3J81b

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
81
structure length
81
Chain Sequence
VLVQDLLHPTAASEARKHKLKTLVQSPRSHFLDVKCPGCLNITTVFSHAQTAVTCESCSTVLCTPTGGKAKLSEGTSFRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 5
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
b PF01667 Ribosomal_S27e Ribosomal protein S27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.640 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3j81b00
3J7A4 3J80b 5LL6f 3JAMb 5IT9b 5A2Qb 5FLXb 3J81b
chains in the Genus database with same CATH superfamily
1QYPA 4BBSI 2JUBA 2QLVB 1W2BY 2E2JI 1KD11 5T64A 3I551 1ML8A 2O4HA 2JR6A 3HKZA 2OTJZ 2QA41 3S17I 1Q812 2JS4A 2RT9A 1YIJZ 1KQSY 1X3WA 2KPIA 2V3VA 1Y1VI 3D9XA 2QEX1 1K732 3IR7A 2JA8I 5IP7I 1N8R2 1WZNA 1SFOI 2JIQA 3CCEZ 2OOXB 1DL6A 2W04A 1NJI2 4A3EI 1M1K1 3CCJ1 1W2BZ 1KC81 1RQFA 3OW2Y 4A3FI 2DE5A 3S16I 2GU2A 2K3RA 2R6MA 1YJNZ 5T67A 4A93I 1KQSZ 1QXFA 3CMEZ 5C4JI 3H3VJ 3CC2Z 1L1OC 2NAPA 2VPYA 4Y7NI 3Q87A 1PFTA 3CPWZ 1TFIA 1TWCI 4RVHA 1X0TA 2V45A 3TDHB 1FDIA 2IV2X 4A3KI 1VQO1 1K8A1 3CCRZ 1RO2A 3CC4Z 4MRIA 4NBEA 1Q862 2AYDA 3H0GI 1TWFI 1TWGI 2IZ4A 3CMA1 3IF8A 3I56Z 2OTL1 1VQP1 3M3YI 4QTUA 1S72Z 2ZAEB 1TWAI 1VQ7Z 4A3JI 2P28A 1SIWA 3D2LA 1M902 3NH8A 1JWHC 1I3QI 2JA7I 2M48A 3CCVZ 2NVQI 4NFRA 2DE7A 3F3FC 2P3YA 3HOZI 2NVTI 3S1MI 1YHQ1 3CCLZ 1Z02A 3EEDA 4MONA 2PM9A 1Z01A 5LL6f 1USPB 3HOVI 2B63I 2KI7B 2YADA 2M6NA 1VQ41 1RO0A 5D1OB 1VQ5Z 5IP9I 3I4NI 1I50I 1VQK1 3PO2I 3GTLI 1QVFZ 3PO3S 2QRDB 4A3LI 3FQQA 4RVFA 1Q821 4A3DI 3HOWI 3NDJA 3G6EZ 1YJ91 4E33A 1I6HI 3CCQZ 2HF1A 2GTIA 4QTTA 4A3CI 3GTMS 2RPRA 4RVDA 1VQ6Z 3CPWY 3D6WA 2OTJ1 3P5JB 1M1K2 2O53A 3GTGI 4E32A 3GKQA 1YIJ1 3FQMA 5CM2M 1QF8A 2EGTA 1QVGY 2H85A 4CL1A 3G4SZ 3HOUI 2Q51A 3J80b 3I4MI 4DQYB 3VMGA 1YUAA 2IZ3A 3KIFA 4E2YA 3CCE1 1YI2Z 4MD7A 1RNIA 1NUIA 3QWUA 4A3GI 2R7ZI 4A3MI 2G2KA 1VQLZ 5IT9b 1K8A2 2HU9A 2E2II 2PMZA 2QREB 1YJN1 4A3BI 2JA5I 1NJI1 4NBBA 3PO3I 4HGYA 1ZB9A 2JA6I 3JAMb 5FLXf 3CME1 1K9M1 1QVGZ 3CD6Z 1WJ2A 4DK1A 3CC21 2YU9I 2LFUA 5C44I 3NDIA 4MXUA 5FLXb 2V8KA 1YUKA 3J7A4 4RS4A 1VQMZ 2E9HA 2VPXA 2R93I 3LUSA 3CCR1 2DE6A 3CC41 2VUMI 3S15I 3GTMI 3IFUA 3S1NI 1WW9A 4Y52I 4NBCA 3GTPI 4TNUA 4HH4A 2JNYA 4AYBA 4E2ZA 1QVFY 4MD8A 3GTJI 3NFZA 3I561 3TE5B 1VQ8Z 1S721 3RZOI 3GCFA 1VQ71 1Q7Y1 3FKII 3T4NB 2JIMA 3HOXI 2GTHA 4NB9A 4X6AI 3CCV1 2LEXA 2VPZA 3J81b 2NVXI 1Q822 1KD12 4NBHA 2RBLA 1Q16A 2K5RA 3CCL1 3CCMZ 4RV9A 1KRLA 2JMOA 1VQ9Z 3G71Z 3CC7Z 3KIHA 4NB8A 2LIYA 2OZKA 3BG0B 1LQLA 3K7AI 1FDOA 2JIPA 3I55Z 4BY7I 5A2Qf 3CCSZ 1VQ51 2E7ZA 2QA4Z 3VMHA 2WAQA 4E2XA 1R9TI 3ESWA 5A2Qb 3CC71 3G6E1 1TWHI 3MZKB 2J6AA 4RVGA 2WB1A 2QEXZ 2V8JA 1VQNZ 1KC82 2JIRA 2JIOA 3CCQ1 3CCS1 3J80f 2I3CA 3VTNA 3S14I 4EWCA 1VQ61 2PK7A 4BXXI 3NH4A 3CCJZ 1VQN1 1Q811 4NBFA 3RZDI 1WCMI 5IT9f 3VMIA 4S1TA 1RO4A 4DGLA 4NBGA 2AKLA 5D1PA 4MD9A 3M4OI 4NBAA 3U50C 1N2FA 3G4S1 1K731 1K9M2 3JAMf 1N8R1 3GTQI 3CCUZ 2Q4ZA 1ZH1A 1YI21 3F3PC 2QRCB 5AN9F 1VQOZ 2VF1A 1VQL1 2QKDA 2V8IA 3CQZI 4XX2A 2R92I 3CXCY 3CCU1 4NH1C 1P9NA 1JJ2Y 3VB9A 5C3EI 2W03A 5FLMI 3IX0A 2E2HI 1YITZ 3CMAZ 1AA6A 2OOYB 4NBDA 3CD61 2OTLZ 1VQPZ 1YJWZ 2QR1B 3S2DI 1VLAA 1USPA 1Q7Y2 2NVYI 5C4XI 3OW2Z 1VQM1 1Z03A 5D1OA 4NOZA 4MH4A 1YIT1 2F4OA 4E30A 4HGZA 1YJW1 1Y1WI 3HOYI 3GTOI 1Y1VS 3I07A 2Y0SA 1RLYA 3CXCZ 1Q861 3J81f 2VUGA 3MZLB 1JJ2Z 1Y8CA 3NH5A 1YHQZ 1VQ81 3EERA 1X3ZA 1ZB8A 3GTKI 3BG1B 4BBRI 1S7MA 1M901 3MONA 4BY1I 3S2HI 1VQ4Z 2VPWA 4E31A 2RIQA 1VQKZ 4A3II 1K83I 2RHBA 5T6BA 2BJOA 3S1QI 2F4MA 1YJ9Z 3CCM1 4E2WA 1WIIA 3S1RI 1VQ91 3G711 1NP6A
chains in the Genus database with same CATH topology
1QYPA 4BBSI 2JUBA 2QLVB 1W2BY 2E2JI 1KD11 5T64A 3I551 1ML8A 2O4HA 2JR6A 3HKZA 2OTJZ 2QA41 3S17I 1Q812 2JS4A 2RT9A 1YIJZ 1KQSY 1X3WA 2KPIA 1Y1VI 3D9XA 2QEX1 1K732 2JA8I 5IP7I 1N8R2 1SFOI 3CCEZ 2OOXB 1DL6A 2W04A 1NJI2 4A3EI 1M1K1 3CCJ1 1W2BZ 1KC81 1RQFA 3OW2Y 4A3FI 2DE5A 3S16I 2GU2A 2K3RA 2R6MA 1YJNZ 5T67A 4A93I 1KQSZ 3CMEZ 5C4JI 3H3VJ 3CC2Z 1L1OC 4Y7NI 3Q87A 1PFTA 3CPWZ 1TFIA 1TWCI 4RVHA 1X0TA 3TDHB 4A3KI 1VQO1 1K8A1 3CCRZ 1RO2A 3CC4Z 4MRIA 4NBEA 1Q862 3H0GI 1TWFI 1TWGI 2IZ4A 3CMA1 3IF8A 3I56Z 2OTL1 1VQP1 3M3YI 4QTUA 1S72Z 2ZAEB 1TWAI 1VQ7Z 4A3JI 2P28A 1M902 3NH8A 1JWHC 1I3QI 2JA7I 2M48A 3CCVZ 2NVQI 4NFRA 2DE7A 3F3FC 2P3YA 3HOZI 2NVTI 3S1MI 1YHQ1 3CCLZ 1Z02A 3EEDA 4MONA 2PM9A 1Z01A 5LL6f 1USPB 3HOVI 2B63I 2KI7B 2YADA 2M6NA 1VQ41 1RO0A 5D1OB 1VQ5Z 5IP9I 3I4NI 1I50I 1VQK1 3PO2I 3GTLI 1QVFZ 3PO3S 2QRDB 4A3LI 3FQQA 4RVFA 1Q821 4A3DI 3HOWI 3NDJA 3G6EZ 1YJ91 4E33A 1I6HI 3CCQZ 2HF1A 2GTIA 4QTTA 4A3CI 3GTMS 2RPRA 4RVDA 1VQ6Z 3CPWY 3D6WA 2OTJ1 3P5JB 1M1K2 2O53A 3GTGI 4E32A 3GKQA 1YIJ1 3FQMA 5CM2M 1QF8A 2EGTA 1QVGY 2H85A 4CL1A 3G4SZ 3HOUI 2Q51A 3J80b 3I4MI 4DQYB 3VMGA 1YUAA 2IZ3A 3KIFA 4E2YA 3CCE1 1YI2Z 4MD7A 1RNIA 1NUIA 3QWUA 4A3GI 2R7ZI 4A3MI 2G2KA 1VQLZ 5IT9b 1K8A2 2HU9A 2E2II 2PMZA 2QREB 1YJN1 4A3BI 2JA5I 1NJI1 4NBBA 3PO3I 4HGYA 1ZB9A 2JA6I 3JAMb 5FLXf 3CME1 1K9M1 1QVGZ 3CD6Z 4DK1A 3CC21 2YU9I 2LFUA 5C44I 3NDIA 4MXUA 5FLXb 2V8KA 1YUKA 3J7A4 4RS4A 1VQMZ 2E9HA 2R93I 3LUSA 3CCR1 2DE6A 3CC41 2VUMI 3S15I 3GTMI 3IFUA 3S1NI 1WW9A 4Y52I 4NBCA 3GTPI 4TNUA 4HH4A 2JNYA 4AYBA 4E2ZA 1QVFY 4MD8A 3GTJI 3NFZA 3I561 3TE5B 1VQ8Z 1S721 3RZOI 3GCFA 1VQ71 1Q7Y1 3FKII 3T4NB 3HOXI 2GTHA 4NB9A 4X6AI 3CCV1 3J81b 2NVXI 1Q822 1KD12 4NBHA 2RBLA 2K5RA 3CCL1 3CCMZ 4RV9A 1KRLA 1VQ9Z 2JMOA 3G71Z 3CC7Z 3KIHA 4NB8A 2LIYA 2OZKA 3BG0B 1LQLA 3K7AI 3I55Z 4BY7I 5A2Qf 3CCSZ 1VQ51 2QA4Z 3VMHA 2WAQA 4E2XA 1R9TI 3ESWA 5A2Qb 3CC71 3G6E1 1TWHI 3MZKB 2J6AA 4RVGA 2WB1A 2QEXZ 2V8JA 1VQNZ 1KC82 3CCQ1 3CCS1 3J80f 2I3CA 3VTNA 3S14I 4EWCA 1VQ61 2PK7A 4BXXI 3NH4A 3CCJZ 1VQN1 1Q811 4NBFA 3RZDI 1WCMI 5IT9f 3VMIA 4S1TA 1RO4A 4DGLA 4NBGA 2AKLA 5D1PA 4MD9A 3M4OI 4NBAA 3U50C 1N2FA 3G4S1 1K731 1K9M2 3JAMf 1N8R1 3GTQI 3CCUZ 2Q4ZA 1ZH1A 1YI21 3F3PC 2QRCB 5AN9F 1VQOZ 2VF1A 1VQL1 2QKDA 2V8IA 3CQZI 4XX2A 2R92I 3CXCY 3CCU1 4NH1C 1P9NA 1JJ2Y 3VB9A 5C3EI 2W03A 5FLMI 3IX0A 2E2HI 1YITZ 3CMAZ 2OOYB 4NBDA 3CD61 2OTLZ 1VQPZ 1YJWZ 2QR1B 3S2DI 1VLAA 1USPA 1Q7Y2 2NVYI 5C4XI 3OW2Z 1VQM1 1Z03A 5D1OA 4NOZA 4MH4A 1YIT1 2F4OA 4E30A 4HGZA 1YJW1 1Y1WI 3HOYI 3GTOI 1Y1VS 3I07A 2Y0SA 1RLYA 3CXCZ 1Q861 3J81f 2VUGA 3MZLB 1JJ2Z 3NH5A 1YHQZ 1VQ81 3EERA 1X3ZA 1ZB8A 3GTKI 3BG1B 4BBRI 1S7MA 1M901 3MONA 4BY1I 3S2HI 1VQ4Z 4E31A 2RIQA 1VQKZ 4A3II 1K83I 2RHBA 5T6BA 2BJOA 3S1QI 2F4MA 1YJ9Z 3CCM1 4E2WA 1WIIA 3S1RI 1VQ91 3G711 1NP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7A 4;  3J80 b;  5LL6 f;  3JAM b;  5IT9 b;  5A2Q b;  5FLX b;  3J81 b; 
#chains in the Genus database with same CATH topology
 1QYP A;  4BBS I;  2JUB A;  2QLV B;  1W2B Y;  2E2J I;  1KD1 1;  5T64 A;  3I55 1;  1ML8 A;  2O4H A;  2JR6 A;  3HKZ A;  2OTJ Z;  2QA4 1;  3S17 I;  1Q81 2;  2JS4 A;  2RT9 A;  1YIJ Z;  1KQS Y;  1X3W A;  2KPI A;  2V3V A;  1Y1V I;  3D9X A;  2QEX 1;  1K73 2;  3IR7 A;  2JA8 I;  5IP7 I;  1N8R 2;  1WZN A;  1SFO I;  2JIQ A;  3CCE Z;  2OOX B;  1DL6 A;  2W04 A;  1NJI 2;  4A3E I;  1M1K 1;  3CCJ 1;  1W2B Z;  1KC8 1;  1RQF A;  3OW2 Y;  4A3F I;  2DE5 A;  3S16 I;  2GU2 A;  2K3R A;  2R6M A;  1YJN Z;  5T67 A;  4A93 I;  1KQS Z;  1QXF A;  3CME Z;  5C4J I;  3H3V J;  3CC2 Z;  1L1O C;  2NAP A;  2VPY A;  4Y7N I;  3Q87 A;  1PFT A;  3CPW Z;  1TFI A;  1TWC I;  4RVH A;  1X0T A;  2V45 A;  3TDH B;  1FDI A;  2IV2 X;  4A3K I;  1VQO 1;  1K8A 1;  3CCR Z;  1RO2 A;  3CC4 Z;  4MRI A;  4NBE A;  1Q86 2;  2AYD A;  3H0G I;  1TWF I;  1TWG I;  2IZ4 A;  3CMA 1;  3IF8 A;  3I56 Z;  2OTL 1;  1VQP 1;  3M3Y I;  4QTU A;  1S72 Z;  2ZAE B;  1TWA I;  1VQ7 Z;  4A3J I;  2P28 A;  1SIW A;  3D2L A;  1M90 2;  3NH8 A;  1JWH C;  1I3Q I;  2JA7 I;  2M48 A;  3CCV Z;  2NVQ I;  4NFR A;  2DE7 A;  3F3F C;  2P3Y A;  3HOZ I;  2NVT I;  3S1M I;  1YHQ 1;  3CCL Z;  1Z02 A;  3EED A;  4MON A;  2PM9 A;  1Z01 A;  5LL6 f;  1USP B;  3HOV I;  2B63 I;  2KI7 B;  2YAD A;  2M6N A;  1VQ4 1;  1RO0 A;  5D1O B;  1VQ5 Z;  5IP9 I;  3I4N I;  1I50 I;  1VQK 1;  3PO2 I;  3GTL I;  1QVF Z;  3PO3 S;  2QRD B;  4A3L I;  3FQQ A;  4RVF A;  1Q82 1;  4A3D I;  3HOW I;  3NDJ A;  3G6E Z;  1YJ9 1;  4E33 A;  1I6H I;  3CCQ Z;  2HF1 A;  2GTI A;  4QTT A;  4A3C I;  3GTM S;  2RPR A;  4RVD A;  1VQ6 Z;  3CPW Y;  3D6W A;  2OTJ 1;  3P5J B;  1M1K 2;  2O53 A;  3GTG I;  4E32 A;  3GKQ A;  1YIJ 1;  3FQM A;  5CM2 M;  1QF8 A;  2EGT A;  1QVG Y;  2H85 A;  4CL1 A;  3G4S Z;  3HOU I;  2Q51 A;  3J80 b;  3I4M I;  4DQY B;  3VMG A;  1YUA A;  2IZ3 A;  3KIF A;  4E2Y A;  3CCE 1;  1YI2 Z;  4MD7 A;  1RNI A;  1NUI A;  3QWU A;  4A3G I;  2R7Z I;  4A3M I;  2G2K A;  1VQL Z;  5IT9 b;  1K8A 2;  2HU9 A;  2E2I I;  2PMZ A;  2QRE B;  1YJN 1;  4A3B I;  2JA5 I;  1NJI 1;  4NBB A;  3PO3 I;  4HGY A;  1ZB9 A;  2JA6 I;  3JAM b;  5FLX f;  3CME 1;  1K9M 1;  1QVG Z;  3CD6 Z;  1WJ2 A;  4DK1 A;  3CC2 1;  2YU9 I;  2LFU A;  5C44 I;  3NDI A;  4MXU A;  5FLX b;  2V8K A;  1YUK A;  3J7A 4;  4RS4 A;  1VQM Z;  2E9H A;  2VPX A;  2R93 I;  3LUS A;  3CCR 1;  2DE6 A;  3CC4 1;  2VUM I;  3S15 I;  3GTM I;  3IFU A;  3S1N I;  1WW9 A;  4Y52 I;  4NBC A;  3GTP I;  4TNU A;  4HH4 A;  2JNY A;  4AYB A;  4E2Z A;  1QVF Y;  4MD8 A;  3GTJ I;  3NFZ A;  3I56 1;  3TE5 B;  1VQ8 Z;  1S72 1;  3RZO I;  3GCF A;  1VQ7 1;  1Q7Y 1;  3FKI I;  3T4N B;  2JIM A;  3HOX I;  2GTH A;  4NB9 A;  4X6A I;  3CCV 1;  2LEX A;  2VPZ A;  3J81 b;  2NVX I;  1Q82 2;  1KD1 2;  4NBH A;  2RBL A;  1Q16 A;  2K5R A;  3CCL 1;  3CCM Z;  4RV9 A;  1KRL A;  2JMO A;  1VQ9 Z;  3G71 Z;  3CC7 Z;  3KIH A;  4NB8 A;  2LIY A;  2OZK A;  3BG0 B;  1LQL A;  3K7A I;  1FDO A;  2JIP A;  3I55 Z;  4BY7 I;  5A2Q f;  3CCS Z;  1VQ5 1;  2E7Z A;  2QA4 Z;  3VMH A;  2WAQ A;  4E2X A;  1R9T I;  3ESW A;  5A2Q b;  3CC7 1;  3G6E 1;  1TWH I;  3MZK B;  2J6A A;  4RVG A;  2WB1 A;  2QEX Z;  2V8J A;  1VQN Z;  1KC8 2;  2JIR A;  2JIO A;  3CCQ 1;  3CCS 1;  3J80 f;  2I3C A;  3VTN A;  3S14 I;  4EWC A;  1VQ6 1;  2PK7 A;  4BXX I;  3NH4 A;  3CCJ Z;  1VQN 1;  1Q81 1;  4NBF A;  3RZD I;  1WCM I;  5IT9 f;  3VMI A;  4S1T A;  1RO4 A;  4DGL A;  4NBG A;  2AKL A;  5D1P A;  4MD9 A;  3M4O I;  4NBA A;  3U50 C;  1N2F A;  3G4S 1;  1K73 1;  1K9M 2;  3JAM f;  1N8R 1;  3GTQ I;  3CCU Z;  2Q4Z A;  1ZH1 A;  1YI2 1;  3F3P C;  2QRC B;  5AN9 F;  1VQO Z;  2VF1 A;  1VQL 1;  2QKD A;  2V8I A;  3CQZ I;  4XX2 A;  2R92 I;  3CXC Y;  3CCU 1;  4NH1 C;  1P9N A;  1JJ2 Y;  3VB9 A;  5C3E I;  2W03 A;  5FLM I;  3IX0 A;  2E2H I;  1YIT Z;  3CMA Z;  1AA6 A;  2OOY B;  4NBD A;  3CD6 1;  2OTL Z;  1VQP Z;  1YJW Z;  2QR1 B;  3S2D I;  1VLA A;  1USP A;  1Q7Y 2;  2NVY I;  5C4X I;  3OW2 Z;  1VQM 1;  1Z03 A;  5D1O A;  4NOZ A;  4MH4 A;  1YIT 1;  2F4O A;  4E30 A;  4HGZ A;  1YJW 1;  1Y1W I;  3HOY I;  3GTO I;  1Y1V S;  3I07 A;  2Y0S A;  1RLY A;  3CXC Z;  1Q86 1;  3J81 f;  2VUG A;  3MZL B;  1JJ2 Z;  1Y8C A;  3NH5 A;  1YHQ Z;  1VQ8 1;  3EER A;  1X3Z A;  1ZB8 A;  3GTK I;  3BG1 B;  4BBR I;  1S7M A;  1M90 1;  3MON A;  4BY1 I;  3S2H I;  1VQ4 Z;  2VPW A;  4E31 A;  2RIQ A;  1VQK Z;  4A3I I;  1K83 I;  2RHB A;  5T6B A;  2BJO A;  3S1Q I;  2F4M A;  1YJ9 Z;  3CCM 1;  4E2W A;  1WII A;  3S1R I;  1VQ9 1;  3G71 1;  1NP6 A; 
#chains in the Genus database with same CATH homology
 1QYP A;  4BBS I;  2JUB A;  2QLV B;  1W2B Y;  2E2J I;  1KD1 1;  5T64 A;  3I55 1;  1ML8 A;  2O4H A;  2JR6 A;  3HKZ A;  2OTJ Z;  2QA4 1;  3S17 I;  1Q81 2;  2JS4 A;  2RT9 A;  1YIJ Z;  1KQS Y;  1X3W A;  2KPI A;  1Y1V I;  3D9X A;  2QEX 1;  1K73 2;  2JA8 I;  5IP7 I;  1N8R 2;  1SFO I;  3CCE Z;  2OOX B;  1DL6 A;  2W04 A;  1NJI 2;  4A3E I;  1M1K 1;  3CCJ 1;  1W2B Z;  1KC8 1;  1RQF A;  3OW2 Y;  4A3F I;  2DE5 A;  3S16 I;  2GU2 A;  2K3R A;  2R6M A;  1YJN Z;  5T67 A;  4A93 I;  1KQS Z;  3CME Z;  5C4J I;  3H3V J;  3CC2 Z;  1L1O C;  4Y7N I;  3Q87 A;  1PFT A;  3CPW Z;  1TFI A;  1TWC I;  4RVH A;  1X0T A;  3TDH B;  4A3K I;  1VQO 1;  1K8A 1;  3CCR Z;  1RO2 A;  3CC4 Z;  4MRI A;  4NBE A;  1Q86 2;  3H0G I;  1TWF I;  1TWG I;  2IZ4 A;  3CMA 1;  3IF8 A;  3I56 Z;  2OTL 1;  1VQP 1;  3M3Y I;  4QTU A;  1S72 Z;  2ZAE B;  1TWA I;  1VQ7 Z;  4A3J I;  2P28 A;  1M90 2;  3NH8 A;  1JWH C;  1I3Q I;  2JA7 I;  2M48 A;  3CCV Z;  2NVQ I;  4NFR A;  2DE7 A;  3F3F C;  2P3Y A;  3HOZ I;  2NVT I;  3S1M I;  1YHQ 1;  3CCL Z;  1Z02 A;  3EED A;  4MON A;  2PM9 A;  1Z01 A;  5LL6 f;  1USP B;  3HOV I;  2B63 I;  2KI7 B;  2YAD A;  2M6N A;  1VQ4 1;  1RO0 A;  5D1O B;  1VQ5 Z;  5IP9 I;  3I4N I;  1I50 I;  1VQK 1;  3PO2 I;  3GTL I;  1QVF Z;  3PO3 S;  2QRD B;  4A3L I;  3FQQ A;  4RVF A;  1Q82 1;  4A3D I;  3HOW I;  3NDJ A;  3G6E Z;  1YJ9 1;  4E33 A;  1I6H I;  3CCQ Z;  2HF1 A;  2GTI A;  4QTT A;  4A3C I;  3GTM S;  2RPR A;  4RVD A;  1VQ6 Z;  3CPW Y;  3D6W A;  2OTJ 1;  3P5J B;  1M1K 2;  2O53 A;  3GTG I;  4E32 A;  3GKQ A;  1YIJ 1;  3FQM A;  5CM2 M;  1QF8 A;  2EGT A;  1QVG Y;  2H85 A;  4CL1 A;  3G4S Z;  3HOU I;  2Q51 A;  3J80 b;  3I4M I;  4DQY B;  3VMG A;  1YUA A;  2IZ3 A;  3KIF A;  4E2Y A;  3CCE 1;  1YI2 Z;  4MD7 A;  1RNI A;  1NUI A;  3QWU A;  4A3G I;  2R7Z I;  4A3M I;  2G2K A;  1VQL Z;  5IT9 b;  1K8A 2;  2HU9 A;  2E2I I;  2PMZ A;  2QRE B;  1YJN 1;  4A3B I;  2JA5 I;  1NJI 1;  4NBB A;  3PO3 I;  4HGY A;  1ZB9 A;  2JA6 I;  3JAM b;  5FLX f;  3CME 1;  1K9M 1;  1QVG Z;  3CD6 Z;  4DK1 A;  3CC2 1;  2YU9 I;  2LFU A;  5C44 I;  3NDI A;  4MXU A;  5FLX b;  2V8K A;  1YUK A;  3J7A 4;  4RS4 A;  1VQM Z;  2E9H A;  2R93 I;  3LUS A;  3CCR 1;  2DE6 A;  3CC4 1;  2VUM I;  3S15 I;  3GTM I;  3IFU A;  3S1N I;  1WW9 A;  4Y52 I;  4NBC A;  3GTP I;  4TNU A;  4HH4 A;  2JNY A;  4AYB A;  4E2Z A;  1QVF Y;  4MD8 A;  3GTJ I;  3NFZ A;  3I56 1;  3TE5 B;  1VQ8 Z;  1S72 1;  3RZO I;  3GCF A;  1VQ7 1;  1Q7Y 1;  3FKI I;  3T4N B;  3HOX I;  2GTH A;  4NB9 A;  4X6A I;  3CCV 1;  3J81 b;  2NVX I;  1Q82 2;  1KD1 2;  4NBH A;  2RBL A;  2K5R A;  3CCL 1;  3CCM Z;  4RV9 A;  1KRL A;  1VQ9 Z;  2JMO A;  3G71 Z;  3CC7 Z;  3KIH A;  4NB8 A;  2LIY A;  2OZK A;  3BG0 B;  1LQL A;  3K7A I;  3I55 Z;  4BY7 I;  5A2Q f;  3CCS Z;  1VQ5 1;  2QA4 Z;  3VMH A;  2WAQ A;  4E2X A;  1R9T I;  3ESW A;  5A2Q b;  3CC7 1;  3G6E 1;  1TWH I;  3MZK B;  2J6A A;  4RVG A;  2WB1 A;  2QEX Z;  2V8J A;  1VQN Z;  1KC8 2;  3CCQ 1;  3CCS 1;  3J80 f;  2I3C A;  3VTN A;  3S14 I;  4EWC A;  1VQ6 1;  2PK7 A;  4BXX I;  3NH4 A;  3CCJ Z;  1VQN 1;  1Q81 1;  4NBF A;  3RZD I;  1WCM I;  5IT9 f;  3VMI A;  4S1T A;  1RO4 A;  4DGL A;  4NBG A;  2AKL A;  5D1P A;  4MD9 A;  3M4O I;  4NBA A;  3U50 C;  1N2F A;  3G4S 1;  1K73 1;  1K9M 2;  3JAM f;  1N8R 1;  3GTQ I;  3CCU Z;  2Q4Z A;  1ZH1 A;  1YI2 1;  3F3P C;  2QRC B;  5AN9 F;  1VQO Z;  2VF1 A;  1VQL 1;  2QKD A;  2V8I A;  3CQZ I;  4XX2 A;  2R92 I;  3CXC Y;  3CCU 1;  4NH1 C;  1P9N A;  1JJ2 Y;  3VB9 A;  5C3E I;  2W03 A;  5FLM I;  3IX0 A;  2E2H I;  1YIT Z;  3CMA Z;  2OOY B;  4NBD A;  3CD6 1;  2OTL Z;  1VQP Z;  1YJW Z;  2QR1 B;  3S2D I;  1VLA A;  1USP A;  1Q7Y 2;  2NVY I;  5C4X I;  3OW2 Z;  1VQM 1;  1Z03 A;  5D1O A;  4NOZ A;  4MH4 A;  1YIT 1;  2F4O A;  4E30 A;  4HGZ A;  1YJW 1;  1Y1W I;  3HOY I;  3GTO I;  1Y1V S;  3I07 A;  2Y0S A;  1RLY A;  3CXC Z;  1Q86 1;  3J81 f;  2VUG A;  3MZL B;  1JJ2 Z;  3NH5 A;  1YHQ Z;  1VQ8 1;  3EER A;  1X3Z A;  1ZB8 A;  3GTK I;  3BG1 B;  4BBR I;  1S7M A;  1M90 1;  3MON A;  4BY1 I;  3S2H I;  1VQ4 Z;  4E31 A;  2RIQ A;  1VQK Z;  4A3I I;  1K83 I;  2RHB A;  5T6B A;  2BJO A;  3S1Q I;  2F4M A;  1YJ9 Z;  3CCM 1;  4E2W A;  1WII A;  3S1R I;  1VQ9 1;  3G71 1;  1NP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...