2OTJZ

13-deoxytedanolide bound to the large subunit of haloarcula marismortui
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2007-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2otjZ00
1VQ71 1VQL1 1QVFZ 1VQK1 3CMEZ 1KQSZ 2OTL1 1YJN1 1VQ8Z 1N8R2 3CC41 1VQP1 3G6E1 1N8R1 1KD11 3CCJZ 1JJ2Y 3CC21 1VQ5Z 1YITZ 3CCLZ 2QA4Z 3CCQZ 3CCRZ 1VQO1 1S72Z 2QA41 1YJ9Z 1KQSY 1VQ7Z 1VQLZ 3CC71 1YJ91 1VQKZ 3CCMZ 2OTLZ 1YJNZ 3CC4Z 1VQPZ 3I55Z 3G6EZ 3CCM1 1KD12 3CC2Z 1M901 3I551 1M1K2 1VQOZ 3CPWY 1VQN1 1M1K1 1VQM1 1VQ61 1VQ91 3CXCY 1QVGZ 3CC7Z 3CCS1 3G4S1 1YHQ1 1YIJ1 3CPWZ 3CXCZ 3I56Z 3OW2Y 1YI21 1K8A1 1Q861 3CMA1 2QEX1 1M902 1VQNZ 1QVGY 3CCU1 1VQMZ 1VQ9Z 1VQ6Z 3OW2Z 1K9M2 3CCSZ 1Q811 3G711 3G4SZ 1W2BZ 1YHQZ 1YIJZ 1K9M1 1Q7Y2 1VQ4Z 1YJW1 2OTJ1 1Q7Y1 1VQ41 3CCVZ 3CD61 1YI2Z 3I561 3CCE1 1K8A2 3CMAZ 3CCV1 1Q862 2QEXZ 3CCUZ 1NJI2 3CME1 1W2BY 1KC82 1VQ81 1NJI1 1KC81 3G71Z 3CCJ1 1Q812 1VQ51 1YIT1 3CCL1 1YJWZ 1K732 1QVFY 3CCQ1 3CCR1 2OTJZ 1S721 1JJ2Z 1K731 1Q822 3CD6Z 1Q821 3CCEZ
chains in the Genus database with same CATH superfamily
3IF8A 5AN9F 4A3JI 1Y8CA 4QTUA 3GTLI 3CMEZ 5IT9b 4DGLA 2OTL1 5D1OB 3FQMA 4Y7NI 2JMOA 1P9NA 1VQP1 2JNYA 3G6E1 2I3CA 3CC21 5T67A 4NBDA 2QA4Z 2JR6A 4BBRI 1RO0A 3CCQZ 1ZB9A 1VQO1 1N2FA 4NB9A 3M3YI 1FDOA 3I07A 2QA41 1LQLA 1VQ7Z 2RBLA 1VQLZ 3H3VJ 4A3DI 4E32A 1QF8A 4DK1A 2H85A 2E9HA 4A3BI 1ZB8A 2IZ3A 3TDHB 1M1K2 2NVYI 2Q51A 2QRCB 4E30A 2JIRA 2JA7I 1VQ91 1ZH1A 1TWCI 3S2DI 4A3CI 1YIJ1 4QTTA 3VMIA 1Y1WI 1K8A1 3IX0A 4A3KI 5FLXb 4NBGA 1QVGY 1VQMZ 2OZKA 5A2Qb 1K9M2 3S1MI 3FQQA 4XX2A 3G711 1W2BZ 3MONA 4E31A 1YJW1 1Q16A 3F3FC 2EGTA 1RNIA 3CD61 4Y52I 2F4OA 2P28A 4AYBA 1I6HI 2QREB 1K8A2 3QWUA 3FKII 1Z03A 3HOWI 3NFZA 1WW9A 3MZLB 5LL6f 1NJI1 4A93I 1SFOI 2NAPA 3J80f 4E2XA 2DE5A 2DE6A 4BBSI 3BG0B 2P3YA 1Z02A 3D9XA 3CCEZ 3JAMb 4MONA 3I56Z 2QKDA 5IP9I 3I4MI 1VQK1 1TWAI 1YJN1 1VQ8Z 5IT9f 1WIIA 1N8R2 4NH1C 2E2HI 3H0GI 3IFUA 1YITZ 2V8IA 3NH5A 3CCRZ 3M4OI 2IZ4A 1YUKA 2O4HA 2NVQI 2K5RA 3CC71 3HOUI 2RIQA 2OTLZ 1VQPZ 3I55Z 3G6EZ 3CC2Z 5C44I 3RZOI 3I551 1VQOZ 3CPWY 3D6WA 2GU2A 1M1K1 1TFIA 1USPA 3GTMI 2M6NA 1QVGZ 2V8KA 2ZAEB 3VB9A 2R6MA 3S2HI 1Y1VS 1VLAA 3CXCZ 4BY1I 4MD9A 4S1TA 2QEX1 4HH4A 2R93I 2VF1A 1VQ9Z 2V3VA 5FLXf 2QLVB 2JA8I 3NH8A 2LIYA 5A2Qf 3OW2Z 1YIJZ 1K9M1 2JA5I 1Q7Y2 1VQ4Z 2E2JI 2BJOA 2KI7B 2OTJ1 1FDIA 1VQ41 3CCVZ 1KRLA 2LEXA 1USPB 2WAQA 3S15I 3CCV1 4NFRA 3VMGA 2WB1A 2VPXA 1WJ2A 4TNUA 3GTJI 3GTOI 3G71Z 3CCJ1 1TWGI 4RVHA 4E2ZA 2OOYB 1VQ51 3CCL1 2V8JA 1YJWZ 1X3ZA 1K732 3J81b 1S721 1Z01A 2JUBA 2YADA 3CD6Z 3NH4A 2NVXI 2JS4A 4RVDA 3PO3S 3JAMf 1QVFZ 2F4MA 1DL6A 2JIMA 4A3EI 1S7MA 3CC41 3S14I 1N8R1 3GKQA 1KD11 1RQFA 4A3MI 2VUMI 3VTNA 2VPYA 1KQSY 2Q4ZA 5IP7I 1TWHI 3HOVI 1VQKZ 3Q87A 1YJNZ 1NUIA 2PK7A 2QRDB 3PO2I 4HGZA 1KD12 1M901 1VQN1 2J6AA 1VQ61 3CQZI 3EERA 4NB8A 2VUGA 3CC7Z 3CCS1 3G4S1 4A3GI 1YHQ1 4NBBA 3KIHA 3S16I 4DQYB 3D2LA 1YI21 1Q861 2OOXB 3CMA1 1M902 5FLMI 1YUAA 3CCU1 4NBEA 4NBAA 1I50I 2VPWA 4E2YA 1Q811 3HOYI 4NBCA 1Q7Y1 2M48A 4BY7I 2W03A 2E2II 3IR7A 1Q862 2QEXZ 4A3FI 5C4XI 4NOZA 2AYDA 1L1OC 2V45A 5T6BA 3CME1 2W04A 1KC82 2PMZA 2VPZA 3TE5B 2DE7A 3EEDA 3ESWA 4RVGA 3NDJA 3S17I 1QYPA 2R92I 1Q812 4MD8A 4MRIA 3CCQ1 2OTJZ 2KPIA 1K731 1Q822 2HU9A 3J81f 3F3PC 2YU9I 1TWFI 1VQ71 1Y1VI 1VQL1 3K7AI 2R7ZI 1KQSZ 3RZDI 3BG1B 3GTPI 1RO2A 3MZKB 4E33A 3CCJZ 1JJ2Y 2AKLA 3S1NI 1VQ5Z 3CCLZ 4NBFA 5D1PA 4A3LI 1S72Z 2HF1A 2O53A 1YJ9Z 1RO4A 1SIWA 3GTKI 3J7A4 4RV9A 4BXXI 1YJ91 2GTHA 3CCMZ 1WCMI 4RS4A 2LFUA 4CL1A 3S1RI 2IV2X 3CC4Z 5CM2M 1X3WA 3CCM1 3GTGI 5C3EI 1ML8A 3GTQI 3LUSA 1X0TA 2JA6I 2G2KA 1VQM1 3KIFA 1RLYA 1QXFA 3CXCY 1K83I 4X6AI 2JIQA 1NP6A 3CPWZ 2RHBA 3T4NB 3P5JB 1PFTA 3PO3I 3HKZA 2RT9A 3OW2Y 1WZNA 3U50C 2QR1B 1VQNZ 1VQ6Z 4RVFA 2Y0SA 2RPRA 2GTIA 2JIPA 4MXUA 3CCSZ 3G4SZ 1YHQZ 3S1QI 3HOZI 2NVTI 3VMHA 5D1OA 5C4JI 1AA6A 3I4NI 1YI2Z 4MH4A 3I561 3CCE1 4HGYA 3CMAZ 3HOXI 2PM9A 3CCUZ 1NJI2 1W2BY 1R9TI 4A3II 1VQ81 1JWHC 3J80b 1KC81 2K3RA 2E7ZA 4E2WA 5T64A 1YIT1 1QVFY 3GTMS 1I3QI 3GCFA 3CCR1 1JJ2Z 4MD7A 4NBHA 3NDIA 1Q821 4EWCA 2JIOA 2B63I
chains in the Genus database with same CATH topology
3IF8A 5AN9F 4A3JI 4QTUA 3GTLI 3CMEZ 5IT9b 4DGLA 2OTL1 5D1OB 3FQMA 4Y7NI 2JMOA 1P9NA 1VQP1 2JNYA 3G6E1 2I3CA 3CC21 5T67A 4NBDA 2QA4Z 2JR6A 4BBRI 1RO0A 3CCQZ 1ZB9A 1VQO1 1N2FA 4NB9A 3M3YI 3I07A 2QA41 1LQLA 1VQ7Z 2RBLA 1VQLZ 3H3VJ 4A3DI 4E32A 1QF8A 4DK1A 2H85A 2E9HA 4A3BI 1ZB8A 2IZ3A 3TDHB 1M1K2 2NVYI 2Q51A 2QRCB 4E30A 2JA7I 1VQ91 1ZH1A 1TWCI 3S2DI 4A3CI 1YIJ1 4QTTA 3VMIA 1Y1WI 1K8A1 3IX0A 4A3KI 5FLXb 4NBGA 1QVGY 1VQMZ 2OZKA 5A2Qb 1K9M2 3S1MI 3FQQA 4XX2A 3G711 1W2BZ 3MONA 4E31A 1YJW1 3F3FC 2EGTA 1RNIA 3CD61 4Y52I 2F4OA 2P28A 4AYBA 1I6HI 2QREB 1K8A2 3QWUA 3FKII 1Z03A 3HOWI 3NFZA 1WW9A 3MZLB 5LL6f 1NJI1 4A93I 1SFOI 3J80f 4E2XA 2DE5A 2DE6A 4BBSI 3BG0B 2P3YA 1Z02A 3D9XA 3CCEZ 3JAMb 4MONA 3I56Z 2QKDA 5IP9I 3I4MI 1VQK1 1TWAI 1YJN1 1VQ8Z 5IT9f 1WIIA 1N8R2 4NH1C 2E2HI 3H0GI 3IFUA 1YITZ 2V8IA 3NH5A 3CCRZ 3M4OI 2IZ4A 1YUKA 2O4HA 2NVQI 2K5RA 3CC71 3HOUI 2RIQA 2OTLZ 1VQPZ 3I55Z 3G6EZ 3CC2Z 5C44I 3RZOI 3I551 1VQOZ 3CPWY 3D6WA 2GU2A 1M1K1 1TFIA 1USPA 3GTMI 2M6NA 1QVGZ 2V8KA 2ZAEB 3VB9A 2R6MA 3S2HI 1Y1VS 1VLAA 3CXCZ 4BY1I 4MD9A 4S1TA 2QEX1 4HH4A 2R93I 2VF1A 1VQ9Z 5FLXf 2QLVB 2JA8I 3NH8A 2LIYA 5A2Qf 3OW2Z 1YIJZ 1K9M1 2JA5I 1Q7Y2 1VQ4Z 2E2JI 2BJOA 2KI7B 2OTJ1 1VQ41 3CCVZ 1KRLA 1USPB 2WAQA 3S15I 3CCV1 4NFRA 3VMGA 2WB1A 4TNUA 3GTJI 3GTOI 3G71Z 3CCJ1 1TWGI 4RVHA 4E2ZA 2OOYB 1VQ51 3CCL1 2V8JA 1YJWZ 1X3ZA 1K732 3J81b 1S721 1Z01A 2JUBA 2YADA 3CD6Z 3NH4A 2NVXI 2JS4A 4RVDA 3PO3S 3JAMf 1QVFZ 2F4MA 1DL6A 4A3EI 1S7MA 3CC41 3S14I 1N8R1 3GKQA 1KD11 1RQFA 4A3MI 2VUMI 3VTNA 1KQSY 2Q4ZA 5IP7I 1TWHI 3HOVI 1VQKZ 3Q87A 1YJNZ 1NUIA 2PK7A 2QRDB 3PO2I 4HGZA 1KD12 1M901 1VQN1 2J6AA 1VQ61 3CQZI 3EERA 4NB8A 2VUGA 3CC7Z 3CCS1 3G4S1 4A3GI 1YHQ1 4NBBA 3KIHA 3S16I 4DQYB 1YI21 1Q861 2OOXB 3CMA1 1M902 5FLMI 1YUAA 3CCU1 4NBEA 4NBAA 1I50I 4E2YA 1Q811 3HOYI 4NBCA 1Q7Y1 2M48A 4BY7I 2W03A 2E2II 1Q862 2QEXZ 4A3FI 5C4XI 4NOZA 3CME1 1L1OC 5T6BA 2W04A 1KC82 2PMZA 3TE5B 2DE7A 3EEDA 3ESWA 4RVGA 3NDJA 3S17I 1QYPA 2R92I 1Q812 4MD8A 4MRIA 3CCQ1 2OTJZ 2KPIA 1K731 1Q822 2HU9A 3J81f 3F3PC 2YU9I 1TWFI 1VQ71 1Y1VI 1VQL1 3K7AI 2R7ZI 1KQSZ 3RZDI 3BG1B 3GTPI 1RO2A 3MZKB 4E33A 3CCJZ 1JJ2Y 2AKLA 3S1NI 1VQ5Z 3CCLZ 4NBFA 5D1PA 4A3LI 1S72Z 2HF1A 2O53A 1YJ9Z 1RO4A 3GTKI 3J7A4 4RV9A 4BXXI 1YJ91 2GTHA 3CCMZ 1WCMI 4RS4A 2LFUA 4CL1A 3S1RI 3CC4Z 5CM2M 1X3WA 3CCM1 3GTGI 5C3EI 1ML8A 3GTQI 3LUSA 1X0TA 2JA6I 2G2KA 1VQM1 3KIFA 1RLYA 3CXCY 1K83I 4X6AI 1NP6A 3CPWZ 2RHBA 3T4NB 3P5JB 1PFTA 3PO3I 3HKZA 2RT9A 3OW2Y 3U50C 2QR1B 1VQNZ 1VQ6Z 4RVFA 2Y0SA 2RPRA 2GTIA 4MXUA 3CCSZ 3G4SZ 1YHQZ 3S1QI 3HOZI 2NVTI 3VMHA 5D1OA 5C4JI 3I4NI 1YI2Z 4MH4A 3I561 3CCE1 4HGYA 3CMAZ 3HOXI 2PM9A 3CCUZ 1NJI2 1W2BY 1R9TI 4A3II 1VQ81 1JWHC 3J80b 1KC81 2K3RA 4E2WA 5T64A 1YIT1 1QVFY 3GTMS 1I3QI 3GCFA 3CCR1 1JJ2Z 4MD7A 4NBHA 3NDIA 1Q821 4EWCA 2B63I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ7 1;  1VQL 1;  1QVF Z;  1VQK 1;  3CME Z;  1KQS Z;  2OTL 1;  1YJN 1;  1VQ8 Z;  1N8R 2;  3CC4 1;  1VQP 1;  3G6E 1;  1N8R 1;  1KD1 1;  3CCJ Z;  1JJ2 Y;  3CC2 1;  1VQ5 Z;  1YIT Z;  3CCL Z;  2QA4 Z;  3CCQ Z;  3CCR Z;  1VQO 1;  1S72 Z;  2QA4 1;  1YJ9 Z;  1KQS Y;  1VQ7 Z;  1VQL Z;  3CC7 1;  1YJ9 1;  1VQK Z;  3CCM Z;  2OTL Z;  1YJN Z;  3CC4 Z;  1VQP Z;  3I55 Z;  3G6E Z;  3CCM 1;  1KD1 2;  3CC2 Z;  1M90 1;  3I55 1;  1M1K 2;  1VQO Z;  3CPW Y;  1VQN 1;  1M1K 1;  1VQM 1;  1VQ6 1;  1VQ9 1;  3CXC Y;  1QVG Z;  3CC7 Z;  3CCS 1;  3G4S 1;  1YHQ 1;  1YIJ 1;  3CPW Z;  3CXC Z;  3I56 Z;  3OW2 Y;  1YI2 1;  1K8A 1;  1Q86 1;  3CMA 1;  2QEX 1;  1M90 2;  1VQN Z;  1QVG Y;  3CCU 1;  1VQM Z;  1VQ9 Z;  1VQ6 Z;  3OW2 Z;  1K9M 2;  3CCS Z;  1Q81 1;  3G71 1;  3G4S Z;  1W2B Z;  1YHQ Z;  1YIJ Z;  1K9M 1;  1Q7Y 2;  1VQ4 Z;  1YJW 1;  2OTJ 1;  1Q7Y 1;  1VQ4 1;  3CCV Z;  3CD6 1;  1YI2 Z;  3I56 1;  3CCE 1;  1K8A 2;  3CMA Z;  3CCV 1;  1Q86 2;  2QEX Z;  3CCU Z;  1NJI 2;  3CME 1;  1W2B Y;  1KC8 2;  1VQ8 1;  1NJI 1;  1KC8 1;  3G71 Z;  3CCJ 1;  1Q81 2;  1VQ5 1;  1YIT 1;  3CCL 1;  1YJW Z;  1K73 2;  1QVF Y;  3CCQ 1;  3CCR 1;  2OTJ Z;  1S72 1;  1JJ2 Z;  1K73 1;  1Q82 2;  3CD6 Z;  1Q82 1;  3CCE Z; 
#chains in the Genus database with same CATH topology
 3IF8 A;  5AN9 F;  4A3J I;  1Y8C A;  4QTU A;  3GTL I;  3CME Z;  5IT9 b;  4DGL A;  2OTL 1;  5D1O B;  3FQM A;  4Y7N I;  2JMO A;  1P9N A;  1VQP 1;  2JNY A;  3G6E 1;  2I3C A;  3CC2 1;  5T67 A;  4NBD A;  2QA4 Z;  2JR6 A;  4BBR I;  1RO0 A;  3CCQ Z;  1ZB9 A;  1VQO 1;  1N2F A;  4NB9 A;  3M3Y I;  1FDO A;  3I07 A;  2QA4 1;  1LQL A;  1VQ7 Z;  2RBL A;  1VQL Z;  3H3V J;  4A3D I;  4E32 A;  1QF8 A;  4DK1 A;  2H85 A;  2E9H A;  4A3B I;  1ZB8 A;  2IZ3 A;  3TDH B;  1M1K 2;  2NVY I;  2Q51 A;  2QRC B;  4E30 A;  2JIR A;  2JA7 I;  1VQ9 1;  1ZH1 A;  1TWC I;  3S2D I;  4A3C I;  1YIJ 1;  4QTT A;  3VMI A;  1Y1W I;  1K8A 1;  3IX0 A;  4A3K I;  5FLX b;  4NBG A;  1QVG Y;  1VQM Z;  2OZK A;  5A2Q b;  1K9M 2;  3S1M I;  3FQQ A;  4XX2 A;  3G71 1;  1W2B Z;  3MON A;  4E31 A;  1YJW 1;  1Q16 A;  3F3F C;  2EGT A;  1RNI A;  3CD6 1;  4Y52 I;  2F4O A;  2P28 A;  4AYB A;  1I6H I;  2QRE B;  1K8A 2;  3QWU A;  3FKI I;  1Z03 A;  3HOW I;  3NFZ A;  1WW9 A;  3MZL B;  5LL6 f;  1NJI 1;  4A93 I;  1SFO I;  2NAP A;  3J80 f;  4E2X A;  2DE5 A;  2DE6 A;  4BBS I;  3BG0 B;  2P3Y A;  1Z02 A;  3D9X A;  3CCE Z;  3JAM b;  4MON A;  3I56 Z;  2QKD A;  5IP9 I;  3I4M I;  1VQK 1;  1TWA I;  1YJN 1;  1VQ8 Z;  5IT9 f;  1WII A;  1N8R 2;  4NH1 C;  2E2H I;  3H0G I;  3IFU A;  1YIT Z;  2V8I A;  3NH5 A;  3CCR Z;  3M4O I;  2IZ4 A;  1YUK A;  2O4H A;  2NVQ I;  2K5R A;  3CC7 1;  3HOU I;  2RIQ A;  2OTL Z;  1VQP Z;  3I55 Z;  3G6E Z;  3CC2 Z;  5C44 I;  3RZO I;  3I55 1;  1VQO Z;  3CPW Y;  3D6W A;  2GU2 A;  1M1K 1;  1TFI A;  1USP A;  3GTM I;  2M6N A;  1QVG Z;  2V8K A;  2ZAE B;  3VB9 A;  2R6M A;  3S2H I;  1Y1V S;  1VLA A;  3CXC Z;  4BY1 I;  4MD9 A;  4S1T A;  2QEX 1;  4HH4 A;  2R93 I;  2VF1 A;  1VQ9 Z;  2V3V A;  5FLX f;  2QLV B;  2JA8 I;  3NH8 A;  2LIY A;  5A2Q f;  3OW2 Z;  1YIJ Z;  1K9M 1;  2JA5 I;  1Q7Y 2;  1VQ4 Z;  2E2J I;  2BJO A;  2KI7 B;  2OTJ 1;  1FDI A;  1VQ4 1;  3CCV Z;  1KRL A;  2LEX A;  1USP B;  2WAQ A;  3S15 I;  3CCV 1;  4NFR A;  3VMG A;  2WB1 A;  2VPX A;  1WJ2 A;  4TNU A;  3GTJ I;  3GTO I;  3G71 Z;  3CCJ 1;  1TWG I;  4RVH A;  4E2Z A;  2OOY B;  1VQ5 1;  3CCL 1;  2V8J A;  1YJW Z;  1X3Z A;  1K73 2;  3J81 b;  1S72 1;  1Z01 A;  2JUB A;  2YAD A;  3CD6 Z;  3NH4 A;  2NVX I;  2JS4 A;  4RVD A;  3PO3 S;  3JAM f;  1QVF Z;  2F4M A;  1DL6 A;  2JIM A;  4A3E I;  1S7M A;  3CC4 1;  3S14 I;  1N8R 1;  3GKQ A;  1KD1 1;  1RQF A;  4A3M I;  2VUM I;  3VTN A;  2VPY A;  1KQS Y;  2Q4Z A;  5IP7 I;  1TWH I;  3HOV I;  1VQK Z;  3Q87 A;  1YJN Z;  1NUI A;  2PK7 A;  2QRD B;  3PO2 I;  4HGZ A;  1KD1 2;  1M90 1;  1VQN 1;  2J6A A;  1VQ6 1;  3CQZ I;  3EER A;  4NB8 A;  2VUG A;  3CC7 Z;  3CCS 1;  3G4S 1;  4A3G I;  1YHQ 1;  4NBB A;  3KIH A;  3S16 I;  4DQY B;  3D2L A;  1YI2 1;  1Q86 1;  2OOX B;  3CMA 1;  1M90 2;  5FLM I;  1YUA A;  3CCU 1;  4NBE A;  4NBA A;  1I50 I;  2VPW A;  4E2Y A;  1Q81 1;  3HOY I;  4NBC A;  1Q7Y 1;  2M48 A;  4BY7 I;  2W03 A;  2E2I I;  3IR7 A;  1Q86 2;  2QEX Z;  4A3F I;  5C4X I;  4NOZ A;  2AYD A;  1L1O C;  2V45 A;  5T6B A;  3CME 1;  2W04 A;  1KC8 2;  2PMZ A;  2VPZ A;  3TE5 B;  2DE7 A;  3EED A;  3ESW A;  4RVG A;  3NDJ A;  3S17 I;  1QYP A;  2R92 I;  1Q81 2;  4MD8 A;  4MRI A;  3CCQ 1;  2OTJ Z;  2KPI A;  1K73 1;  1Q82 2;  2HU9 A;  3J81 f;  3F3P C;  2YU9 I;  1TWF I;  1VQ7 1;  1Y1V I;  1VQL 1;  3K7A I;  2R7Z I;  1KQS Z;  3RZD I;  3BG1 B;  3GTP I;  1RO2 A;  3MZK B;  4E33 A;  3CCJ Z;  1JJ2 Y;  2AKL A;  3S1N I;  1VQ5 Z;  3CCL Z;  4NBF A;  5D1P A;  4A3L I;  1S72 Z;  2HF1 A;  2O53 A;  1YJ9 Z;  1RO4 A;  1SIW A;  3GTK I;  3J7A 4;  4RV9 A;  4BXX I;  1YJ9 1;  2GTH A;  3CCM Z;  1WCM I;  4RS4 A;  2LFU A;  4CL1 A;  3S1R I;  2IV2 X;  3CC4 Z;  5CM2 M;  1X3W A;  3CCM 1;  3GTG I;  5C3E I;  1ML8 A;  3GTQ I;  3LUS A;  1X0T A;  2JA6 I;  2G2K A;  1VQM 1;  3KIF A;  1RLY A;  1QXF A;  3CXC Y;  1K83 I;  4X6A I;  2JIQ A;  1NP6 A;  3CPW Z;  2RHB A;  3T4N B;  3P5J B;  1PFT A;  3PO3 I;  3HKZ A;  2RT9 A;  3OW2 Y;  1WZN A;  3U50 C;  2QR1 B;  1VQN Z;  1VQ6 Z;  4RVF A;  2Y0S A;  2RPR A;  2GTI A;  2JIP A;  4MXU A;  3CCS Z;  3G4S Z;  1YHQ Z;  3S1Q I;  3HOZ I;  2NVT I;  3VMH A;  5D1O A;  5C4J I;  1AA6 A;  3I4N I;  1YI2 Z;  4MH4 A;  3I56 1;  3CCE 1;  4HGY A;  3CMA Z;  3HOX I;  2PM9 A;  3CCU Z;  1NJI 2;  1W2B Y;  1R9T I;  4A3I I;  1VQ8 1;  1JWH C;  3J80 b;  1KC8 1;  2K3R A;  2E7Z A;  4E2W A;  5T64 A;  1YIT 1;  1QVF Y;  3GTM S;  1I3Q I;  3GCF A;  3CCR 1;  1JJ2 Z;  4MD7 A;  4NBH A;  3NDI A;  1Q82 1;  4EWC A;  2JIO A;  2B63 I; 
#chains in the Genus database with same CATH homology
 3IF8 A;  5AN9 F;  4A3J I;  4QTU A;  3GTL I;  3CME Z;  5IT9 b;  4DGL A;  2OTL 1;  5D1O B;  3FQM A;  4Y7N I;  2JMO A;  1P9N A;  1VQP 1;  2JNY A;  3G6E 1;  2I3C A;  3CC2 1;  5T67 A;  4NBD A;  2QA4 Z;  2JR6 A;  4BBR I;  1RO0 A;  3CCQ Z;  1ZB9 A;  1VQO 1;  1N2F A;  4NB9 A;  3M3Y I;  3I07 A;  2QA4 1;  1LQL A;  1VQ7 Z;  2RBL A;  1VQL Z;  3H3V J;  4A3D I;  4E32 A;  1QF8 A;  4DK1 A;  2H85 A;  2E9H A;  4A3B I;  1ZB8 A;  2IZ3 A;  3TDH B;  1M1K 2;  2NVY I;  2Q51 A;  2QRC B;  4E30 A;  2JA7 I;  1VQ9 1;  1ZH1 A;  1TWC I;  3S2D I;  4A3C I;  1YIJ 1;  4QTT A;  3VMI A;  1Y1W I;  1K8A 1;  3IX0 A;  4A3K I;  5FLX b;  4NBG A;  1QVG Y;  1VQM Z;  2OZK A;  5A2Q b;  1K9M 2;  3S1M I;  3FQQ A;  4XX2 A;  3G71 1;  1W2B Z;  3MON A;  4E31 A;  1YJW 1;  3F3F C;  2EGT A;  1RNI A;  3CD6 1;  4Y52 I;  2F4O A;  2P28 A;  4AYB A;  1I6H I;  2QRE B;  1K8A 2;  3QWU A;  3FKI I;  1Z03 A;  3HOW I;  3NFZ A;  1WW9 A;  3MZL B;  5LL6 f;  1NJI 1;  4A93 I;  1SFO I;  3J80 f;  4E2X A;  2DE5 A;  2DE6 A;  4BBS I;  3BG0 B;  2P3Y A;  1Z02 A;  3D9X A;  3CCE Z;  3JAM b;  4MON A;  3I56 Z;  2QKD A;  5IP9 I;  3I4M I;  1VQK 1;  1TWA I;  1YJN 1;  1VQ8 Z;  5IT9 f;  1WII A;  1N8R 2;  4NH1 C;  2E2H I;  3H0G I;  3IFU A;  1YIT Z;  2V8I A;  3NH5 A;  3CCR Z;  3M4O I;  2IZ4 A;  1YUK A;  2O4H A;  2NVQ I;  2K5R A;  3CC7 1;  3HOU I;  2RIQ A;  2OTL Z;  1VQP Z;  3I55 Z;  3G6E Z;  3CC2 Z;  5C44 I;  3RZO I;  3I55 1;  1VQO Z;  3CPW Y;  3D6W A;  2GU2 A;  1M1K 1;  1TFI A;  1USP A;  3GTM I;  2M6N A;  1QVG Z;  2V8K A;  2ZAE B;  3VB9 A;  2R6M A;  3S2H I;  1Y1V S;  1VLA A;  3CXC Z;  4BY1 I;  4MD9 A;  4S1T A;  2QEX 1;  4HH4 A;  2R93 I;  2VF1 A;  1VQ9 Z;  5FLX f;  2QLV B;  2JA8 I;  3NH8 A;  2LIY A;  5A2Q f;  3OW2 Z;  1YIJ Z;  1K9M 1;  2JA5 I;  1Q7Y 2;  1VQ4 Z;  2E2J I;  2BJO A;  2KI7 B;  2OTJ 1;  1VQ4 1;  3CCV Z;  1KRL A;  1USP B;  2WAQ A;  3S15 I;  3CCV 1;  4NFR A;  3VMG A;  2WB1 A;  4TNU A;  3GTJ I;  3GTO I;  3G71 Z;  3CCJ 1;  1TWG I;  4RVH A;  4E2Z A;  2OOY B;  1VQ5 1;  3CCL 1;  2V8J A;  1YJW Z;  1X3Z A;  1K73 2;  3J81 b;  1S72 1;  1Z01 A;  2JUB A;  2YAD A;  3CD6 Z;  3NH4 A;  2NVX I;  2JS4 A;  4RVD A;  3PO3 S;  3JAM f;  1QVF Z;  2F4M A;  1DL6 A;  4A3E I;  1S7M A;  3CC4 1;  3S14 I;  1N8R 1;  3GKQ A;  1KD1 1;  1RQF A;  4A3M I;  2VUM I;  3VTN A;  1KQS Y;  2Q4Z A;  5IP7 I;  1TWH I;  3HOV I;  1VQK Z;  3Q87 A;  1YJN Z;  1NUI A;  2PK7 A;  2QRD B;  3PO2 I;  4HGZ A;  1KD1 2;  1M90 1;  1VQN 1;  2J6A A;  1VQ6 1;  3CQZ I;  3EER A;  4NB8 A;  2VUG A;  3CC7 Z;  3CCS 1;  3G4S 1;  4A3G I;  1YHQ 1;  4NBB A;  3KIH A;  3S16 I;  4DQY B;  1YI2 1;  1Q86 1;  2OOX B;  3CMA 1;  1M90 2;  5FLM I;  1YUA A;  3CCU 1;  4NBE A;  4NBA A;  1I50 I;  4E2Y A;  1Q81 1;  3HOY I;  4NBC A;  1Q7Y 1;  2M48 A;  4BY7 I;  2W03 A;  2E2I I;  1Q86 2;  2QEX Z;  4A3F I;  5C4X I;  4NOZ A;  3CME 1;  1L1O C;  5T6B A;  2W04 A;  1KC8 2;  2PMZ A;  3TE5 B;  2DE7 A;  3EED A;  3ESW A;  4RVG A;  3NDJ A;  3S17 I;  1QYP A;  2R92 I;  1Q81 2;  4MD8 A;  4MRI A;  3CCQ 1;  2OTJ Z;  2KPI A;  1K73 1;  1Q82 2;  2HU9 A;  3J81 f;  3F3P C;  2YU9 I;  1TWF I;  1VQ7 1;  1Y1V I;  1VQL 1;  3K7A I;  2R7Z I;  1KQS Z;  3RZD I;  3BG1 B;  3GTP I;  1RO2 A;  3MZK B;  4E33 A;  3CCJ Z;  1JJ2 Y;  2AKL A;  3S1N I;  1VQ5 Z;  3CCL Z;  4NBF A;  5D1P A;  4A3L I;  1S72 Z;  2HF1 A;  2O53 A;  1YJ9 Z;  1RO4 A;  3GTK I;  3J7A 4;  4RV9 A;  4BXX I;  1YJ9 1;  2GTH A;  3CCM Z;  1WCM I;  4RS4 A;  2LFU A;  4CL1 A;  3S1R I;  3CC4 Z;  5CM2 M;  1X3W A;  3CCM 1;  3GTG I;  5C3E I;  1ML8 A;  3GTQ I;  3LUS A;  1X0T A;  2JA6 I;  2G2K A;  1VQM 1;  3KIF A;  1RLY A;  3CXC Y;  1K83 I;  4X6A I;  1NP6 A;  3CPW Z;  2RHB A;  3T4N B;  3P5J B;  1PFT A;  3PO3 I;  3HKZ A;  2RT9 A;  3OW2 Y;  3U50 C;  2QR1 B;  1VQN Z;  1VQ6 Z;  4RVF A;  2Y0S A;  2RPR A;  2GTI A;  4MXU A;  3CCS Z;  3G4S Z;  1YHQ Z;  3S1Q I;  3HOZ I;  2NVT I;  3VMH A;  5D1O A;  5C4J I;  3I4N I;  1YI2 Z;  4MH4 A;  3I56 1;  3CCE 1;  4HGY A;  3CMA Z;  3HOX I;  2PM9 A;  3CCU Z;  1NJI 2;  1W2B Y;  1R9T I;  4A3I I;  1VQ8 1;  1JWH C;  3J80 b;  1KC8 1;  2K3R A;  4E2W A;  5T64 A;  1YIT 1;  1QVF Y;  3GTM S;  1I3Q I;  3GCF A;  3CCR 1;  1JJ2 Z;  4MD7 A;  4NBH A;  3NDI A;  1Q82 1;  4EWC A;  2B63 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...