3J81b

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
81
structure length
81
Chain Sequence
b'VLVQDLLHPTAASEARKHKLKTLVQSPRSHFLDVKCPGCLNITTVFSHAQTAVTCESCSTVLCTPTGGKAKLSEGTSFRRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 5
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
b PF01667 Ribosomal_S27e Ribosomal protein S27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.640 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3j81b00
3JAMb 5FLXb 5A2Qb 5LL6f 3J7A4 3J80b 3J81b 5IT9b
chains in the Genus database with same CATH superfamily
1X3ZA 1Z03A 5FLXb 1RQFA 3BG1B 1RO2A 3KIHA 1JJ2Y 3CCQZ 3GTQI 1RO4A 1NJI1 2V45A 4TNUA 2QEX1 4A3GI 1KD11 1VQ6Z 1Q811 3S16I 4Y7NI 1QVFZ 2M6NA 2K3RA 5LL6f 2VUGA 1TWCI 4NH1C 1PFTA 3GTKI 1N2FA 1NP6A 2R7ZI 1K8A2 3CCRZ 1Y1WI 1Q7Y1 3RZOI 2VPYA 4A3CI 5IT9b 1TWFI 1S721 2AYDA 1VLAA 1WZNA 2RPRA 3H3VJ 4RVFA 3S2HI 1M902 1VQP1 4A3MI 5D1PA 3HKZA 3MONA 2V8JA 3VMIA 5A2Qb 3H0GI 5IP7I 1VQ8Z 2QEXZ 3NDIA 1S7MA 3M3YI 3J7A4 4E31A 5C44I 4MXUA 3S1RI 3IR7A 1VQK1 2G2KA 2DE6A 3S1QI 4DQYB 1Y8CA 3CMEZ 1YJ91 2JIQA 4A3KI 3CCJZ 2V8IA 2BJOA 2IV2X 3KIFA 3I4NI 5D1OA 2QKDA 3M4OI 1YITZ 1K732 3IX0A 3RZDI 1YJW1 5CM2M 3VMGA 2VF1A 2QA41 2NAPA 5C4XI 3GTMI 2R92I 2JUBA 1VQPZ 2QRDB 4A3II 4NBBA 1VQO1 1I6HI 3K7AI 3F3FC 3I07A 2JA8I 2V3VA 3QWUA 1Q861 1N8R2 5AN9F 2KPIA 4NBFA 3Q87A 3CC41 3CPWY 5C3EI 4E32A 2Q51A 4A3JI 2OOXB 2RT9A 1YUAA 2OTLZ 1YJ9Z 2OTJ1 3FKII 2QR1B 3I551 3CMA1 4AYBA 3CD61 2QRCB 2VPZA 2OOYB 3CCS1 4NFRA 3CCE1 2GTHA 2E2JI 1WCMI 2JIPA 1QXFA 2QLVB 2KI7B 2RHBA 2YADA 2M48A 3EERA 4HGYA 3VB9A 2E2II 3J81f 1ZB8A 3FQQA 2P28A 1QYPA 2VPWA 3J80f 1K9M1 2JIRA 2JA6I 2WB1A 1LQLA 2LIYA 3PO3S 3NH4A 1KQSY 1VQ71 3I4MI 4NB8A 2F4MA 3GTLI 3CC4Z 4EWCA 4A3EI 4MD7A 1WW9A 4NBAA 1DL6A 2R93I 1W2BY 4NBCA 3PO3I 1VQL1 2OTJZ 3CD6Z 3CMAZ 1QVGY 2R6MA 4RS4A 3CCSZ 3FQMA 1K83I 3CCEZ 4Y52I 4E30A 4NB9A 1VQ91 1X3WA 4MH4A 1NJI2 3PO2I 4A3FI 1KD12 2VPXA 1Q812 2H85A 3CXCZ 3S17I 4BBRI 4BBSI 2LEXA 1USPA 2EGTA 3S1MI 3D9XA 1VQM1 3HOXI 2O4HA 1Y1VI 5FLXf 1QVFY 3GTMS 1Q7Y2 2NVTI 4RV9A 2HU9A 3HOVI 2W03A 2PM9A 2JIMA 3VTNA 2NVQI 1S72Z 3LUSA 4NBHA 4E2WA 2NVXI 4QTTA 4BY7I 3F3PC 2B63I 1JJ2Z 4NBEA 2RBLA 1VQ9Z 1RLYA 1NUIA 1Q821 3G711 2JR6A 1YI21 1WIIA 2JNYA 2Q4ZA 1FDOA 3CCQ1 1RO0A 4RVHA 5IT9f 5FLMI 2O53A 3CC71 2I3CA 4NBDA 1I3QI 5D1OB 1X0TA 1VQN1 1YHQ1 1VQKZ 1VQ61 4A3BI 3CXCY 4DK1A 1Z01A 3NH5A 4QTUA 2E7ZA 3NH8A 4RVGA 2HF1A 3JAMb 5IP9I 2JA5I 3G6E1 4E2ZA 4E2YA 3CCR1 1K8A1 5A2Qf 4X6AI 4XX2A 3CCL1 4A3LI 3OW2Z 1YJWZ 4NOZA 2QA4Z 3P5JB 2E2HI 4A93I 3NFZA 3CCV1 1Q16A 3ESWA 1VQOZ 3I561 3G71Z 1VQ51 1YI2Z 1M901 3U50C 1M1K1 3GTPI 1Q862 3CC21 3CQZI 4BY1I 1WJ2A 2E9HA 2AKLA 3HOWI 2YU9I 2VUMI 3CC7Z 1YIJ1 3S15I 1VQ81 3GTOI 1VQNZ 1YHQZ 3HOYI 3G4S1 1Z02A 3D6WA 2IZ4A 3I55Z 3HOUI 4S1TA 1QF8A 2F4OA 3TE5B 2K5RA 3G6EZ 3CME1 1I50I 4BXXI 2P3YA 3CCLZ 2W04A 3CCJ1 4RVDA 3D2LA 1VQ41 1Y1VS 1YUKA 3MZKB 3EEDA 3MZLB 1RNIA 1YIT1 3NDJA 4MD8A 3CCVZ 1K731 3OW2Y 2V8KA 1K9M2 3T4NB 2OZKA 3BG0B 3I56Z 1M1K2 1VQ5Z 3JAMf 2RIQA 2Y0SA 3CC2Z 3CCU1 4MRIA 1VQ7Z 2JMOA 1KC81 4HH4A 3GKQA 3CPWZ 2NVYI 1SIWA 1YIJZ 4A3DI 4DGLA 1N8R1 3G4SZ 1SFOI 2GTIA 3CCM1 3TDHB 4E33A 1L1OC 1TWAI 3GTJI 2PK7A 1VQLZ 3J81b 1FDIA 1AA6A 3GTGI 2DE5A 2OTL1 3VMHA 5C4JI 3J80b 1USPB 4CL1A 1R9TI 2JA7I 2JS4A 1YJN1 2LFUA 3S2DI 1VQ4Z 3IFUA 3S14I 1TWGI 1JWHC 3HOZI 2QREB 5T67A 2DE7A 2PMZA 4E2XA 2ZAEB 4MONA 1P9NA 3IF8A 3S1NI 1VQMZ 1KQSZ 3CCUZ 1KC82 2GU2A 1TWHI 1ZB9A 2IZ3A 4MD9A 1W2BZ 1KRLA 2WAQA 3GCFA 3CCMZ 5T64A 1QVGZ 2JIOA 2J6AA 4HGZA 1ML8A 1TFIA 4NBGA 5T6BA 1Q822 1ZH1A 1YJNZ
chains in the Genus database with same CATH topology
1X3ZA 1Z03A 5FLXb 1RQFA 3BG1B 1RO2A 3KIHA 1JJ2Y 3CCQZ 3GTQI 1RO4A 1NJI1 4TNUA 2QEX1 4A3GI 1KD11 1VQ6Z 1Q811 3S16I 4Y7NI 1QVFZ 2M6NA 2K3RA 5LL6f 2VUGA 1TWCI 4NH1C 1PFTA 3GTKI 1N2FA 1NP6A 2R7ZI 1K8A2 3CCRZ 1Y1WI 1Q7Y1 3RZOI 4A3CI 5IT9b 1TWFI 1S721 1VLAA 2RPRA 3H3VJ 4RVFA 3S2HI 1M902 1VQP1 4A3MI 5D1PA 3HKZA 3MONA 2V8JA 3VMIA 5A2Qb 3H0GI 5IP7I 1VQ8Z 2QEXZ 3NDIA 1S7MA 3M3YI 3J7A4 4E31A 5C44I 4MXUA 3S1RI 1VQK1 2G2KA 2DE6A 3S1QI 4DQYB 3CMEZ 1YJ91 4A3KI 3CCJZ 2V8IA 2BJOA 3I4NI 3KIFA 5D1OA 2QKDA 3M4OI 1YITZ 1K732 3IX0A 3RZDI 1YJW1 5CM2M 3VMGA 2VF1A 2QA41 5C4XI 3GTMI 2R92I 2JUBA 1VQPZ 2QRDB 4A3II 4NBBA 1VQO1 1I6HI 3K7AI 3F3FC 3I07A 2JA8I 3QWUA 1Q861 1N8R2 5AN9F 2KPIA 4NBFA 3Q87A 3CC41 3CPWY 5C3EI 4E32A 2Q51A 4A3JI 2OOXB 2RT9A 1YUAA 2OTLZ 1YJ9Z 2OTJ1 3FKII 2QR1B 3I551 3CMA1 4AYBA 3CD61 2QRCB 2OOYB 3CCS1 4NFRA 3CCE1 2GTHA 2E2JI 1WCMI 2QLVB 2KI7B 2RHBA 2YADA 2M48A 3EERA 4HGYA 3VB9A 2E2II 3J81f 1ZB8A 3FQQA 2P28A 1QYPA 3J80f 1K9M1 2JA6I 2WB1A 1LQLA 2LIYA 3PO3S 3NH4A 1KQSY 1VQ71 3I4MI 4NB8A 2F4MA 3GTLI 3CC4Z 4EWCA 4A3EI 4MD7A 1WW9A 4NBAA 1DL6A 2R93I 1W2BY 4NBCA 3PO3I 1VQL1 2OTJZ 3CD6Z 3CMAZ 1QVGY 2R6MA 4RS4A 3CCSZ 3FQMA 1K83I 3CCEZ 4Y52I 4E30A 4NB9A 1VQ91 1X3WA 4MH4A 1NJI2 3PO2I 4A3FI 1KD12 1Q812 2H85A 3CXCZ 3S17I 4BBRI 4BBSI 1USPA 2EGTA 3S1MI 3D9XA 1VQM1 3HOXI 2O4HA 1Y1VI 5FLXf 1QVFY 3GTMS 1Q7Y2 2NVTI 4RV9A 2HU9A 3HOVI 2W03A 2PM9A 3VTNA 2NVQI 1S72Z 3LUSA 4NBHA 4E2WA 2NVXI 4QTTA 4BY7I 3F3PC 2B63I 1JJ2Z 4NBEA 2RBLA 1VQ9Z 1RLYA 1NUIA 1Q821 3G711 2JR6A 1YI21 1WIIA 2JNYA 2Q4ZA 3CCQ1 1RO0A 4RVHA 5IT9f 5FLMI 2O53A 3CC71 2I3CA 4NBDA 1I3QI 5D1OB 1X0TA 1VQN1 1YHQ1 1VQKZ 1VQ61 4A3BI 3CXCY 4DK1A 1Z01A 3NH5A 4QTUA 3NH8A 4RVGA 2HF1A 3JAMb 5IP9I 2JA5I 3G6E1 4E2ZA 4E2YA 3CCR1 1K8A1 5A2Qf 4X6AI 4XX2A 3CCL1 4A3LI 3OW2Z 1YJWZ 4NOZA 2QA4Z 3P5JB 2E2HI 4A93I 3NFZA 3CCV1 3ESWA 1VQOZ 3I561 3G71Z 1VQ51 1YI2Z 1M901 3U50C 1M1K1 3GTPI 1Q862 3CC21 3CQZI 4BY1I 2E9HA 2AKLA 3HOWI 2YU9I 2VUMI 3CC7Z 1YIJ1 3S15I 1VQ81 3GTOI 1VQNZ 1YHQZ 3HOYI 3G4S1 1Z02A 3D6WA 2IZ4A 3I55Z 3HOUI 4S1TA 1QF8A 2F4OA 3TE5B 2K5RA 3G6EZ 3CME1 1I50I 4BXXI 2P3YA 3CCLZ 2W04A 3CCJ1 4RVDA 1VQ41 1Y1VS 1YUKA 3MZKB 3EEDA 3MZLB 1RNIA 1YIT1 3NDJA 4MD8A 3CCVZ 1K731 3OW2Y 2V8KA 1K9M2 3T4NB 2OZKA 3BG0B 3I56Z 1M1K2 1VQ5Z 3JAMf 2RIQA 2Y0SA 3CC2Z 3CCU1 4MRIA 1VQ7Z 2JMOA 1KC81 4HH4A 3GKQA 3CPWZ 2NVYI 1YIJZ 4A3DI 4DGLA 1N8R1 3G4SZ 1SFOI 2GTIA 3CCM1 3TDHB 4E33A 1L1OC 1TWAI 3GTJI 2PK7A 1VQLZ 3J81b 3GTGI 2DE5A 2OTL1 3VMHA 5C4JI 3J80b 1USPB 4CL1A 1R9TI 2JA7I 2JS4A 1YJN1 2LFUA 3S2DI 1VQ4Z 3IFUA 3S14I 1TWGI 1JWHC 3HOZI 2QREB 5T67A 2DE7A 2PMZA 4E2XA 2ZAEB 4MONA 1P9NA 3IF8A 3S1NI 1VQMZ 1KQSZ 3CCUZ 1KC82 2GU2A 1TWHI 1ZB9A 2IZ3A 4MD9A 1W2BZ 1KRLA 2WAQA 3GCFA 3CCMZ 5T64A 1QVGZ 2J6AA 4HGZA 1ML8A 1TFIA 4NBGA 5T6BA 1Q822 1ZH1A 1YJNZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAM b;  5FLX b;  5A2Q b;  5LL6 f;  3J7A 4;  3J80 b;  3J81 b;  5IT9 b; 
#chains in the Genus database with same CATH topology
 1X3Z A;  1Z03 A;  5FLX b;  1RQF A;  3BG1 B;  1RO2 A;  3KIH A;  1JJ2 Y;  3CCQ Z;  3GTQ I;  1RO4 A;  1NJI 1;  2V45 A;  4TNU A;  2QEX 1;  4A3G I;  1KD1 1;  1VQ6 Z;  1Q81 1;  3S16 I;  4Y7N I;  1QVF Z;  2M6N A;  2K3R A;  5LL6 f;  2VUG A;  1TWC I;  4NH1 C;  1PFT A;  3GTK I;  1N2F A;  1NP6 A;  2R7Z I;  1K8A 2;  3CCR Z;  1Y1W I;  1Q7Y 1;  3RZO I;  2VPY A;  4A3C I;  5IT9 b;  1TWF I;  1S72 1;  2AYD A;  1VLA A;  1WZN A;  2RPR A;  3H3V J;  4RVF A;  3S2H I;  1M90 2;  1VQP 1;  4A3M I;  5D1P A;  3HKZ A;  3MON A;  2V8J A;  3VMI A;  5A2Q b;  3H0G I;  5IP7 I;  1VQ8 Z;  2QEX Z;  3NDI A;  1S7M A;  3M3Y I;  3J7A 4;  4E31 A;  5C44 I;  4MXU A;  3S1R I;  3IR7 A;  1VQK 1;  2G2K A;  2DE6 A;  3S1Q I;  4DQY B;  1Y8C A;  3CME Z;  1YJ9 1;  2JIQ A;  4A3K I;  3CCJ Z;  2V8I A;  2BJO A;  2IV2 X;  3KIF A;  3I4N I;  5D1O A;  2QKD A;  3M4O I;  1YIT Z;  1K73 2;  3IX0 A;  3RZD I;  1YJW 1;  5CM2 M;  3VMG A;  2VF1 A;  2QA4 1;  2NAP A;  5C4X I;  3GTM I;  2R92 I;  2JUB A;  1VQP Z;  2QRD B;  4A3I I;  4NBB A;  1VQO 1;  1I6H I;  3K7A I;  3F3F C;  3I07 A;  2JA8 I;  2V3V A;  3QWU A;  1Q86 1;  1N8R 2;  5AN9 F;  2KPI A;  4NBF A;  3Q87 A;  3CC4 1;  3CPW Y;  5C3E I;  4E32 A;  2Q51 A;  4A3J I;  2OOX B;  2RT9 A;  1YUA A;  2OTL Z;  1YJ9 Z;  2OTJ 1;  3FKI I;  2QR1 B;  3I55 1;  3CMA 1;  4AYB A;  3CD6 1;  2QRC B;  2VPZ A;  2OOY B;  3CCS 1;  4NFR A;  3CCE 1;  2GTH A;  2E2J I;  1WCM I;  2JIP A;  1QXF A;  2QLV B;  2KI7 B;  2RHB A;  2YAD A;  2M48 A;  3EER A;  4HGY A;  3VB9 A;  2E2I I;  3J81 f;  1ZB8 A;  3FQQ A;  2P28 A;  1QYP A;  2VPW A;  3J80 f;  1K9M 1;  2JIR A;  2JA6 I;  2WB1 A;  1LQL A;  2LIY A;  3PO3 S;  3NH4 A;  1KQS Y;  1VQ7 1;  3I4M I;  4NB8 A;  2F4M A;  3GTL I;  3CC4 Z;  4EWC A;  4A3E I;  4MD7 A;  1WW9 A;  4NBA A;  1DL6 A;  2R93 I;  1W2B Y;  4NBC A;  3PO3 I;  1VQL 1;  2OTJ Z;  3CD6 Z;  3CMA Z;  1QVG Y;  2R6M A;  4RS4 A;  3CCS Z;  3FQM A;  1K83 I;  3CCE Z;  4Y52 I;  4E30 A;  4NB9 A;  1VQ9 1;  1X3W A;  4MH4 A;  1NJI 2;  3PO2 I;  4A3F I;  1KD1 2;  2VPX A;  1Q81 2;  2H85 A;  3CXC Z;  3S17 I;  4BBR I;  4BBS I;  2LEX A;  1USP A;  2EGT A;  3S1M I;  3D9X A;  1VQM 1;  3HOX I;  2O4H A;  1Y1V I;  5FLX f;  1QVF Y;  3GTM S;  1Q7Y 2;  2NVT I;  4RV9 A;  2HU9 A;  3HOV I;  2W03 A;  2PM9 A;  2JIM A;  3VTN A;  2NVQ I;  1S72 Z;  3LUS A;  4NBH A;  4E2W A;  2NVX I;  4QTT A;  4BY7 I;  3F3P C;  2B63 I;  1JJ2 Z;  4NBE A;  2RBL A;  1VQ9 Z;  1RLY A;  1NUI A;  1Q82 1;  3G71 1;  2JR6 A;  1YI2 1;  1WII A;  2JNY A;  2Q4Z A;  1FDO A;  3CCQ 1;  1RO0 A;  4RVH A;  5IT9 f;  5FLM I;  2O53 A;  3CC7 1;  2I3C A;  4NBD A;  1I3Q I;  5D1O B;  1X0T A;  1VQN 1;  1YHQ 1;  1VQK Z;  1VQ6 1;  4A3B I;  3CXC Y;  4DK1 A;  1Z01 A;  3NH5 A;  4QTU A;  2E7Z A;  3NH8 A;  4RVG A;  2HF1 A;  3JAM b;  5IP9 I;  2JA5 I;  3G6E 1;  4E2Z A;  4E2Y A;  3CCR 1;  1K8A 1;  5A2Q f;  4X6A I;  4XX2 A;  3CCL 1;  4A3L I;  3OW2 Z;  1YJW Z;  4NOZ A;  2QA4 Z;  3P5J B;  2E2H I;  4A93 I;  3NFZ A;  3CCV 1;  1Q16 A;  3ESW A;  1VQO Z;  3I56 1;  3G71 Z;  1VQ5 1;  1YI2 Z;  1M90 1;  3U50 C;  1M1K 1;  3GTP I;  1Q86 2;  3CC2 1;  3CQZ I;  4BY1 I;  1WJ2 A;  2E9H A;  2AKL A;  3HOW I;  2YU9 I;  2VUM I;  3CC7 Z;  1YIJ 1;  3S15 I;  1VQ8 1;  3GTO I;  1VQN Z;  1YHQ Z;  3HOY I;  3G4S 1;  1Z02 A;  3D6W A;  2IZ4 A;  3I55 Z;  3HOU I;  4S1T A;  1QF8 A;  2F4O A;  3TE5 B;  2K5R A;  3G6E Z;  3CME 1;  1I50 I;  4BXX I;  2P3Y A;  3CCL Z;  2W04 A;  3CCJ 1;  4RVD A;  3D2L A;  1VQ4 1;  1Y1V S;  1YUK A;  3MZK B;  3EED A;  3MZL B;  1RNI A;  1YIT 1;  3NDJ A;  4MD8 A;  3CCV Z;  1K73 1;  3OW2 Y;  2V8K A;  1K9M 2;  3T4N B;  2OZK A;  3BG0 B;  3I56 Z;  1M1K 2;  1VQ5 Z;  3JAM f;  2RIQ A;  2Y0S A;  3CC2 Z;  3CCU 1;  4MRI A;  1VQ7 Z;  2JMO A;  1KC8 1;  4HH4 A;  3GKQ A;  3CPW Z;  2NVY I;  1SIW A;  1YIJ Z;  4A3D I;  4DGL A;  1N8R 1;  3G4S Z;  1SFO I;  2GTI A;  3CCM 1;  3TDH B;  4E33 A;  1L1O C;  1TWA I;  3GTJ I;  2PK7 A;  1VQL Z;  3J81 b;  1FDI A;  1AA6 A;  3GTG I;  2DE5 A;  2OTL 1;  3VMH A;  5C4J I;  3J80 b;  1USP B;  4CL1 A;  1R9T I;  2JA7 I;  2JS4 A;  1YJN 1;  2LFU A;  3S2D I;  1VQ4 Z;  3IFU A;  3S14 I;  1TWG I;  1JWH C;  3HOZ I;  2QRE B;  5T67 A;  2DE7 A;  2PMZ A;  4E2X A;  2ZAE B;  4MON A;  1P9N A;  3IF8 A;  3S1N I;  1VQM Z;  1KQS Z;  3CCU Z;  1KC8 2;  2GU2 A;  1TWH I;  1ZB9 A;  2IZ3 A;  4MD9 A;  1W2B Z;  1KRL A;  2WAQ A;  3GCF A;  3CCM Z;  5T64 A;  1QVG Z;  2JIO A;  2J6A A;  4HGZ A;  1ML8 A;  1TFI A;  4NBG A;  5T6B A;  1Q82 2;  1ZH1 A;  1YJN Z; 
#chains in the Genus database with same CATH homology
 1X3Z A;  1Z03 A;  5FLX b;  1RQF A;  3BG1 B;  1RO2 A;  3KIH A;  1JJ2 Y;  3CCQ Z;  3GTQ I;  1RO4 A;  1NJI 1;  4TNU A;  2QEX 1;  4A3G I;  1KD1 1;  1VQ6 Z;  1Q81 1;  3S16 I;  4Y7N I;  1QVF Z;  2M6N A;  2K3R A;  5LL6 f;  2VUG A;  1TWC I;  4NH1 C;  1PFT A;  3GTK I;  1N2F A;  1NP6 A;  2R7Z I;  1K8A 2;  3CCR Z;  1Y1W I;  1Q7Y 1;  3RZO I;  4A3C I;  5IT9 b;  1TWF I;  1S72 1;  1VLA A;  2RPR A;  3H3V J;  4RVF A;  3S2H I;  1M90 2;  1VQP 1;  4A3M I;  5D1P A;  3HKZ A;  3MON A;  2V8J A;  3VMI A;  5A2Q b;  3H0G I;  5IP7 I;  1VQ8 Z;  2QEX Z;  3NDI A;  1S7M A;  3M3Y I;  3J7A 4;  4E31 A;  5C44 I;  4MXU A;  3S1R I;  1VQK 1;  2G2K A;  2DE6 A;  3S1Q I;  4DQY B;  3CME Z;  1YJ9 1;  4A3K I;  3CCJ Z;  2V8I A;  2BJO A;  3I4N I;  3KIF A;  5D1O A;  2QKD A;  3M4O I;  1YIT Z;  1K73 2;  3IX0 A;  3RZD I;  1YJW 1;  5CM2 M;  3VMG A;  2VF1 A;  2QA4 1;  5C4X I;  3GTM I;  2R92 I;  2JUB A;  1VQP Z;  2QRD B;  4A3I I;  4NBB A;  1VQO 1;  1I6H I;  3K7A I;  3F3F C;  3I07 A;  2JA8 I;  3QWU A;  1Q86 1;  1N8R 2;  5AN9 F;  2KPI A;  4NBF A;  3Q87 A;  3CC4 1;  3CPW Y;  5C3E I;  4E32 A;  2Q51 A;  4A3J I;  2OOX B;  2RT9 A;  1YUA A;  2OTL Z;  1YJ9 Z;  2OTJ 1;  3FKI I;  2QR1 B;  3I55 1;  3CMA 1;  4AYB A;  3CD6 1;  2QRC B;  2OOY B;  3CCS 1;  4NFR A;  3CCE 1;  2GTH A;  2E2J I;  1WCM I;  2QLV B;  2KI7 B;  2RHB A;  2YAD A;  2M48 A;  3EER A;  4HGY A;  3VB9 A;  2E2I I;  3J81 f;  1ZB8 A;  3FQQ A;  2P28 A;  1QYP A;  3J80 f;  1K9M 1;  2JA6 I;  2WB1 A;  1LQL A;  2LIY A;  3PO3 S;  3NH4 A;  1KQS Y;  1VQ7 1;  3I4M I;  4NB8 A;  2F4M A;  3GTL I;  3CC4 Z;  4EWC A;  4A3E I;  4MD7 A;  1WW9 A;  4NBA A;  1DL6 A;  2R93 I;  1W2B Y;  4NBC A;  3PO3 I;  1VQL 1;  2OTJ Z;  3CD6 Z;  3CMA Z;  1QVG Y;  2R6M A;  4RS4 A;  3CCS Z;  3FQM A;  1K83 I;  3CCE Z;  4Y52 I;  4E30 A;  4NB9 A;  1VQ9 1;  1X3W A;  4MH4 A;  1NJI 2;  3PO2 I;  4A3F I;  1KD1 2;  1Q81 2;  2H85 A;  3CXC Z;  3S17 I;  4BBR I;  4BBS I;  1USP A;  2EGT A;  3S1M I;  3D9X A;  1VQM 1;  3HOX I;  2O4H A;  1Y1V I;  5FLX f;  1QVF Y;  3GTM S;  1Q7Y 2;  2NVT I;  4RV9 A;  2HU9 A;  3HOV I;  2W03 A;  2PM9 A;  3VTN A;  2NVQ I;  1S72 Z;  3LUS A;  4NBH A;  4E2W A;  2NVX I;  4QTT A;  4BY7 I;  3F3P C;  2B63 I;  1JJ2 Z;  4NBE A;  2RBL A;  1VQ9 Z;  1RLY A;  1NUI A;  1Q82 1;  3G71 1;  2JR6 A;  1YI2 1;  1WII A;  2JNY A;  2Q4Z A;  3CCQ 1;  1RO0 A;  4RVH A;  5IT9 f;  5FLM I;  2O53 A;  3CC7 1;  2I3C A;  4NBD A;  1I3Q I;  5D1O B;  1X0T A;  1VQN 1;  1YHQ 1;  1VQK Z;  1VQ6 1;  4A3B I;  3CXC Y;  4DK1 A;  1Z01 A;  3NH5 A;  4QTU A;  3NH8 A;  4RVG A;  2HF1 A;  3JAM b;  5IP9 I;  2JA5 I;  3G6E 1;  4E2Z A;  4E2Y A;  3CCR 1;  1K8A 1;  5A2Q f;  4X6A I;  4XX2 A;  3CCL 1;  4A3L I;  3OW2 Z;  1YJW Z;  4NOZ A;  2QA4 Z;  3P5J B;  2E2H I;  4A93 I;  3NFZ A;  3CCV 1;  3ESW A;  1VQO Z;  3I56 1;  3G71 Z;  1VQ5 1;  1YI2 Z;  1M90 1;  3U50 C;  1M1K 1;  3GTP I;  1Q86 2;  3CC2 1;  3CQZ I;  4BY1 I;  2E9H A;  2AKL A;  3HOW I;  2YU9 I;  2VUM I;  3CC7 Z;  1YIJ 1;  3S15 I;  1VQ8 1;  3GTO I;  1VQN Z;  1YHQ Z;  3HOY I;  3G4S 1;  1Z02 A;  3D6W A;  2IZ4 A;  3I55 Z;  3HOU I;  4S1T A;  1QF8 A;  2F4O A;  3TE5 B;  2K5R A;  3G6E Z;  3CME 1;  1I50 I;  4BXX I;  2P3Y A;  3CCL Z;  2W04 A;  3CCJ 1;  4RVD A;  1VQ4 1;  1Y1V S;  1YUK A;  3MZK B;  3EED A;  3MZL B;  1RNI A;  1YIT 1;  3NDJ A;  4MD8 A;  3CCV Z;  1K73 1;  3OW2 Y;  2V8K A;  1K9M 2;  3T4N B;  2OZK A;  3BG0 B;  3I56 Z;  1M1K 2;  1VQ5 Z;  3JAM f;  2RIQ A;  2Y0S A;  3CC2 Z;  3CCU 1;  4MRI A;  1VQ7 Z;  2JMO A;  1KC8 1;  4HH4 A;  3GKQ A;  3CPW Z;  2NVY I;  1YIJ Z;  4A3D I;  4DGL A;  1N8R 1;  3G4S Z;  1SFO I;  2GTI A;  3CCM 1;  3TDH B;  4E33 A;  1L1O C;  1TWA I;  3GTJ I;  2PK7 A;  1VQL Z;  3J81 b;  3GTG I;  2DE5 A;  2OTL 1;  3VMH A;  5C4J I;  3J80 b;  1USP B;  4CL1 A;  1R9T I;  2JA7 I;  2JS4 A;  1YJN 1;  2LFU A;  3S2D I;  1VQ4 Z;  3IFU A;  3S14 I;  1TWG I;  1JWH C;  3HOZ I;  2QRE B;  5T67 A;  2DE7 A;  2PMZ A;  4E2X A;  2ZAE B;  4MON A;  1P9N A;  3IF8 A;  3S1N I;  1VQM Z;  1KQS Z;  3CCU Z;  1KC8 2;  2GU2 A;  1TWH I;  1ZB9 A;  2IZ3 A;  4MD9 A;  1W2B Z;  1KRL A;  2WAQ A;  3GCF A;  3CCM Z;  5T64 A;  1QVG Z;  2J6A A;  4HGZ A;  1ML8 A;  1TFI A;  4NBG A;  5T6B A;  1Q82 2;  1ZH1 A;  1YJN Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...