ML8A 2J6AA 5T6BA 3J7A4 4X6AI 5IP9I 3NDIA 1VQ51 1LQLA 2W04A 4RS4A 1Q862 3CCQZ 3CMA1 3G71Z 4CL1A 1Z01A 3F3PC 1NJI2 2JA5I 1YI21 2P28A 2V8IA 2PMZA 4NBCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAM b;  5LL6 f;  5FLX b;  5A2Q b;  3J81 b;  3J80 b;  3J7A 4;  5IT9 b; 
#chains in the Genus database with same CATH topology
 1TFI A;  3BG0 B;  2DE5 A;  3OW2 Z;  2M48 A;  3J80 b;  2LFU A;  3S1R I;  2NAP A;  3Q87 A;  5FLM I;  4E2X A;  1QVF Z;  3D6W A;  3IF8 A;  2JA6 I;  5AN9 F;  3EER A;  2OOX B;  1W2B Z;  3TE5 B;  4QTU A;  1USP B;  1SFO I;  4A3J I;  3MZK B;  4MON A;  1Y8C A;  3CME Z;  2YAD A;  1Y1V S;  3K7A I;  1Q82 2;  3GTM I;  1M1K 2;  3FQQ A;  3HOX I;  3CXC Y;  2AYD A;  4NBG A;  1YIJ 1;  1NJI 1;  4MXU A;  2R7Z I;  1QVG Y;  1L1O C;  2OTJ 1;  1YJN 1;  1VQ9 Z;  3CMA Z;  3NFZ A;  1K83 I;  3S16 I;  4A3K I;  1X0T A;  3HKZ A;  3NH4 A;  1ZB9 A;  1Q7Y 1;  2IZ3 A;  1YJW 1;  2V45 A;  4HGZ A;  4BY1 I;  5D1O B;  3CCE Z;  3MON A;  1M1K 1;  2OTJ Z;  1VQ9 1;  2JR6 A;  1WJ2 A;  3H0G I;  1YHQ 1;  1VQK 1;  1VQ4 Z;  3LUS A;  3GTO I;  4RVF A;  4TNU A;  3D2L A;  1RLY A;  2VPZ A;  2HU9 A;  3I55 Z;  3CME 1;  3GTQ I;  1KQS Y;  3S1M I;  4Y7N I;  1NP6 A;  4NH1 C;  2OZK A;  1SIW A;  3J81 f;  1N8R 1;  1FDI A;  2QA4 Z;  3PO3 I;  2P3Y A;  2R92 I;  1YUA A;  3F3F C;  1K73 2;  5C4X I;  3VMI A;  1YI2 Z;  2KPI A;  1KRL A;  1Q82 1;  4NOZ A;  2E2I I;  3I55 1;  3J80 f;  2M6N A;  3T4N B;  4MH4 A;  1K8A 1;  1N2F A;  1KC8 2;  4DGL A;  1X3W A;  1VQ7 Z;  3G6E Z;  1Q86 1;  2R93 I;  2V3V A;  1Q81 1;  1YIT 1;  2BJO A;  1QXF A;  3CPW Z;  4NBF A;  1VQO 1;  2OOY B;  1WW9 A;  3GTJ I;  1Z03 A;  1QVF Y;  2JNY A;  4HH4 A;  5IT9 f;  1KD1 1;  3S15 I;  2E7Z A;  3CCS Z;  2QLV B;  1VQP 1;  1VQ6 Z;  4NFR A;  2V8K A;  5LL6 f;  1Z02 A;  4A3L I;  2E2H I;  2OTL 1;  3G6E 1;  2VF1 A;  1YJ9 1;  3CC2 1;  2NVQ I;  1S72 1;  2VUG A;  4RVD A;  1VQN Z;  5C4J I;  2O4H A;  1YIJ Z;  3JAM b;  1VQO Z;  4RVH A;  3IFU A;  3PO2 I;  3M4O I;  3KIH A;  2QRC B;  2DE6 A;  1VQP Z;  1TWG I;  3D9X A;  1VQ6 1;  2JS4 A;  3CCR Z;  1Y1W I;  1RQF A;  2VPX A;  2WAQ A;  3P5J B;  1QF8 A;  4XX2 A;  3JAM f;  1YJ9 Z;  4MD9 A;  5CM2 M;  3I56 Z;  1WCM I;  4BBR I;  2GTI A;  2PM9 A;  2JIP A;  2JA8 I;  3CCV Z;  5IP7 I;  2JIR A;  2F4O A;  1YHQ Z;  2NVY I;  3HOW I;  2VPY A;  1RO4 A;  2R6M A;  4HGY A;  1JJ2 Z;  2V8J A;  1S7M A;  2RPR A;  3RZD I;  3BG1 B;  2I3C A;  2Q51 A;  2F4M A;  5C44 I;  4DQY B;  3RZO I;  2W03 A;  4NBD A;  1M90 1;  4NB8 A;  4RVG A;  5A2Q f;  3CCJ 1;  2JMO A;  1VQL Z;  4BY7 I;  1ZB8 A;  2K5R A;  1VQN 1;  1I50 I;  4DK1 A;  2LEX A;  1FDO A;  4Y52 I;  4E31 A;  4A3D I;  1JWH C;  3HOU I;  1X3Z A;  4A3I I;  1WZN A;  2JUB A;  5C3E I;  3FQM A;  4A3C I;  3G4S 1;  3HOV I;  3J81 b;  4MRI A;  1I6H I;  4MD7 A;  3OW2 Y;  4MD8 A;  2VUM I;  3CCJ Z;  1VQ5 Z;  1VQL 1;  2NVT I;  1KC8 1;  3ESW A;  1TWA I;  2G2K A;  3I4N I;  3CCQ 1;  2QKD A;  4A3G I;  3NDJ A;  2DE7 A;  2QR1 B;  4AYB A;  3KIF A;  2ZAE B;  1K9M 2;  1N8R 2;  3CCM Z;  2LIY A;  5D1P A;  2OTL Z;  1YJW Z;  1QYP A;  2KI7 B;  5D1O A;  1S72 Z;  2RHB A;  3CCU 1;  3CCE 1;  4NBH A;  1Q16 A;  2QRE B;  3VB9 A;  3PO3 S;  2O53 A;  3CQZ I;  3HOZ I;  4E32 A;  4BBS I;  1QVG Z;  1VQ4 1;  1I3Q I;  2Q4Z A;  1W2B Y;  1R9T I;  4E2W A;  3S2H I;  3QWU A;  2PK7 A;  4E30 A;  1Q7Y 2;  4E2Y A;  4NBA A;  3S17 I;  4RV9 A;  3GCF A;  4EWC A;  2E9H A;  1VLA A;  3CXC Z;  4A93 I;  3CCV 1;  3GTG I;  3VTN A;  1K8A 2;  2GU2 A;  2QRD B;  4BXX I;  4A3E I;  1ZH1 A;  1K9M 1;  3CCM 1;  2YU9 I;  2AKL A;  3IR7 A;  5T67 A;  3I07 A;  4NBB A;  1DL6 A;  3S1N I;  1JJ2 Y;  3CCU Z;  2WB1 A;  2HF1 A;  1RO2 A;  2RBL A;  2GTH A;  3GTM S;  5A2Q b;  3G4S Z;  2JIM A;  4E33 A;  3CC7 1;  2K3R A;  3CC2 Z;  2RT9 A;  3H3V J;  5IT9 b;  2EGT A;  3HOY I;  5T64 A;  1VQM Z;  3MZL B;  3NH5 A;  1KD1 2;  2JA7 I;  1TWF I;  2QA4 1;  3CCL Z;  3I4M I;  1NUI A;  3CC4 1;  1RNI A;  3U50 C;  1PFT A;  3S14 I;  1USP A;  1VQ8 1;  1Y1V I;  2H85 A;  1TWH I;  1YUK A;  3NH8 A;  2IZ4 A;  2QEX 1;  4NBE A;  3GTK I;  3M3Y I;  1VQ7 1;  1P9N A;  4E2Z A;  5FLX b;  1VQM 1;  3I56 1;  1YIT Z;  2IV2 X;  1RO0 A;  3G71 1;  1K73 1;  1YJN Z;  1M90 2;  4A3M I;  3CCS 1;  3GTP I;  2B63 I;  3CD6 1;  3TDH B;  2RIQ A;  2QEX Z;  3EED A;  4A3B I;  3IX0 A;  1Q81 2;  3VMH A;  3VMG A;  3GTL I;  3CC7 Z;  4A3F I;  4QTT A;  3S1Q I;  3FKI I;  4S1T A;  1WII A;  2NVX I;  4NB9 A;  1AA6 A;  3CD6 Z;  3CCL 1;  1VQK Z;  3CCR 1;  1TWC I;  2Y0S A;  2JIO A;  1KQS Z;  2E2J I;  5FLX f;  3CC4 Z;  3S2D I;  3CPW Y;  3GKQ A;  1VQ8 Z;  1ML8 A;  2J6A A;  5T6B A;  3J7A 4;  4X6A I;  5IP9 I;  3NDI A;  1VQ5 1;  1LQL A;  2W04 A;  4RS4 A;  1Q86 2;  3CCQ Z;  2VPW A;  3CMA 1;  3G71 Z;  4CL1 A;  1Z01 A;  3F3P C;  1NJI 2;  2JA5 I;  1YI2 1;  2P28 A;  2V8I A;  2PMZ A;  2JIQ A;  4NBC A; 
#chains in the Genus database with same CATH homology
 1TFI A;  3BG0 B;  2DE5 A;  3OW2 Z;  2M48 A;  3J80 b;  2LFU A;  3S1R I;  3Q87 A;  5FLM I;  4E2X A;  1QVF Z;  3D6W A;  3IF8 A;  2JA6 I;  5AN9 F;  3EER A;  2OOX B;  1W2B Z;  3TE5 B;  4QTU A;  1USP B;  1SFO I;  4A3J I;  3MZK B;  4MON A;  3CME Z;  2YAD A;  1Y1V S;  3K7A I;  1Q82 2;  3GTM I;  1M1K 2;  3FQQ A;  3HOX I;  3CXC Y;  4NBG A;  1YIJ 1;  1NJI 1;  4MXU A;  2R7Z I;  1QVG Y;  1L1O C;  2OTJ 1;  1YJN 1;  1VQ9 Z;  3CMA Z;  3NFZ A;  1K83 I;  3S16 I;  4A3K I;  1X0T A;  3HKZ A;  3NH4 A;  1ZB9 A;  1Q7Y 1;  2IZ3 A;  1YJW 1;  4HGZ A;  4BY1 I;  5D1O B;  3CCE Z;  3MON A;  1M1K 1;  2OTJ Z;  1VQ9 1;  2JR6 A;  3H0G I;  1YHQ 1;  1VQK 1;  1VQ4 Z;  3LUS A;  3GTO I;  4RVF A;  4TNU A;  1RLY A;  2HU9 A;  3I55 Z;  3CME 1;  3GTQ I;  1KQS Y;  3S1M I;  4Y7N I;  1NP6 A;  4NH1 C;  2OZK A;  3J81 f;  1N8R 1;  2QA4 Z;  3PO3 I;  2P3Y A;  2R92 I;  1YUA A;  3F3F C;  1K73 2;  5C4X I;  3VMI A;  1YI2 Z;  2KPI A;  1KRL A;  1Q82 1;  4NOZ A;  2E2I I;  3I55 1;  3J80 f;  2M6N A;  3T4N B;  4MH4 A;  1K8A 1;  1N2F A;  1KC8 2;  4DGL A;  1X3W A;  1VQ7 Z;  3G6E Z;  1Q86 1;  2R93 I;  1Q81 1;  1YIT 1;  2BJO A;  3CPW Z;  4NBF A;  1VQO 1;  2OOY B;  1WW9 A;  3GTJ I;  1Z03 A;  1QVF Y;  2JNY A;  4HH4 A;  5IT9 f;  1KD1 1;  3S15 I;  3CCS Z;  2QLV B;  1VQP 1;  1VQ6 Z;  4NFR A;  2V8K A;  5LL6 f;  1Z02 A;  4A3L I;  2E2H I;  2OTL 1;  3G6E 1;  2VF1 A;  1YJ9 1;  3CC2 1;  2NVQ I;  1S72 1;  2VUG A;  4RVD A;  1VQN Z;  5C4J I;  2O4H A;  1YIJ Z;  3JAM b;  1VQO Z;  4RVH A;  3IFU A;  3PO2 I;  3M4O I;  3KIH A;  2QRC B;  2DE6 A;  1VQP Z;  1TWG I;  3D9X A;  1VQ6 1;  2JS4 A;  3CCR Z;  1Y1W I;  1RQF A;  2WAQ A;  3P5J B;  1QF8 A;  4XX2 A;  3JAM f;  1YJ9 Z;  4MD9 A;  5CM2 M;  3I56 Z;  1WCM I;  4BBR I;  2GTI A;  2PM9 A;  2JA8 I;  3CCV Z;  5IP7 I;  2F4O A;  1YHQ Z;  2NVY I;  3HOW I;  1RO4 A;  2R6M A;  4HGY A;  1JJ2 Z;  2V8J A;  1S7M A;  2RPR A;  3RZD I;  3BG1 B;  2I3C A;  2Q51 A;  2F4M A;  5C44 I;  4DQY B;  3RZO I;  2W03 A;  4NBD A;  1M90 1;  4NB8 A;  4RVG A;  5A2Q f;  3CCJ 1;  2JMO A;  1VQL Z;  4BY7 I;  1ZB8 A;  2K5R A;  1VQN 1;  1I50 I;  4DK1 A;  4Y52 I;  4E31 A;  4A3D I;  1JWH C;  3HOU I;  1X3Z A;  4A3I I;  2JUB A;  5C3E I;  3FQM A;  4A3C I;  3G4S 1;  3HOV I;  3J81 b;  4MRI A;  1I6H I;  4MD7 A;  3OW2 Y;  4MD8 A;  2VUM I;  3CCJ Z;  1VQ5 Z;  1VQL 1;  2NVT I;  1KC8 1;  3ESW A;  1TWA I;  2G2K A;  3I4N I;  3CCQ 1;  2QKD A;  4A3G I;  3NDJ A;  2DE7 A;  2QR1 B;  4AYB A;  3KIF A;  2ZAE B;  1K9M 2;  1N8R 2;  3CCM Z;  2LIY A;  5D1P A;  2OTL Z;  1YJW Z;  1QYP A;  2KI7 B;  5D1O A;  1S72 Z;  2RHB A;  3CCU 1;  3CCE 1;  4NBH A;  2QRE B;  3VB9 A;  3PO3 S;  2O53 A;  3CQZ I;  3HOZ I;  4E32 A;  4BBS I;  1QVG Z;  1VQ4 1;  1I3Q I;  2Q4Z A;  1W2B Y;  1R9T I;  4E2W A;  3S2H I;  3QWU A;  2PK7 A;  4E30 A;  1Q7Y 2;  4E2Y A;  4NBA A;  3S17 I;  4RV9 A;  3GCF A;  4EWC A;  2E9H A;  1VLA A;  3CXC Z;  4A93 I;  3CCV 1;  3GTG I;  3VTN A;  1K8A 2;  2GU2 A;  2QRD B;  4BXX I;  4A3E I;  1ZH1 A;  1K9M 1;  3CCM 1;  2YU9 I;  2AKL A;  5T67 A;  3I07 A;  4NBB A;  1DL6 A;  3S1N I;  1JJ2 Y;  3CCU Z;  2WB1 A;  2HF1 A;  1RO2 A;  2RBL A;  2GTH A;  3GTM S;  5A2Q b;  3G4S Z;  4E33 A;  3CC7 1;  2K3R A;  3CC2 Z;  2RT9 A;  3H3V J;  5IT9 b;  2EGT A;  3HOY I;  5T64 A;  1VQM Z;  3MZL B;  3NH5 A;  1KD1 2;  2JA7 I;  1TWF I;  2QA4 1;  3CCL Z;  3I4M I;  1NUI A;  3CC4 1;  1RNI A;  3U50 C;  1PFT A;  3S14 I;  1USP A;  1VQ8 1;  1Y1V I;  2H85 A;  1TWH I;  1YUK A;  3NH8 A;  2IZ4 A;  2QEX 1;  4NBE A;  3GTK I;  3M3Y I;  1VQ7 1;  1P9N A;  4E2Z A;  5FLX b;  1VQM 1;  3I56 1;  1YIT Z;  1RO0 A;  3G71 1;  1K73 1;  1YJN Z;  1M90 2;  4A3M I;  3CCS 1;  3GTP I;  2B63 I;  3CD6 1;  3TDH B;  2RIQ A;  2QEX Z;  3EED A;  4A3B I;  3IX0 A;  1Q81 2;  3VMH A;  3VMG A;  3GTL I;  3CC7 Z;  4A3F I;  4QTT A;  3S1Q I;  3FKI I;  4S1T A;  1WII A;  2NVX I;  4NB9 A;  3CD6 Z;  3CCL 1;  1VQK Z;  3CCR 1;  1TWC I;  2Y0S A;  1KQS Z;  2E2J I;  5FLX f;  3CC4 Z;  3S2D I;  3CPW Y;  3GKQ A;  1VQ8 Z;  1ML8 A;  2J6A A;  5T6B A;  3J7A 4;  4X6A I;  5IP9 I;  3NDI A;  1VQ5 1;  1LQL A;  2W04 A;  4RS4 A;  1Q86 2;  3CCQ Z;  3CMA 1;  3G71 Z;  4CL1 A;  1Z01 A;  3F3P C;  1NJI 2;  2JA5 I;  1YI2 1;  2P28 A;  2V8I A;  2PMZ A;  4NBC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...