3J81b

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
81
structure length
81
Chain Sequence
VLVQDLLHPTAASEARKHKLKTLVQSPRSHFLDVKCPGCLNITTVFSHAQTAVTCESCSTVLCTPTGGKAKLSEGTSFRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 5
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
b PF01667 Ribosomal_S27e Ribosomal protein S27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.640 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3j81b00
5A2Qb 3J7A4 5IT9b 5FLXb 3JAMb 5LL6f 3J80b 3J81b
chains in the Genus database with same CATH superfamily
1KD12 2JA7I 3QWUA 1ZB8A 1AA6A 3CCEZ 1YIJZ 2RT9A 1YUAA 1JJ2Z 1VQL1 3I07A 5FLMI 3H3VJ 3J81f 2JS4A 3CCL1 1TWAI 3NDIA 2QA41 4NBFA 1JJ2Y 1YHQZ 2IZ3A 5FLXb 3JAMb 1Z02A 5CM2M 4NBGA 1P9NA 1K9M2 1Q821 2W03A 3HOVI 1X3WA 4BBRI 2R93I 1ML8A 1NJI1 2KI7B 1VQ5Z 4A93I 1K731 5IP9I 1VQ9Z 1VQP1 2W04A 4BY1I 2QLVB 3GTKI 2QEXZ 5A2Qb 1Q822 2E2HI 4NBCA 1YITZ 1NJI2 1R9TI 1K732 2LIYA 3CCV1 1TWCI 1RLYA 1TFIA 3MZLB 1VQ7Z 2NVQI 4A3CI 3FQQA 2OTLZ 1Q7Y1 1KC82 2YU9I 3J81b 1X0TA 2O53A 3G6EZ 2V45A 3BG1B 5T64A 1TWHI 4A3EI 4RVHA 4S1TA 1VQO1 1USPB 3I551 3I4MI 4RVGA 2OTJ1 2V8IA 1Z01A 2IZ4A 3BG0B 5C4XI 2WB1A 4DK1A 1S721 2IV2X 1YJ91 3CCS1 3VMHA 3S1NI 2GTIA 3GTMI 1S7MA 4NBHA 1NP6A 1FDIA 3CD61 3VMGA 2NVYI 4MXUA 2M48A 3IF8A 2RBLA 3GTQI 2G2KA 3EERA 3FKII 1YI2Z 1M902 1WW9A 3LUSA 4NBEA 3S15I 2H85A 3PO2I 5FLXf 2V8KA 2V8JA 2E9HA 2Y0SA 4HGYA 3CCQ1 3J7A4 1I6HI 1W2BZ 3CPWZ 1QVGY 5A2Qf 4E2ZA 2RHBA 2O4HA 3K7AI 4NBBA 1VQN1 5D1PA 1YJWZ 3NH5A 1VQ6Z 2JIRA 3CME1 3CCR1 1QVFZ 3G71Z 2HF1A 3PO3I 5D1OA 1ZH1A 2JNYA 3MONA 1K9M1 3M3YI 3HOZI 3CCJZ 3GTPI 1Y1VI 3ESWA 1VQMZ 2VPXA 1QVFY 4RVDA 1YUKA 1QF8A 4NBAA 5C44I 3CC4Z 2E2II 2JIPA 3M4OI 2K5RA 3TE5B 4RV9A 4E2YA 3D9XA 3CMAZ 2JMOA 2PMZA 3CCMZ 4MD7A 4MD9A 4HGZA 4A3BI 1I50I 1VQKZ 3CCE1 3T4NB 1YIJ1 3KIFA 3U50C 4NH1C 2M6NA 2F4MA 2NAPA 2AKLA 2P28A 1K83I 2JIMA 1Y1VS 3GTGI 1KC81 4MONA 3TDHB 1M1K2 1RQFA 3F3PC 3CC7Z 1YHQ1 1L1OC 3FQMA 1N8R2 1LQLA 2E7ZA 3HOUI 1VQ4Z 2QRDB 1VQ51 1RO2A 1VQ91 1PFTA 2QEX1 2VUMI 1Q16A 2K3RA 4A3MI 1YIT1 4DGLA 4Y7NI 4BY7I 2QREB 3NH4A 3I56Z 4DQYB 3GKQA 3HOXI 1VQ71 4XX2A 1M901 2OTL1 4QTTA 2NVXI 5C3EI 4A3GI 3G6E1 4AYBA 3D6WA 4MRIA 1USPA 3J80b 3G4SZ 4CL1A 1VQ8Z 2OZKA 4BXXI 2JIQA 2KPIA 3GTLI 2HU9A 3CC2Z 3EEDA 2QRCB 1QYPA 3CCUZ 1YJNZ 1FDOA 3S17I 2JA5I 2JA8I 4A3II 3OW2Z 3GTMS 4A3DI 5C4JI 2I3CA 1WIIA 3IR7A 2JR6A 1W2BY 3CPWY 3RZDI 2JUBA 2RIQA 5T67A 4E32A 1TWFI 2PM9A 1YI21 1VQLZ 1TWGI 2QKDA 4MD8A 2VUGA 5D1OB 3S2DI 3CCLZ 3S16I 1WJ2A 1N2FA 2QA4Z 3GTJI 3IFUA 2VPZA 3GCFA 3NH8A 4E2XA 1WCMI 2R6MA 4RS4A 3VB9A 4BBSI 4E2WA 2JA6I 3CXCZ 1VQPZ 3CXCY 2YADA 1RNIA 2E2JI 1YJW1 2Q51A 1M1K1 1VQ61 3CQZI 3CCVZ 3HOWI 1QXFA 2R92I 3S1QI 2V3VA 2DE7A 3G711 3PO3S 3D2LA 1N8R1 4X6AI 4NB8A 2BJOA 1DL6A 3CCJ1 4HH4A 3S1RI 1RO4A 1VQM1 2VPWA 3MZKB 3CC41 2EGTA 3J80f 2DE5A 4NFRA 3S14I 1KRLA 2OOXB 2P3YA 3NFZA 3CMA1 4Y52I 2AYDA 5T6BA 4E31A 1Y1WI 1Q861 5IT9b 3CCM1 1JWHC 1VQOZ 3I55Z 1Y8CA 4A3KI 2NVTI 2OTJZ 1Z03A 5IP7I 2F4OA 1VQK1 2Q4ZA 4RVFA 4TNUA 4NOZA 1S72Z 3HKZA 1Q862 1YJ9Z 3CCSZ 2R7ZI 3NDJA 3KIHA 3H0GI 3CD6Z 3CC71 4QTUA 2ZAEB 2VF1A 2OOYB 1SFOI 1NUIA 3F3FC 3VTNA 2WAQA 4NB9A 4EWCA 1VQ41 5AN9F 2GU2A 3S1MI 1K8A1 1WZNA 2RPRA 1Q7Y2 3I4NI 1ZB9A 4A3LI 2GTHA 1K8A2 3CCQZ 2LFUA 2VPYA 3I561 1Q811 3VMIA 1I3QI 4E30A 2DE6A 1VLAA 1VQNZ 3HOYI 1SIWA 2J6AA 2LEXA 3OW2Y 4E33A 2QR1B 1Q812 4A3JI 4NBDA 3Q87A 3CMEZ 3JAMf 3CCRZ 3G4S1 1QVGZ 1VQ81 3S2HI 2JIOA 2B63I 1KQSZ 3CC21 1KD11 4MH4A 4A3FI 3CCU1 3IX0A 5LL6f 3GTOI 1YJN1 1RO0A 2PK7A 1KQSY 3P5JB 3RZOI 5IT9f 1X3ZA
chains in the Genus database with same CATH topology
1KD12 2JA7I 3QWUA 1ZB8A 3CCEZ 1YIJZ 2RT9A 1YUAA 1JJ2Z 1VQL1 3I07A 5FLMI 3H3VJ 3J81f 2JS4A 3CCL1 1TWAI 3NDIA 2QA41 4NBFA 1JJ2Y 1YHQZ 2IZ3A 5FLXb 3JAMb 1Z02A 5CM2M 4NBGA 1P9NA 1K9M2 1Q821 2W03A 3HOVI 1X3WA 4BBRI 2R93I 1ML8A 1NJI1 2KI7B 1VQ5Z 4A93I 1K731 5IP9I 1VQ9Z 1VQP1 2W04A 4BY1I 2QLVB 3GTKI 2QEXZ 5A2Qb 1Q822 2E2HI 4NBCA 1YITZ 1NJI2 1R9TI 1K732 2LIYA 3CCV1 1TWCI 1RLYA 1TFIA 3MZLB 1VQ7Z 2NVQI 4A3CI 3FQQA 2OTLZ 1Q7Y1 1KC82 2YU9I 3J81b 1X0TA 2O53A 3G6EZ 3BG1B 5T64A 1TWHI 4A3EI 4RVHA 4S1TA 1VQO1 1USPB 3I551 3I4MI 4RVGA 2OTJ1 2V8IA 1Z01A 2IZ4A 3BG0B 5C4XI 2WB1A 4DK1A 1S721 1YJ91 3CCS1 3VMHA 3S1NI 2GTIA 3GTMI 1S7MA 4NBHA 1NP6A 3CD61 3VMGA 2NVYI 4MXUA 2M48A 3IF8A 2RBLA 3GTQI 2G2KA 3EERA 3FKII 1YI2Z 1M902 1WW9A 3LUSA 4NBEA 3S15I 2H85A 3PO2I 5FLXf 2V8KA 2V8JA 2E9HA 2Y0SA 4HGYA 3CCQ1 3J7A4 1I6HI 1W2BZ 3CPWZ 1QVGY 5A2Qf 4E2ZA 2RHBA 2O4HA 3K7AI 4NBBA 1VQN1 5D1PA 1YJWZ 3NH5A 1VQ6Z 3CME1 3CCR1 1QVFZ 3G71Z 2HF1A 3PO3I 5D1OA 1ZH1A 2JNYA 3MONA 1K9M1 3M3YI 3HOZI 3CCJZ 3GTPI 1Y1VI 3ESWA 1VQMZ 1QVFY 4RVDA 1YUKA 1QF8A 4NBAA 5C44I 3CC4Z 2E2II 3M4OI 2K5RA 3TE5B 4RV9A 4E2YA 3D9XA 3CMAZ 2JMOA 2PMZA 3CCMZ 4MD7A 4MD9A 4HGZA 4A3BI 1I50I 1VQKZ 3CCE1 3T4NB 1YIJ1 3KIFA 3U50C 4NH1C 2M6NA 2F4MA 2AKLA 2P28A 1K83I 1Y1VS 3GTGI 1KC81 4MONA 3TDHB 1M1K2 1RQFA 3F3PC 3CC7Z 1YHQ1 1L1OC 3FQMA 1N8R2 1LQLA 3HOUI 1VQ4Z 2QRDB 1VQ51 1RO2A 1VQ91 1PFTA 2QEX1 2VUMI 2K3RA 4A3MI 1YIT1 4DGLA 4Y7NI 4BY7I 2QREB 3NH4A 3I56Z 4DQYB 3GKQA 3HOXI 1VQ71 4XX2A 1M901 2OTL1 4QTTA 2NVXI 5C3EI 4A3GI 3G6E1 4AYBA 3D6WA 4MRIA 1USPA 3J80b 3G4SZ 4CL1A 1VQ8Z 2OZKA 4BXXI 2KPIA 3GTLI 2HU9A 3CC2Z 3EEDA 2QRCB 1QYPA 3CCUZ 1YJNZ 3S17I 2JA5I 2JA8I 4A3II 3OW2Z 3GTMS 4A3DI 5C4JI 2I3CA 1WIIA 2JR6A 1W2BY 3CPWY 3RZDI 2JUBA 2RIQA 5T67A 4E32A 1TWFI 2PM9A 1YI21 1VQLZ 1TWGI 2QKDA 4MD8A 2VUGA 5D1OB 3S2DI 3CCLZ 3S16I 1N2FA 2QA4Z 3GTJI 3IFUA 3GCFA 3NH8A 4E2XA 1WCMI 2R6MA 4RS4A 3VB9A 4BBSI 4E2WA 2JA6I 3CXCZ 1VQPZ 3CXCY 2YADA 1RNIA 2E2JI 1YJW1 2Q51A 1M1K1 1VQ61 3CQZI 3CCVZ 3HOWI 2R92I 3S1QI 2DE7A 3G711 3PO3S 1N8R1 4X6AI 4NB8A 2BJOA 1DL6A 3CCJ1 4HH4A 3S1RI 1RO4A 1VQM1 3MZKB 3CC41 2EGTA 3J80f 2DE5A 4NFRA 3S14I 1KRLA 2OOXB 2P3YA 3NFZA 3CMA1 4Y52I 1Y1WI 5T6BA 4E31A 1Q861 5IT9b 3CCM1 1JWHC 1VQOZ 3I55Z 4A3KI 2NVTI 2OTJZ 1Z03A 5IP7I 2F4OA 1VQK1 2Q4ZA 4RVFA 4TNUA 4NOZA 1S72Z 3HKZA 1Q862 1YJ9Z 3CCSZ 2R7ZI 3NDJA 3KIHA 3H0GI 3CD6Z 3CC71 4QTUA 2ZAEB 2VF1A 2OOYB 1SFOI 1NUIA 3F3FC 3VTNA 2WAQA 4NB9A 4EWCA 1VQ41 5AN9F 2GU2A 3S1MI 1K8A1 2RPRA 1Q7Y2 3I4NI 1ZB9A 4A3LI 2GTHA 1K8A2 3CCQZ 2LFUA 3I561 1Q811 3VMIA 1I3QI 4E30A 2DE6A 1VLAA 1VQNZ 3HOYI 2J6AA 3OW2Y 4E33A 2QR1B 1Q812 4A3JI 4NBDA 3Q87A 3CMEZ 3JAMf 3CCRZ 3G4S1 1QVGZ 1VQ81 3S2HI 2B63I 1KQSZ 3CC21 1KD11 4MH4A 4A3FI 3CCU1 3IX0A 5LL6f 3GTOI 1YJN1 1RO0A 2PK7A 1KQSY 3P5JB 3RZOI 5IT9f 1X3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A2Q b;  3J7A 4;  5IT9 b;  5FLX b;  3JAM b;  5LL6 f;  3J80 b;  3J81 b; 
#chains in the Genus database with same CATH topology
 1KD1 2;  2JA7 I;  3QWU A;  1ZB8 A;  1AA6 A;  3CCE Z;  1YIJ Z;  2RT9 A;  1YUA A;  1JJ2 Z;  1VQL 1;  3I07 A;  5FLM I;  3H3V J;  3J81 f;  2JS4 A;  3CCL 1;  1TWA I;  3NDI A;  2QA4 1;  4NBF A;  1JJ2 Y;  1YHQ Z;  2IZ3 A;  5FLX b;  3JAM b;  1Z02 A;  5CM2 M;  4NBG A;  1P9N A;  1K9M 2;  1Q82 1;  2W03 A;  3HOV I;  1X3W A;  4BBR I;  2R93 I;  1ML8 A;  1NJI 1;  2KI7 B;  1VQ5 Z;  4A93 I;  1K73 1;  5IP9 I;  1VQ9 Z;  1VQP 1;  2W04 A;  4BY1 I;  2QLV B;  3GTK I;  2QEX Z;  5A2Q b;  1Q82 2;  2E2H I;  4NBC A;  1YIT Z;  1NJI 2;  1R9T I;  1K73 2;  2LIY A;  3CCV 1;  1TWC I;  1RLY A;  1TFI A;  3MZL B;  1VQ7 Z;  2NVQ I;  4A3C I;  3FQQ A;  2OTL Z;  1Q7Y 1;  1KC8 2;  2YU9 I;  3J81 b;  1X0T A;  2O53 A;  3G6E Z;  2V45 A;  3BG1 B;  5T64 A;  1TWH I;  4A3E I;  4RVH A;  4S1T A;  1VQO 1;  1USP B;  3I55 1;  3I4M I;  4RVG A;  2OTJ 1;  2V8I A;  1Z01 A;  2IZ4 A;  3BG0 B;  5C4X I;  2WB1 A;  4DK1 A;  1S72 1;  2IV2 X;  1YJ9 1;  3CCS 1;  3VMH A;  3S1N I;  2GTI A;  3GTM I;  1S7M A;  4NBH A;  1NP6 A;  1FDI A;  3CD6 1;  3VMG A;  2NVY I;  4MXU A;  2M48 A;  3IF8 A;  2RBL A;  3GTQ I;  2G2K A;  3EER A;  3FKI I;  1YI2 Z;  1M90 2;  1WW9 A;  3LUS A;  4NBE A;  3S15 I;  2H85 A;  3PO2 I;  5FLX f;  2V8K A;  2V8J A;  2E9H A;  2Y0S A;  4HGY A;  3CCQ 1;  3J7A 4;  1I6H I;  1W2B Z;  3CPW Z;  1QVG Y;  5A2Q f;  4E2Z A;  2RHB A;  2O4H A;  3K7A I;  4NBB A;  1VQN 1;  5D1P A;  1YJW Z;  3NH5 A;  1VQ6 Z;  2JIR A;  3CME 1;  3CCR 1;  1QVF Z;  3G71 Z;  2HF1 A;  3PO3 I;  5D1O A;  1ZH1 A;  2JNY A;  3MON A;  1K9M 1;  3M3Y I;  3HOZ I;  3CCJ Z;  3GTP I;  1Y1V I;  3ESW A;  1VQM Z;  2VPX A;  1QVF Y;  4RVD A;  1YUK A;  1QF8 A;  4NBA A;  5C44 I;  3CC4 Z;  2E2I I;  2JIP A;  3M4O I;  2K5R A;  3TE5 B;  4RV9 A;  4E2Y A;  3D9X A;  3CMA Z;  2JMO A;  2PMZ A;  3CCM Z;  4MD7 A;  4MD9 A;  4HGZ A;  4A3B I;  1I50 I;  1VQK Z;  3CCE 1;  3T4N B;  1YIJ 1;  3KIF A;  3U50 C;  4NH1 C;  2M6N A;  2F4M A;  2NAP A;  2AKL A;  2P28 A;  1K83 I;  2JIM A;  1Y1V S;  3GTG I;  1KC8 1;  4MON A;  3TDH B;  1M1K 2;  1RQF A;  3F3P C;  3CC7 Z;  1YHQ 1;  1L1O C;  3FQM A;  1N8R 2;  1LQL A;  2E7Z A;  3HOU I;  1VQ4 Z;  2QRD B;  1VQ5 1;  1RO2 A;  1VQ9 1;  1PFT A;  2QEX 1;  2VUM I;  1Q16 A;  2K3R A;  4A3M I;  1YIT 1;  4DGL A;  4Y7N I;  4BY7 I;  2QRE B;  3NH4 A;  3I56 Z;  4DQY B;  3GKQ A;  3HOX I;  1VQ7 1;  4XX2 A;  1M90 1;  2OTL 1;  4QTT A;  2NVX I;  5C3E I;  4A3G I;  3G6E 1;  4AYB A;  3D6W A;  4MRI A;  1USP A;  3J80 b;  3G4S Z;  4CL1 A;  1VQ8 Z;  2OZK A;  4BXX I;  2JIQ A;  2KPI A;  3GTL I;  2HU9 A;  3CC2 Z;  3EED A;  2QRC B;  1QYP A;  3CCU Z;  1YJN Z;  1FDO A;  3S17 I;  2JA5 I;  2JA8 I;  4A3I I;  3OW2 Z;  3GTM S;  4A3D I;  5C4J I;  2I3C A;  1WII A;  3IR7 A;  2JR6 A;  1W2B Y;  3CPW Y;  3RZD I;  2JUB A;  2RIQ A;  5T67 A;  4E32 A;  1TWF I;  2PM9 A;  1YI2 1;  1VQL Z;  1TWG I;  2QKD A;  4MD8 A;  2VUG A;  5D1O B;  3S2D I;  3CCL Z;  3S16 I;  1WJ2 A;  1N2F A;  2QA4 Z;  3GTJ I;  3IFU A;  2VPZ A;  3GCF A;  3NH8 A;  4E2X A;  1WCM I;  2R6M A;  4RS4 A;  3VB9 A;  4BBS I;  4E2W A;  2JA6 I;  3CXC Z;  1VQP Z;  3CXC Y;  2YAD A;  1RNI A;  2E2J I;  1YJW 1;  2Q51 A;  1M1K 1;  1VQ6 1;  3CQZ I;  3CCV Z;  3HOW I;  1QXF A;  2R92 I;  3S1Q I;  2V3V A;  2DE7 A;  3G71 1;  3PO3 S;  3D2L A;  1N8R 1;  4X6A I;  4NB8 A;  2BJO A;  1DL6 A;  3CCJ 1;  4HH4 A;  3S1R I;  1RO4 A;  1VQM 1;  2VPW A;  3MZK B;  3CC4 1;  2EGT A;  3J80 f;  2DE5 A;  4NFR A;  3S14 I;  1KRL A;  2OOX B;  2P3Y A;  3NFZ A;  3CMA 1;  4Y52 I;  2AYD A;  5T6B A;  4E31 A;  1Y1W I;  1Q86 1;  5IT9 b;  3CCM 1;  1JWH C;  1VQO Z;  3I55 Z;  1Y8C A;  4A3K I;  2NVT I;  2OTJ Z;  1Z03 A;  5IP7 I;  2F4O A;  1VQK 1;  2Q4Z A;  4RVF A;  4TNU A;  4NOZ A;  1S72 Z;  3HKZ A;  1Q86 2;  1YJ9 Z;  3CCS Z;  2R7Z I;  3NDJ A;  3KIH A;  3H0G I;  3CD6 Z;  3CC7 1;  4QTU A;  2ZAE B;  2VF1 A;  2OOY B;  1SFO I;  1NUI A;  3F3F C;  3VTN A;  2WAQ A;  4NB9 A;  4EWC A;  1VQ4 1;  5AN9 F;  2GU2 A;  3S1M I;  1K8A 1;  1WZN A;  2RPR A;  1Q7Y 2;  3I4N I;  1ZB9 A;  4A3L I;  2GTH A;  1K8A 2;  3CCQ Z;  2LFU A;  2VPY A;  3I56 1;  1Q81 1;  3VMI A;  1I3Q I;  4E30 A;  2DE6 A;  1VLA A;  1VQN Z;  3HOY I;  1SIW A;  2J6A A;  2LEX A;  3OW2 Y;  4E33 A;  2QR1 B;  1Q81 2;  4A3J I;  4NBD A;  3Q87 A;  3CME Z;  3JAM f;  3CCR Z;  3G4S 1;  1QVG Z;  1VQ8 1;  3S2H I;  2JIO A;  2B63 I;  1KQS Z;  3CC2 1;  1KD1 1;  4MH4 A;  4A3F I;  3CCU 1;  3IX0 A;  5LL6 f;  3GTO I;  1YJN 1;  1RO0 A;  2PK7 A;  1KQS Y;  3P5J B;  3RZO I;  5IT9 f;  1X3Z A; 
#chains in the Genus database with same CATH homology
 1KD1 2;  2JA7 I;  3QWU A;  1ZB8 A;  3CCE Z;  1YIJ Z;  2RT9 A;  1YUA A;  1JJ2 Z;  1VQL 1;  3I07 A;  5FLM I;  3H3V J;  3J81 f;  2JS4 A;  3CCL 1;  1TWA I;  3NDI A;  2QA4 1;  4NBF A;  1JJ2 Y;  1YHQ Z;  2IZ3 A;  5FLX b;  3JAM b;  1Z02 A;  5CM2 M;  4NBG A;  1P9N A;  1K9M 2;  1Q82 1;  2W03 A;  3HOV I;  1X3W A;  4BBR I;  2R93 I;  1ML8 A;  1NJI 1;  2KI7 B;  1VQ5 Z;  4A93 I;  1K73 1;  5IP9 I;  1VQ9 Z;  1VQP 1;  2W04 A;  4BY1 I;  2QLV B;  3GTK I;  2QEX Z;  5A2Q b;  1Q82 2;  2E2H I;  4NBC A;  1YIT Z;  1NJI 2;  1R9T I;  1K73 2;  2LIY A;  3CCV 1;  1TWC I;  1RLY A;  1TFI A;  3MZL B;  1VQ7 Z;  2NVQ I;  4A3C I;  3FQQ A;  2OTL Z;  1Q7Y 1;  1KC8 2;  2YU9 I;  3J81 b;  1X0T A;  2O53 A;  3G6E Z;  3BG1 B;  5T64 A;  1TWH I;  4A3E I;  4RVH A;  4S1T A;  1VQO 1;  1USP B;  3I55 1;  3I4M I;  4RVG A;  2OTJ 1;  2V8I A;  1Z01 A;  2IZ4 A;  3BG0 B;  5C4X I;  2WB1 A;  4DK1 A;  1S72 1;  1YJ9 1;  3CCS 1;  3VMH A;  3S1N I;  2GTI A;  3GTM I;  1S7M A;  4NBH A;  1NP6 A;  3CD6 1;  3VMG A;  2NVY I;  4MXU A;  2M48 A;  3IF8 A;  2RBL A;  3GTQ I;  2G2K A;  3EER A;  3FKI I;  1YI2 Z;  1M90 2;  1WW9 A;  3LUS A;  4NBE A;  3S15 I;  2H85 A;  3PO2 I;  5FLX f;  2V8K A;  2V8J A;  2E9H A;  2Y0S A;  4HGY A;  3CCQ 1;  3J7A 4;  1I6H I;  1W2B Z;  3CPW Z;  1QVG Y;  5A2Q f;  4E2Z A;  2RHB A;  2O4H A;  3K7A I;  4NBB A;  1VQN 1;  5D1P A;  1YJW Z;  3NH5 A;  1VQ6 Z;  3CME 1;  3CCR 1;  1QVF Z;  3G71 Z;  2HF1 A;  3PO3 I;  5D1O A;  1ZH1 A;  2JNY A;  3MON A;  1K9M 1;  3M3Y I;  3HOZ I;  3CCJ Z;  3GTP I;  1Y1V I;  3ESW A;  1VQM Z;  1QVF Y;  4RVD A;  1YUK A;  1QF8 A;  4NBA A;  5C44 I;  3CC4 Z;  2E2I I;  3M4O I;  2K5R A;  3TE5 B;  4RV9 A;  4E2Y A;  3D9X A;  3CMA Z;  2JMO A;  2PMZ A;  3CCM Z;  4MD7 A;  4MD9 A;  4HGZ A;  4A3B I;  1I50 I;  1VQK Z;  3CCE 1;  3T4N B;  1YIJ 1;  3KIF A;  3U50 C;  4NH1 C;  2M6N A;  2F4M A;  2AKL A;  2P28 A;  1K83 I;  1Y1V S;  3GTG I;  1KC8 1;  4MON A;  3TDH B;  1M1K 2;  1RQF A;  3F3P C;  3CC7 Z;  1YHQ 1;  1L1O C;  3FQM A;  1N8R 2;  1LQL A;  3HOU I;  1VQ4 Z;  2QRD B;  1VQ5 1;  1RO2 A;  1VQ9 1;  1PFT A;  2QEX 1;  2VUM I;  2K3R A;  4A3M I;  1YIT 1;  4DGL A;  4Y7N I;  4BY7 I;  2QRE B;  3NH4 A;  3I56 Z;  4DQY B;  3GKQ A;  3HOX I;  1VQ7 1;  4XX2 A;  1M90 1;  2OTL 1;  4QTT A;  2NVX I;  5C3E I;  4A3G I;  3G6E 1;  4AYB A;  3D6W A;  4MRI A;  1USP A;  3J80 b;  3G4S Z;  4CL1 A;  1VQ8 Z;  2OZK A;  4BXX I;  2KPI A;  3GTL I;  2HU9 A;  3CC2 Z;  3EED A;  2QRC B;  1QYP A;  3CCU Z;  1YJN Z;  3S17 I;  2JA5 I;  2JA8 I;  4A3I I;  3OW2 Z;  3GTM S;  4A3D I;  5C4J I;  2I3C A;  1WII A;  2JR6 A;  1W2B Y;  3CPW Y;  3RZD I;  2JUB A;  2RIQ A;  5T67 A;  4E32 A;  1TWF I;  2PM9 A;  1YI2 1;  1VQL Z;  1TWG I;  2QKD A;  4MD8 A;  2VUG A;  5D1O B;  3S2D I;  3CCL Z;  3S16 I;  1N2F A;  2QA4 Z;  3GTJ I;  3IFU A;  3GCF A;  3NH8 A;  4E2X A;  1WCM I;  2R6M A;  4RS4 A;  3VB9 A;  4BBS I;  4E2W A;  2JA6 I;  3CXC Z;  1VQP Z;  3CXC Y;  2YAD A;  1RNI A;  2E2J I;  1YJW 1;  2Q51 A;  1M1K 1;  1VQ6 1;  3CQZ I;  3CCV Z;  3HOW I;  2R92 I;  3S1Q I;  2DE7 A;  3G71 1;  3PO3 S;  1N8R 1;  4X6A I;  4NB8 A;  2BJO A;  1DL6 A;  3CCJ 1;  4HH4 A;  3S1R I;  1RO4 A;  1VQM 1;  3MZK B;  3CC4 1;  2EGT A;  3J80 f;  2DE5 A;  4NFR A;  3S14 I;  1KRL A;  2OOX B;  2P3Y A;  3NFZ A;  3CMA 1;  4Y52 I;  1Y1W I;  5T6B A;  4E31 A;  1Q86 1;  5IT9 b;  3CCM 1;  1JWH C;  1VQO Z;  3I55 Z;  4A3K I;  2NVT I;  2OTJ Z;  1Z03 A;  5IP7 I;  2F4O A;  1VQK 1;  2Q4Z A;  4RVF A;  4TNU A;  4NOZ A;  1S72 Z;  3HKZ A;  1Q86 2;  1YJ9 Z;  3CCS Z;  2R7Z I;  3NDJ A;  3KIH A;  3H0G I;  3CD6 Z;  3CC7 1;  4QTU A;  2ZAE B;  2VF1 A;  2OOY B;  1SFO I;  1NUI A;  3F3F C;  3VTN A;  2WAQ A;  4NB9 A;  4EWC A;  1VQ4 1;  5AN9 F;  2GU2 A;  3S1M I;  1K8A 1;  2RPR A;  1Q7Y 2;  3I4N I;  1ZB9 A;  4A3L I;  2GTH A;  1K8A 2;  3CCQ Z;  2LFU A;  3I56 1;  1Q81 1;  3VMI A;  1I3Q I;  4E30 A;  2DE6 A;  1VLA A;  1VQN Z;  3HOY I;  2J6A A;  3OW2 Y;  4E33 A;  2QR1 B;  1Q81 2;  4A3J I;  4NBD A;  3Q87 A;  3CME Z;  3JAM f;  3CCR Z;  3G4S 1;  1QVG Z;  1VQ8 1;  3S2H I;  2B63 I;  1KQS Z;  3CC2 1;  1KD1 1;  4MH4 A;  4A3F I;  3CCU 1;  3IX0 A;  5LL6 f;  3GTO I;  1YJN 1;  1RO0 A;  2PK7 A;  1KQS Y;  3P5J B;  3RZO I;  5IT9 f;  1X3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...