2OTJZ

13-deoxytedanolide bound to the large subunit of haloarcula marismortui
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
total genus 16
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2007-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2otjZ00
3CC4Z 1VQ7Z 1K732 1N8R2 1K8A1 3I551 3CCJZ 1VQO1 1Q861 3CCLZ 1QVFY 3CMA1 1JJ2Y 1VQP1 3CPWY 1NJI1 1K9M2 1KC82 3CCVZ 2QA41 1Q7Y2 1W2BY 3CXCY 1Q811 3CD6Z 1K731 1M901 1VQLZ 3G71Z 1KQSZ 1KD11 3CCSZ 3CC7Z 2QEXZ 1YHQZ 3CCV1 3I56Z 1YJWZ 1Q821 1VQKZ 1VQ61 3G711 1YIJZ 3G4SZ 1YIT1 2OTL1 2OTJZ 3CCS1 1M1K2 2QEX1 2OTJ1 3CCEZ 3CC41 1VQ71 1VQMZ 1QVGZ 1YJW1 3CCJ1 1VQNZ 3CC2Z 1N8R1 3CCL1 1VQ4Z 1S72Z 1YIJ1 3G4S1 1VQ8Z 1YJNZ 3CCE1 1YI2Z 1VQM1 1YJ9Z 1K9M1 1K8A2 1VQ9Z 1KC81 3CCUZ 1Q7Y1 3CD61 1VQN1 3CCRZ 1VQL1 1QVFZ 1S721 1Q862 1JJ2Z 3CCMZ 1VQ5Z 3OW2Z 3I55Z 3CC71 1YHQ1 3I561 1NJI2 3CMAZ 1KQSY 3CMEZ 3CXCZ 1VQ91 1VQPZ 3CCR1 1VQK1 1Q812 1M902 3CCM1 1VQ51 1KD12 3CME1 3CCQZ 1M1K1 3OW2Y 3CC21 1VQ41 3G6EZ 1Q822 1VQ81 3CPWZ 1QVGY 1YJN1 1VQOZ 1YI21 1VQ6Z 3CCQ1 1W2BZ 1YITZ 1YJ91 2OTLZ 3CCU1 3G6E1 2QA4Z
chains in the Genus database with same CATH superfamily
1PFTA 2QKDA 5D1OA 3GTMI 2V8KA 3GTLI 2NVYI 1X0TA 3CCLZ 1QVFY 2NVQI 3HOUI 2JMOA 3D6WA 1VQP1 4MH4A 1ZB8A 3JAMf 4Y7NI 2AYDA 2OOYB 2QA41 1Y1WI 1Z01A 1W2BY 1M901 2PMZA 4NBCA 4RVHA 3G71Z 3QWUA 2E2JI 5IP9I 2QEXZ 1NP6A 5LL6f 1YJWZ 2R93I 5C3EI 2H85A 2QREB 3PO3S 1DL6A 2NVXI 1YIT1 3G4SZ 2OTJ1 1RO4A 3EERA 4TNUA 1VLAA 4A3EI 1QVGZ 2OZKA 1YUKA 3RZDI 2RBLA 1VQNZ 1TFIA 3CCL1 1N8R1 1RO2A 1YIJ1 3NH4A 3FKII 3CCE1 2JUBA 3TDHB 4RVDA 2K5RA 2QR1B 2JA8I 2JS4A 3HOZI 2AKLA 2P28A 2E7ZA 2IV2X 3CMAZ 4A3CI 3GCFA 3S15I 1M902 3BG0B 1VQ51 4A3LI 3S1NI 3HOYI 4A3KI 3J81b 2W03A 3MZKB 3CQZI 1SFOI 2LFUA 2V8JA 3NFZA 1RQFA 3OW2Y 3S2HI 1R9TI 2VPWA 4NBGA 1QVGY 2IZ4A 5A2Qb 5IT9b 1W2BZ 2V45A 2OTLZ 2E2HI 4RVGA 4DK1A 2VPZA 4NBFA 3G6E1 2M6NA 2QA4Z 2V8IA 1N8R2 3J81f 3CCJZ 2KPIA 1Q861 2Q51A 1Z03A 3CMA1 4HH4A 2G2KA 1NJI1 3GTGI 5FLMI 1JWHC 5A2Qf 5IT9f 1TWFI 2JIOA 4DQYB 1K731 4NH1C 2JA5I 5IP7I 4XX2A 1QYPA 3CCV1 3I56Z 3GTOI 1RO0A 1Y1VS 2RPRA 2EGTA 3ESWA 3FQQA 3NH5A 3S1MI 1YIJZ 2NAPA 4E2YA 2OTL1 3CCS1 2JR6A 3TE5B 1TWCI 2B63I 2YU9I 1L1OC 3CCEZ 3CCJ1 1VQ4Z 2GU2A 2OOXB 2VUGA 2ZAEB 1YUAA 2P3YA 1K9M1 4MD9A 1KC81 4X6AI 1Q862 4A3BI 4A3GI 1K83I 1VQ5Z 2R7ZI 3OW2Z 2E2II 1TWGI 4MD7A 3VMHA 3I561 1NJI2 2YADA 4HGZA 4NBDA 5C4XI 3GTJI 3CXCZ 1VQ91 2NVTI 5C44I 4NB8A 3CCM1 3M4OI 3K7AI 3PO3I 2VPXA 3IR7A 4NBEA 2JNYA 3D9XA 3FQMA 1M1K1 2QLVB 2JIMA 4A93I 1VQ41 3IX0A 2JA6I 3G6EZ 2M48A 4DGLA 1FDOA 4E2ZA 4NBBA 1AA6A 3GTKI 3J80b 3HKZA 1FDIA 3F3PC 4NBAA 3KIHA 3CC4Z 1VQ7Z 4E32A 2RIQA 2QRDB 2J6AA 1RNIA 5T67A 3NDIA 5T6BA 3CPWY 4MRIA 4S1TA 1K9M2 4BBSI 1KC82 3CCVZ 3GTQI 3CXCY 1Q811 3J80f 3PO2I 2GTHA 2R6MA 1WIIA 2LEXA 1WW9A 3CCSZ 4BXXI 1YHQZ 2RHBA 1KRLA 4A3JI 3S1RI 2GTIA 2JIQA 3P5JB 2DE7A 1S7MA 2WAQA 2LIYA 2V3VA 2O53A 1M1K2 4HGYA 3CC41 1VQ71 3I4NI 4CL1A 1ZB9A 4NOZA 1I6HI 2PM9A 3HOVI 1QF8A 4RV9A 1VQ8Z 2KI7B 5C4JI 1YJNZ 3S2DI 4A3DI 1YI2Z 1VQM1 4A3MI 1YJ9Z 3S17I 1VQ9Z 5FLXb 1Q7Y1 3GKQA 2DE6A 3I07A 4RVFA 1S721 2W04A 1JJ2Z 3CCMZ 3HOXI 3I55Z 1YHQ1 1P9NA 1WZNA 1ML8A 4Y52I 3VMGA 3J7A4 2BJOA 4MXUA 3CCR1 2F4OA 1Q812 2Q4ZA 1Y1VI 3KIFA 4QTTA 2IZ3A 5FLXf 3S16I 3GTPI 1Z02A 3CME1 2HF1A 2JIPA 1VQ81 3MONA 3LUSA 3CPWZ 1YJN1 1USPB 1YI21 3NDJA 3VB9A 1VQ6Z 3CCQ1 1YJ91 3MZLB 4E31A 2R92I 1WCMI 1K732 1K8A1 3I551 1VQO1 4AYBA 3D2LA 1X3WA 1JJ2Y 2VPYA 2VF1A 1X3ZA 2HU9A 4A3FI 1Q7Y2 2E9HA 3IFUA 2JA7I 3CD6Z 1VQLZ 3S14I 1KQSZ 1KD11 1WJ2A 3HOWI 1Y8CA 3I4MI 1Q16A 3CC7Z 1I50I 4NFRA 4QTUA 2PK7A 1Q821 1VQKZ 2K3RA 4E2WA 3S1QI 1VQ61 3Q87A 3G711 3VTNA 1NUIA 2I3CA 2QEX1 4E30A 3EEDA 1VQMZ 1USPA 3H0GI 4MD8A 1YJW1 3IF8A 4E2XA 4EWCA 3CC2Z 1N2FA 1S72Z 1SIWA 1LQLA 3G4S1 4MONA 2WB1A 5D1OB 4BY7I 3U50C 4NBHA 1K8A2 3CD61 3CCUZ 1I3QI 3T4NB 1VQN1 3CCRZ 1VQL1 1QVFZ 3VMIA 4RS4A 4E33A 5AN9F 3F3FC 2DE5A 3CC71 3RZOI 1KQSY 3CMEZ 1VQPZ 1VQK1 2F4MA 2JIRA 1ZH1A 3H3VJ 2O4HA 1KD12 4A3II 5CM2M 3CCQZ 2VUMI 3GTMS 3CC21 4NB9A 5T64A 5D1PA 4BY1I 1Q822 3JAMb 1TWHI 3NH8A 1VQOZ 1RLYA 4BBRI 2Y0SA 2QRCB 3BG1B 2RT9A 1YITZ 3CCU1 1TWAI 3M3YI 1QXFA 2OTJZ
chains in the Genus database with same CATH topology
1PFTA 2QKDA 5D1OA 3GTMI 2V8KA 3GTLI 2NVYI 1X0TA 3CCLZ 1QVFY 2NVQI 3HOUI 2JMOA 3D6WA 1VQP1 4MH4A 1ZB8A 3JAMf 4Y7NI 2OOYB 2QA41 1Y1WI 1Z01A 1W2BY 1M901 2PMZA 4NBCA 4RVHA 3G71Z 3QWUA 2E2JI 5IP9I 2QEXZ 1NP6A 5LL6f 1YJWZ 2R93I 5C3EI 2H85A 2QREB 3PO3S 1DL6A 2NVXI 1YIT1 3G4SZ 2OTJ1 1RO4A 3EERA 4TNUA 1VLAA 4A3EI 1QVGZ 2OZKA 1YUKA 3RZDI 2RBLA 1VQNZ 1TFIA 3CCL1 1N8R1 1RO2A 1YIJ1 3NH4A 3FKII 3CCE1 2JUBA 3TDHB 4RVDA 2K5RA 2QR1B 2JA8I 2JS4A 3HOZI 2AKLA 2P28A 3CMAZ 4A3CI 3GCFA 3S15I 1M902 3BG0B 1VQ51 4A3LI 3S1NI 3HOYI 4A3KI 3J81b 2W03A 3MZKB 3CQZI 1SFOI 2LFUA 2V8JA 3NFZA 1RQFA 3OW2Y 3S2HI 1R9TI 4NBGA 1QVGY 2IZ4A 5A2Qb 5IT9b 1W2BZ 2OTLZ 2E2HI 4RVGA 4DK1A 4NBFA 3G6E1 2M6NA 2QA4Z 2V8IA 1N8R2 3J81f 3CCJZ 2KPIA 1Q861 2Q51A 1Z03A 3CMA1 4HH4A 2G2KA 1NJI1 3GTGI 5FLMI 1JWHC 5A2Qf 5IT9f 1TWFI 4DQYB 1K731 4NH1C 2JA5I 5IP7I 4XX2A 1QYPA 3CCV1 3I56Z 3GTOI 1RO0A 1Y1VS 2RPRA 2EGTA 3ESWA 3FQQA 3NH5A 3S1MI 1YIJZ 4E2YA 2OTL1 3CCS1 2JR6A 3TE5B 1TWCI 2B63I 2YU9I 1L1OC 3CCEZ 3CCJ1 1VQ4Z 2GU2A 2OOXB 2VUGA 2ZAEB 1YUAA 2P3YA 1K9M1 4MD9A 1KC81 4X6AI 1Q862 4A3BI 4A3GI 1K83I 1VQ5Z 2R7ZI 3OW2Z 2E2II 1TWGI 4MD7A 3VMHA 3I561 1NJI2 2YADA 4HGZA 4NBDA 5C4XI 3GTJI 3CXCZ 1VQ91 2NVTI 5C44I 4NB8A 3CCM1 3M4OI 3K7AI 3PO3I 4NBEA 2JNYA 3D9XA 3FQMA 1M1K1 2QLVB 4A93I 1VQ41 3IX0A 2JA6I 3G6EZ 2M48A 4DGLA 4E2ZA 4NBBA 3GTKI 3J80b 3HKZA 3F3PC 4NBAA 3KIHA 3CC4Z 1VQ7Z 4E32A 2RIQA 2QRDB 2J6AA 1RNIA 5T67A 3NDIA 5T6BA 3CPWY 4MRIA 4S1TA 1K9M2 4BBSI 1KC82 3CCVZ 3GTQI 3CXCY 1Q811 3J80f 3PO2I 2GTHA 2R6MA 1WIIA 1WW9A 3CCSZ 4BXXI 1YHQZ 2RHBA 1KRLA 4A3JI 3S1RI 2GTIA 3P5JB 2DE7A 1S7MA 2WAQA 2LIYA 2O53A 1M1K2 4HGYA 3CC41 1VQ71 3I4NI 4CL1A 1ZB9A 4NOZA 1I6HI 2PM9A 3HOVI 1QF8A 4RV9A 1VQ8Z 2KI7B 5C4JI 1YJNZ 3S2DI 4A3DI 1YI2Z 1VQM1 4A3MI 1YJ9Z 3S17I 1VQ9Z 5FLXb 1Q7Y1 3GKQA 2DE6A 3I07A 4RVFA 1S721 2W04A 1JJ2Z 3CCMZ 3HOXI 3I55Z 1YHQ1 1P9NA 1ML8A 4Y52I 3VMGA 3J7A4 2BJOA 4MXUA 3CCR1 2F4OA 1Q812 2Q4ZA 1Y1VI 3KIFA 4QTTA 2IZ3A 5FLXf 3S16I 3GTPI 1Z02A 3CME1 2HF1A 1VQ81 3MONA 3LUSA 3CPWZ 1YJN1 1USPB 1YI21 3NDJA 3VB9A 1VQ6Z 3CCQ1 1YJ91 3MZLB 4E31A 2R92I 1WCMI 1K732 1K8A1 3I551 1VQO1 4AYBA 1X3WA 1JJ2Y 2VF1A 1X3ZA 2HU9A 4A3FI 1Q7Y2 2E9HA 3IFUA 2JA7I 3CD6Z 1VQLZ 3S14I 1KQSZ 1KD11 3HOWI 3I4MI 3CC7Z 1I50I 4NFRA 4QTUA 2PK7A 1Q821 1VQKZ 2K3RA 4E2WA 3S1QI 1VQ61 3Q87A 3G711 3VTNA 1NUIA 2I3CA 2QEX1 4E30A 3EEDA 1VQMZ 1USPA 3H0GI 4MD8A 1YJW1 3IF8A 4E2XA 4EWCA 3CC2Z 1N2FA 1S72Z 1LQLA 3G4S1 4MONA 2WB1A 5D1OB 4BY7I 3U50C 4NBHA 1K8A2 3CD61 3CCUZ 1I3QI 3T4NB 1VQN1 3CCRZ 1VQL1 1QVFZ 3VMIA 4RS4A 4E33A 5AN9F 3F3FC 2DE5A 3CC71 3RZOI 1KQSY 3CMEZ 1VQPZ 1VQK1 2F4MA 1ZH1A 3H3VJ 2O4HA 1KD12 4A3II 5CM2M 3CCQZ 2VUMI 3GTMS 3CC21 4NB9A 5T64A 5D1PA 4BY1I 1Q822 3JAMb 1TWHI 3NH8A 1VQOZ 1RLYA 4BBRI 2Y0SA 2QRCB 3BG1B 2RT9A 1YITZ 3CCU1 1TWAI 3M3YI 2OTJZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC4 Z;  1VQ7 Z;  1K73 2;  1N8R 2;  1K8A 1;  3I55 1;  3CCJ Z;  1VQO 1;  1Q86 1;  3CCL Z;  1QVF Y;  3CMA 1;  1JJ2 Y;  1VQP 1;  3CPW Y;  1NJI 1;  1K9M 2;  1KC8 2;  3CCV Z;  2QA4 1;  1Q7Y 2;  1W2B Y;  3CXC Y;  1Q81 1;  3CD6 Z;  1K73 1;  1M90 1;  1VQL Z;  3G71 Z;  1KQS Z;  1KD1 1;  3CCS Z;  3CC7 Z;  2QEX Z;  1YHQ Z;  3CCV 1;  3I56 Z;  1YJW Z;  1Q82 1;  1VQK Z;  1VQ6 1;  3G71 1;  1YIJ Z;  3G4S Z;  1YIT 1;  2OTL 1;  2OTJ Z;  3CCS 1;  1M1K 2;  2QEX 1;  2OTJ 1;  3CCE Z;  3CC4 1;  1VQ7 1;  1VQM Z;  1QVG Z;  1YJW 1;  3CCJ 1;  1VQN Z;  3CC2 Z;  1N8R 1;  3CCL 1;  1VQ4 Z;  1S72 Z;  1YIJ 1;  3G4S 1;  1VQ8 Z;  1YJN Z;  3CCE 1;  1YI2 Z;  1VQM 1;  1YJ9 Z;  1K9M 1;  1K8A 2;  1VQ9 Z;  1KC8 1;  3CCU Z;  1Q7Y 1;  3CD6 1;  1VQN 1;  3CCR Z;  1VQL 1;  1QVF Z;  1S72 1;  1Q86 2;  1JJ2 Z;  3CCM Z;  1VQ5 Z;  3OW2 Z;  3I55 Z;  3CC7 1;  1YHQ 1;  3I56 1;  1NJI 2;  3CMA Z;  1KQS Y;  3CME Z;  3CXC Z;  1VQ9 1;  1VQP Z;  3CCR 1;  1VQK 1;  1Q81 2;  1M90 2;  3CCM 1;  1VQ5 1;  1KD1 2;  3CME 1;  3CCQ Z;  1M1K 1;  3OW2 Y;  3CC2 1;  1VQ4 1;  3G6E Z;  1Q82 2;  1VQ8 1;  3CPW Z;  1QVG Y;  1YJN 1;  1VQO Z;  1YI2 1;  1VQ6 Z;  3CCQ 1;  1W2B Z;  1YIT Z;  1YJ9 1;  2OTL Z;  3CCU 1;  3G6E 1;  2QA4 Z; 
#chains in the Genus database with same CATH topology
 1PFT A;  2QKD A;  5D1O A;  3GTM I;  2V8K A;  3GTL I;  2NVY I;  1X0T A;  3CCL Z;  1QVF Y;  2NVQ I;  3HOU I;  2JMO A;  3D6W A;  1VQP 1;  4MH4 A;  1ZB8 A;  3JAM f;  4Y7N I;  2AYD A;  2OOY B;  2QA4 1;  1Y1W I;  1Z01 A;  1W2B Y;  1M90 1;  2PMZ A;  4NBC A;  4RVH A;  3G71 Z;  3QWU A;  2E2J I;  5IP9 I;  2QEX Z;  1NP6 A;  5LL6 f;  1YJW Z;  2R93 I;  5C3E I;  2H85 A;  2QRE B;  3PO3 S;  1DL6 A;  2NVX I;  1YIT 1;  3G4S Z;  2OTJ 1;  1RO4 A;  3EER A;  4TNU A;  1VLA A;  4A3E I;  1QVG Z;  2OZK A;  1YUK A;  3RZD I;  2RBL A;  1VQN Z;  1TFI A;  3CCL 1;  1N8R 1;  1RO2 A;  1YIJ 1;  3NH4 A;  3FKI I;  3CCE 1;  2JUB A;  3TDH B;  4RVD A;  2K5R A;  2QR1 B;  2JA8 I;  2JS4 A;  3HOZ I;  2AKL A;  2P28 A;  2E7Z A;  2IV2 X;  3CMA Z;  4A3C I;  3GCF A;  3S15 I;  1M90 2;  3BG0 B;  1VQ5 1;  4A3L I;  3S1N I;  3HOY I;  4A3K I;  3J81 b;  2W03 A;  3MZK B;  3CQZ I;  1SFO I;  2LFU A;  2V8J A;  3NFZ A;  1RQF A;  3OW2 Y;  3S2H I;  1R9T I;  2VPW A;  4NBG A;  1QVG Y;  2IZ4 A;  5A2Q b;  5IT9 b;  1W2B Z;  2V45 A;  2OTL Z;  2E2H I;  4RVG A;  4DK1 A;  2VPZ A;  4NBF A;  3G6E 1;  2M6N A;  2QA4 Z;  2V8I A;  1N8R 2;  3J81 f;  3CCJ Z;  2KPI A;  1Q86 1;  2Q51 A;  1Z03 A;  3CMA 1;  4HH4 A;  2G2K A;  1NJI 1;  3GTG I;  5FLM I;  1JWH C;  5A2Q f;  5IT9 f;  1TWF I;  2JIO A;  4DQY B;  1K73 1;  4NH1 C;  2JA5 I;  5IP7 I;  4XX2 A;  1QYP A;  3CCV 1;  3I56 Z;  3GTO I;  1RO0 A;  1Y1V S;  2RPR A;  2EGT A;  3ESW A;  3FQQ A;  3NH5 A;  3S1M I;  1YIJ Z;  2NAP A;  4E2Y A;  2OTL 1;  3CCS 1;  2JR6 A;  3TE5 B;  1TWC I;  2B63 I;  2YU9 I;  1L1O C;  3CCE Z;  3CCJ 1;  1VQ4 Z;  2GU2 A;  2OOX B;  2VUG A;  2ZAE B;  1YUA A;  2P3Y A;  1K9M 1;  4MD9 A;  1KC8 1;  4X6A I;  1Q86 2;  4A3B I;  4A3G I;  1K83 I;  1VQ5 Z;  2R7Z I;  3OW2 Z;  2E2I I;  1TWG I;  4MD7 A;  3VMH A;  3I56 1;  1NJI 2;  2YAD A;  4HGZ A;  4NBD A;  5C4X I;  3GTJ I;  3CXC Z;  1VQ9 1;  2NVT I;  5C44 I;  4NB8 A;  3CCM 1;  3M4O I;  3K7A I;  3PO3 I;  2VPX A;  3IR7 A;  4NBE A;  2JNY A;  3D9X A;  3FQM A;  1M1K 1;  2QLV B;  2JIM A;  4A93 I;  1VQ4 1;  3IX0 A;  2JA6 I;  3G6E Z;  2M48 A;  4DGL A;  1FDO A;  4E2Z A;  4NBB A;  1AA6 A;  3GTK I;  3J80 b;  3HKZ A;  1FDI A;  3F3P C;  4NBA A;  3KIH A;  3CC4 Z;  1VQ7 Z;  4E32 A;  2RIQ A;  2QRD B;  2J6A A;  1RNI A;  5T67 A;  3NDI A;  5T6B A;  3CPW Y;  4MRI A;  4S1T A;  1K9M 2;  4BBS I;  1KC8 2;  3CCV Z;  3GTQ I;  3CXC Y;  1Q81 1;  3J80 f;  3PO2 I;  2GTH A;  2R6M A;  1WII A;  2LEX A;  1WW9 A;  3CCS Z;  4BXX I;  1YHQ Z;  2RHB A;  1KRL A;  4A3J I;  3S1R I;  2GTI A;  2JIQ A;  3P5J B;  2DE7 A;  1S7M A;  2WAQ A;  2LIY A;  2V3V A;  2O53 A;  1M1K 2;  4HGY A;  3CC4 1;  1VQ7 1;  3I4N I;  4CL1 A;  1ZB9 A;  4NOZ A;  1I6H I;  2PM9 A;  3HOV I;  1QF8 A;  4RV9 A;  1VQ8 Z;  2KI7 B;  5C4J I;  1YJN Z;  3S2D I;  4A3D I;  1YI2 Z;  1VQM 1;  4A3M I;  1YJ9 Z;  3S17 I;  1VQ9 Z;  5FLX b;  1Q7Y 1;  3GKQ A;  2DE6 A;  3I07 A;  4RVF A;  1S72 1;  2W04 A;  1JJ2 Z;  3CCM Z;  3HOX I;  3I55 Z;  1YHQ 1;  1P9N A;  1WZN A;  1ML8 A;  4Y52 I;  3VMG A;  3J7A 4;  2BJO A;  4MXU A;  3CCR 1;  2F4O A;  1Q81 2;  2Q4Z A;  1Y1V I;  3KIF A;  4QTT A;  2IZ3 A;  5FLX f;  3S16 I;  3GTP I;  1Z02 A;  3CME 1;  2HF1 A;  2JIP A;  1VQ8 1;  3MON A;  3LUS A;  3CPW Z;  1YJN 1;  1USP B;  1YI2 1;  3NDJ A;  3VB9 A;  1VQ6 Z;  3CCQ 1;  1YJ9 1;  3MZL B;  4E31 A;  2R92 I;  1WCM I;  1K73 2;  1K8A 1;  3I55 1;  1VQO 1;  4AYB A;  3D2L A;  1X3W A;  1JJ2 Y;  2VPY A;  2VF1 A;  1X3Z A;  2HU9 A;  4A3F I;  1Q7Y 2;  2E9H A;  3IFU A;  2JA7 I;  3CD6 Z;  1VQL Z;  3S14 I;  1KQS Z;  1KD1 1;  1WJ2 A;  3HOW I;  1Y8C A;  3I4M I;  1Q16 A;  3CC7 Z;  1I50 I;  4NFR A;  4QTU A;  2PK7 A;  1Q82 1;  1VQK Z;  2K3R A;  4E2W A;  3S1Q I;  1VQ6 1;  3Q87 A;  3G71 1;  3VTN A;  1NUI A;  2I3C A;  2QEX 1;  4E30 A;  3EED A;  1VQM Z;  1USP A;  3H0G I;  4MD8 A;  1YJW 1;  3IF8 A;  4E2X A;  4EWC A;  3CC2 Z;  1N2F A;  1S72 Z;  1SIW A;  1LQL A;  3G4S 1;  4MON A;  2WB1 A;  5D1O B;  4BY7 I;  3U50 C;  4NBH A;  1K8A 2;  3CD6 1;  3CCU Z;  1I3Q I;  3T4N B;  1VQN 1;  3CCR Z;  1VQL 1;  1QVF Z;  3VMI A;  4RS4 A;  4E33 A;  5AN9 F;  3F3F C;  2DE5 A;  3CC7 1;  3RZO I;  1KQS Y;  3CME Z;  1VQP Z;  1VQK 1;  2F4M A;  2JIR A;  1ZH1 A;  3H3V J;  2O4H A;  1KD1 2;  4A3I I;  5CM2 M;  3CCQ Z;  2VUM I;  3GTM S;  3CC2 1;  4NB9 A;  5T64 A;  5D1P A;  4BY1 I;  1Q82 2;  3JAM b;  1TWH I;  3NH8 A;  1VQO Z;  1RLY A;  4BBR I;  2Y0S A;  2QRC B;  3BG1 B;  2RT9 A;  1YIT Z;  3CCU 1;  1TWA I;  3M3Y I;  1QXF A;  2OTJ Z; 
#chains in the Genus database with same CATH homology
 1PFT A;  2QKD A;  5D1O A;  3GTM I;  2V8K A;  3GTL I;  2NVY I;  1X0T A;  3CCL Z;  1QVF Y;  2NVQ I;  3HOU I;  2JMO A;  3D6W A;  1VQP 1;  4MH4 A;  1ZB8 A;  3JAM f;  4Y7N I;  2OOY B;  2QA4 1;  1Y1W I;  1Z01 A;  1W2B Y;  1M90 1;  2PMZ A;  4NBC A;  4RVH A;  3G71 Z;  3QWU A;  2E2J I;  5IP9 I;  2QEX Z;  1NP6 A;  5LL6 f;  1YJW Z;  2R93 I;  5C3E I;  2H85 A;  2QRE B;  3PO3 S;  1DL6 A;  2NVX I;  1YIT 1;  3G4S Z;  2OTJ 1;  1RO4 A;  3EER A;  4TNU A;  1VLA A;  4A3E I;  1QVG Z;  2OZK A;  1YUK A;  3RZD I;  2RBL A;  1VQN Z;  1TFI A;  3CCL 1;  1N8R 1;  1RO2 A;  1YIJ 1;  3NH4 A;  3FKI I;  3CCE 1;  2JUB A;  3TDH B;  4RVD A;  2K5R A;  2QR1 B;  2JA8 I;  2JS4 A;  3HOZ I;  2AKL A;  2P28 A;  3CMA Z;  4A3C I;  3GCF A;  3S15 I;  1M90 2;  3BG0 B;  1VQ5 1;  4A3L I;  3S1N I;  3HOY I;  4A3K I;  3J81 b;  2W03 A;  3MZK B;  3CQZ I;  1SFO I;  2LFU A;  2V8J A;  3NFZ A;  1RQF A;  3OW2 Y;  3S2H I;  1R9T I;  4NBG A;  1QVG Y;  2IZ4 A;  5A2Q b;  5IT9 b;  1W2B Z;  2OTL Z;  2E2H I;  4RVG A;  4DK1 A;  4NBF A;  3G6E 1;  2M6N A;  2QA4 Z;  2V8I A;  1N8R 2;  3J81 f;  3CCJ Z;  2KPI A;  1Q86 1;  2Q51 A;  1Z03 A;  3CMA 1;  4HH4 A;  2G2K A;  1NJI 1;  3GTG I;  5FLM I;  1JWH C;  5A2Q f;  5IT9 f;  1TWF I;  4DQY B;  1K73 1;  4NH1 C;  2JA5 I;  5IP7 I;  4XX2 A;  1QYP A;  3CCV 1;  3I56 Z;  3GTO I;  1RO0 A;  1Y1V S;  2RPR A;  2EGT A;  3ESW A;  3FQQ A;  3NH5 A;  3S1M I;  1YIJ Z;  4E2Y A;  2OTL 1;  3CCS 1;  2JR6 A;  3TE5 B;  1TWC I;  2B63 I;  2YU9 I;  1L1O C;  3CCE Z;  3CCJ 1;  1VQ4 Z;  2GU2 A;  2OOX B;  2VUG A;  2ZAE B;  1YUA A;  2P3Y A;  1K9M 1;  4MD9 A;  1KC8 1;  4X6A I;  1Q86 2;  4A3B I;  4A3G I;  1K83 I;  1VQ5 Z;  2R7Z I;  3OW2 Z;  2E2I I;  1TWG I;  4MD7 A;  3VMH A;  3I56 1;  1NJI 2;  2YAD A;  4HGZ A;  4NBD A;  5C4X I;  3GTJ I;  3CXC Z;  1VQ9 1;  2NVT I;  5C44 I;  4NB8 A;  3CCM 1;  3M4O I;  3K7A I;  3PO3 I;  4NBE A;  2JNY A;  3D9X A;  3FQM A;  1M1K 1;  2QLV B;  4A93 I;  1VQ4 1;  3IX0 A;  2JA6 I;  3G6E Z;  2M48 A;  4DGL A;  4E2Z A;  4NBB A;  3GTK I;  3J80 b;  3HKZ A;  3F3P C;  4NBA A;  3KIH A;  3CC4 Z;  1VQ7 Z;  4E32 A;  2RIQ A;  2QRD B;  2J6A A;  1RNI A;  5T67 A;  3NDI A;  5T6B A;  3CPW Y;  4MRI A;  4S1T A;  1K9M 2;  4BBS I;  1KC8 2;  3CCV Z;  3GTQ I;  3CXC Y;  1Q81 1;  3J80 f;  3PO2 I;  2GTH A;  2R6M A;  1WII A;  1WW9 A;  3CCS Z;  4BXX I;  1YHQ Z;  2RHB A;  1KRL A;  4A3J I;  3S1R I;  2GTI A;  3P5J B;  2DE7 A;  1S7M A;  2WAQ A;  2LIY A;  2O53 A;  1M1K 2;  4HGY A;  3CC4 1;  1VQ7 1;  3I4N I;  4CL1 A;  1ZB9 A;  4NOZ A;  1I6H I;  2PM9 A;  3HOV I;  1QF8 A;  4RV9 A;  1VQ8 Z;  2KI7 B;  5C4J I;  1YJN Z;  3S2D I;  4A3D I;  1YI2 Z;  1VQM 1;  4A3M I;  1YJ9 Z;  3S17 I;  1VQ9 Z;  5FLX b;  1Q7Y 1;  3GKQ A;  2DE6 A;  3I07 A;  4RVF A;  1S72 1;  2W04 A;  1JJ2 Z;  3CCM Z;  3HOX I;  3I55 Z;  1YHQ 1;  1P9N A;  1ML8 A;  4Y52 I;  3VMG A;  3J7A 4;  2BJO A;  4MXU A;  3CCR 1;  2F4O A;  1Q81 2;  2Q4Z A;  1Y1V I;  3KIF A;  4QTT A;  2IZ3 A;  5FLX f;  3S16 I;  3GTP I;  1Z02 A;  3CME 1;  2HF1 A;  1VQ8 1;  3MON A;  3LUS A;  3CPW Z;  1YJN 1;  1USP B;  1YI2 1;  3NDJ A;  3VB9 A;  1VQ6 Z;  3CCQ 1;  1YJ9 1;  3MZL B;  4E31 A;  2R92 I;  1WCM I;  1K73 2;  1K8A 1;  3I55 1;  1VQO 1;  4AYB A;  1X3W A;  1JJ2 Y;  2VF1 A;  1X3Z A;  2HU9 A;  4A3F I;  1Q7Y 2;  2E9H A;  3IFU A;  2JA7 I;  3CD6 Z;  1VQL Z;  3S14 I;  1KQS Z;  1KD1 1;  3HOW I;  3I4M I;  3CC7 Z;  1I50 I;  4NFR A;  4QTU A;  2PK7 A;  1Q82 1;  1VQK Z;  2K3R A;  4E2W A;  3S1Q I;  1VQ6 1;  3Q87 A;  3G71 1;  3VTN A;  1NUI A;  2I3C A;  2QEX 1;  4E30 A;  3EED A;  1VQM Z;  1USP A;  3H0G I;  4MD8 A;  1YJW 1;  3IF8 A;  4E2X A;  4EWC A;  3CC2 Z;  1N2F A;  1S72 Z;  1LQL A;  3G4S 1;  4MON A;  2WB1 A;  5D1O B;  4BY7 I;  3U50 C;  4NBH A;  1K8A 2;  3CD6 1;  3CCU Z;  1I3Q I;  3T4N B;  1VQN 1;  3CCR Z;  1VQL 1;  1QVF Z;  3VMI A;  4RS4 A;  4E33 A;  5AN9 F;  3F3F C;  2DE5 A;  3CC7 1;  3RZO I;  1KQS Y;  3CME Z;  1VQP Z;  1VQK 1;  2F4M A;  1ZH1 A;  3H3V J;  2O4H A;  1KD1 2;  4A3I I;  5CM2 M;  3CCQ Z;  2VUM I;  3GTM S;  3CC2 1;  4NB9 A;  5T64 A;  5D1P A;  4BY1 I;  1Q82 2;  3JAM b;  1TWH I;  3NH8 A;  1VQO Z;  1RLY A;  4BBR I;  2Y0S A;  2QRC B;  3BG1 B;  2RT9 A;  1YIT Z;  3CCU 1;  1TWA I;  3M3Y I;  2OTJ Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...