2OTJZ

13-deoxytedanolide bound to the large subunit of haloarcula marismortui
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2007-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2otjZ00
1K731 3I56Z 3CCQZ 3G4SZ 1VQ81 1M1K2 1QVFZ 1YIT1 3CCLZ 1YHQZ 3CMEZ 3CC4Z 1Q821 1YJNZ 1VQLZ 1N8R1 1VQ5Z 1NJI1 3CPWY 3CCVZ 2QEXZ 1K9M1 1W2BZ 1Q7Y1 1VQ41 1Q822 1VQMZ 1JJ2Z 3CXCZ 3CC7Z 3I561 1VQKZ 3CCQ1 1KQSZ 3G6EZ 3CCUZ 1VQ6Z 3CMAZ 1YHQ1 3CME1 1VQOZ 1VQ9Z 3CC41 1KC82 1K732 1YJN1 1VQL1 3OW2Y 3CD61 1Q861 3CCV1 1YJWZ 2QEX1 1YJ9Z 1YI2Z 1VQM1 2QA4Z 1VQPZ 1M901 1VQK1 1Q811 1QVGZ 1N8R2 3CCU1 3G6E1 1VQ7Z 1KD11 1NJI2 3G4S1 3CC2Z 1VQ61 3CMA1 1K9M2 1VQ91 1Q7Y2 1VQNZ 2OTLZ 3CCRZ 1Q812 3CCL1 1K8A1 3CCSZ 1KQSY 1YJW1 1VQ51 1YJ91 1YI21 1S72Z 3CCEZ 2QA41 3CCMZ 1VQP1 1QVFY 1M1K1 3CCJZ 3CC71 1VQ71 3G71Z 3OW2Z 3CC21 1Q862 2OTJZ 1YIJZ 3I55Z 1VQN1 2OTL1 3CCR1 3CPWZ 1VQO1 1M902 1VQ8Z 3CCS1 1YITZ 1W2BY 1QVGY 1KD12 1JJ2Y 3CXCY 1S721 3CCE1 3CD6Z 3CCM1 1K8A2 3CCJ1 3G711 2OTJ1 1YIJ1 1VQ4Z 3I551 1KC81
chains in the Genus database with same CATH superfamily
1YUKA 3G4SZ 2DE6A 3FQMA 1YUAA 3HOWI 3CCLZ 3BG1B 1Z03A 1AA6A 3HOZI 1YJNZ 1N8R1 5A2Qf 1FDOA 4MH4A 3H3VJ 2QEXZ 4E30A 4MD8A 1TWFI 3IFUA 1Y8CA 3I561 3K7AI 2DE5A 2HF1A 4MXUA 3CME1 1VQOZ 1KC82 3GTLI 3PO2I 3LUSA 2E9HA 2RHBA 2O53A 2GTHA 3GTMS 3CD61 2VPWA 3NH8A 2NVYI 4NBHA 2PMZA 4MRIA 2VUGA 2AYDA 1VQM1 2B63I 4HGYA 1M901 1Q811 4NBDA 1N8R2 2R7ZI 3CCU1 1KD11 3M4OI 4A3MI 1VQ91 1K83I 3RZDI 2JIOA 1Z01A 3NH4A 2W03A 1RQFA 4MONA 2JR6A 1YJ91 2QA41 3D2LA 1WIIA 2F4MA 1RO2A 5CM2M 3CCJZ 3CC71 5D1OA 2NAPA 4NBGA 5A2Qb 3OW2Z 5T6BA 4NBBA 4MD7A 1YIJZ 2IV2X 3I55Z 2JA6I 1LQLA 3I4NI 2I3CA 1M902 3ESWA 4A3FI 2VUMI 3CCS1 1YITZ 1W2BY 1KD12 3S1NI 5T64A 2Y0SA 3S1QI 1S721 1R9TI 3MZLB 3CD6Z 3CCM1 2K5RA 3GCFA 3GTOI 1ZB9A 1VQ4Z 2QR1B 3S2HI 3S15I 2RIQA 1K731 4NB8A 3CCQZ 2VPZA 3IF8A 1YHQZ 2W04A 2JA7I 2LEXA 1Z02A 1S7MA 4E33A 2QKDA 5FLXf 1L1OC 3CPWY 3T4NB 3CCVZ 1Q16A 1DL6A 2JA8I 1Q822 5C4JI 3CC7Z 1VQKZ 2ZAEB 4CL1A 1KQSZ 4BXXI 3F3FC 4NBAA 3KIFA 1JWHC 3RZOI 3P5JB 2WAQA 3CC41 2JIQA 1WW9A 1ZB8A 4NOZA 1K732 2V8IA 1VQL1 3J80f 4E2XA 3MONA 3S1RI 2Q51A 2V8KA 4A3BI 3MZKB 5IP7I 3NDJA 2IZ3A 1WJ2A 3G6E1 4BY7I 1VQ61 3CMA1 1VQNZ 2OTLZ 2R6MA 3IX0A 3PO3I 1YJW1 2JA5I 5IT9f 1VQ51 4RVFA 1YI21 3CCEZ 2QRCB 1VQP1 1QVFY 4A3LI 2M6NA 1VQ71 5FLXb 3CC21 1SIWA 2K3RA 3CCR1 5IP9I 3M3YI 2LIYA 4E2ZA 1JJ2Y 5C4XI 3JAMf 3CXCY 2VPYA 2R92I 2YU9I 2RBLA 4E2WA 1P9NA 5AN9F 3J80b 2QREB 3G711 3CQZI 2V45A 3QWUA 2OTJ1 1I50I 1Y1VS 4DGLA 3I56Z 2VF1A 2E2HI 1VQ81 2QLVB 2EGTA 2GU2A 4A3II 3CMEZ 3HOUI 1RNIA 2V8JA 2PK7A 4DQYB 3S1MI 3TE5B 2JIPA 1Q821 2E7ZA 4A3EI 2G2KA 3TDHB 1VQ5Z 1NJI1 1Y1WI 1TWCI 3VB9A 1K9M1 3I4MI 3HKZA 1W2BZ 1Q7Y1 4Y52I 1RO4A 3NH5A 5IT9b 1VQMZ 3Q87A 1X3WA 3CCUZ 5C44I 2DE7A 3I07A 3GTGI 1VQ9Z 4E32A 4NB9A 1PFTA 4NBEA 1YJN1 1RLYA 1Q861 1ML8A 2QEX1 3KIHA 1YJ9Z 3GKQA 3H0GI 3JAMb 3HOVI 2QA4Z 3S17I 4RVGA 2YADA 4AYBA 2QRDB 1QVGZ 4A3CI 1I3QI 3FKII 1NJI2 4A3KI 1WZNA 1K9M2 1QXFA 1Q7Y2 1X3ZA 3VTNA 4RVDA 3CCSZ 1KQSY 2P28A 1USPB 4RV9A 3GTPI 1S72Z 4TNUA 2HU9A 3CCMZ 4S1TA 3PO3S 3NDIA 1M1K1 1X0TA 5LL6f 2NVTI 2WB1A 1Q862 4X6AI 3VMIA 3FQQA 3HOYI 2F4OA 1NUIA 2KPIA 2JNYA 3U50C 4BBRI 3D9XA 4BY1I 4NFRA 4XX2A 3CCJ1 4A3GI 4BBSI 2J6AA 1YIJ1 2VPXA 2KI7B 3I551 3VMHA 4A3DI 3EERA 2O4HA 3J7A4 4A3JI 1M1K2 1QVFZ 1YIT1 1TFIA 3D6WA 2BJOA 2E2II 3EEDA 2RPRA 4NH1C 3CC4Z 4QTUA 2E2JI 2NVXI 3NFZA 1VQLZ 4MD9A 4HGZA 1NP6A 3J81f 5D1PA 2PM9A 2IZ4A 2R93I 2GTIA 2OOXB 1VQ41 1JJ2Z 3CXCZ 3CCQ1 1QF8A 3G6EZ 1ZH1A 1VQ6Z 4RVHA 3CMAZ 1YHQ1 3GTMI 1TWHI 1I6HI 1WCMI 2AKLA 3S2DI 4E2YA 2JS4A 1SFOI 3OW2Y 3BG0B 3CCV1 1YJWZ 1VLAA 2LFUA 2JUBA 4E31A 2JIRA 1N2FA 5FLMI 4RS4A 1YI2Z 4NBFA 4QTTA 1TWAI 1VQPZ 3F3PC 1VQK1 2H85A 3S16I 2M48A 1FDIA 1VQ7Z 3GTQI 3G4S1 3CC2Z 4A93I 5T67A 1RO0A 2NVQI 2OZKA 5D1OB 2P3YA 3CCRZ 1Q812 4Y7NI 3CCL1 1K8A1 4DK1A 2OOYB 2V3VA 3GTKI 1Y1VI 1TWGI 3G71Z 1KRLA 2OTJZ 3J81b 4EWCA 2JIMA 2OTL1 1VQN1 3CPWZ 1VQO1 1USPA 1VQ8Z 4HH4A 3GTJI 2RT9A 1QVGY 1QYPA 4NBCA 3S14I 3CCE1 3VMGA 1K8A2 2Q4ZA 3IR7A 2JMOA 3HOXI 5C3EI 1KC81
chains in the Genus database with same CATH topology
1YUKA 3G4SZ 2DE6A 3FQMA 1YUAA 3HOWI 3CCLZ 3BG1B 1Z03A 3HOZI 1YJNZ 1N8R1 5A2Qf 4MH4A 3H3VJ 2QEXZ 4E30A 4MD8A 1TWFI 3IFUA 3I561 3K7AI 2DE5A 2HF1A 4MXUA 3CME1 1VQOZ 1KC82 3GTLI 3PO2I 3LUSA 2E9HA 2RHBA 2O53A 2GTHA 3GTMS 3CD61 3NH8A 2NVYI 4NBHA 2PMZA 4MRIA 2VUGA 1VQM1 2B63I 4HGYA 1M901 1Q811 4NBDA 1N8R2 2R7ZI 3CCU1 1KD11 3M4OI 4A3MI 1VQ91 1K83I 3RZDI 1Z01A 3NH4A 2W03A 1RQFA 4MONA 2JR6A 1YJ91 2QA41 1WIIA 2F4MA 1RO2A 5CM2M 3CCJZ 3CC71 5D1OA 4NBGA 5A2Qb 3OW2Z 5T6BA 4NBBA 4MD7A 1YIJZ 3I55Z 2JA6I 1LQLA 3I4NI 2I3CA 1M902 3ESWA 4A3FI 2VUMI 3CCS1 1YITZ 1W2BY 1KD12 3S1NI 5T64A 2Y0SA 3S1QI 1S721 1R9TI 3MZLB 3CD6Z 3CCM1 2K5RA 3GCFA 3GTOI 1ZB9A 1VQ4Z 2QR1B 3S2HI 3S15I 2RIQA 1K731 4NB8A 3CCQZ 3IF8A 1YHQZ 2W04A 2JA7I 1Z02A 1S7MA 4E33A 2QKDA 5FLXf 1L1OC 3CPWY 3T4NB 3CCVZ 1DL6A 2JA8I 1Q822 5C4JI 3CC7Z 1VQKZ 2ZAEB 4CL1A 1KQSZ 4BXXI 3F3FC 4NBAA 3KIFA 1JWHC 3RZOI 3P5JB 2WAQA 3CC41 1WW9A 1ZB8A 4NOZA 1K732 2V8IA 1VQL1 3J80f 4E2XA 3MONA 3S1RI 2Q51A 2V8KA 4A3BI 3MZKB 5IP7I 3NDJA 2IZ3A 3G6E1 4BY7I 1VQ61 3CMA1 1VQNZ 2OTLZ 2R6MA 3IX0A 3PO3I 1YJW1 2JA5I 5IT9f 1VQ51 4RVFA 1YI21 3CCEZ 2QRCB 1VQP1 1QVFY 4A3LI 2M6NA 1VQ71 5FLXb 3CC21 2K3RA 3CCR1 5IP9I 3M3YI 2LIYA 4E2ZA 1JJ2Y 5C4XI 3JAMf 3CXCY 2R92I 2YU9I 2RBLA 4E2WA 1P9NA 5AN9F 3J80b 2QREB 3G711 3CQZI 2OTJ1 3QWUA 1I50I 1Y1VS 4DGLA 3I56Z 2VF1A 2E2HI 1VQ81 2QLVB 2EGTA 2GU2A 4A3II 3CMEZ 3HOUI 1RNIA 2V8JA 2PK7A 4DQYB 3S1MI 3TE5B 1Q821 4A3EI 2G2KA 3TDHB 1VQ5Z 1NJI1 1Y1WI 1TWCI 3VB9A 1K9M1 3I4MI 3HKZA 1W2BZ 1Q7Y1 4Y52I 1RO4A 3NH5A 5IT9b 1VQMZ 3Q87A 1X3WA 3CCUZ 5C44I 2DE7A 3I07A 3GTGI 1VQ9Z 4E32A 4NB9A 1PFTA 4NBEA 1YJN1 1RLYA 1Q861 1ML8A 2QEX1 3KIHA 1YJ9Z 3GKQA 3H0GI 3JAMb 3HOVI 2QA4Z 3S17I 4RVGA 2YADA 4AYBA 2QRDB 1QVGZ 4A3CI 1I3QI 3FKII 1NJI2 4A3KI 1K9M2 1Q7Y2 1X3ZA 3VTNA 4RVDA 3CCSZ 1KQSY 2P28A 1USPB 4RV9A 3GTPI 1S72Z 4TNUA 2HU9A 3CCMZ 4S1TA 3PO3S 3NDIA 1M1K1 1X0TA 5LL6f 2NVTI 2WB1A 1Q862 4X6AI 3VMIA 3FQQA 3HOYI 2F4OA 1NUIA 2KPIA 2JNYA 3U50C 4BBRI 3D9XA 4BY1I 4NFRA 4XX2A 3CCJ1 4A3GI 4BBSI 2J6AA 1YIJ1 2KI7B 3I551 3VMHA 4A3DI 3EERA 2O4HA 3J7A4 4A3JI 1M1K2 1QVFZ 1YIT1 1TFIA 3D6WA 2BJOA 2E2II 3EEDA 2RPRA 4NH1C 3CC4Z 4QTUA 2E2JI 2NVXI 3NFZA 1VQLZ 4MD9A 4HGZA 1NP6A 3J81f 5D1PA 2PM9A 2IZ4A 2R93I 2GTIA 2OOXB 1VQ41 1JJ2Z 3CXCZ 3CCQ1 1QF8A 3G6EZ 1ZH1A 1VQ6Z 4RVHA 3CMAZ 1YHQ1 3GTMI 1TWHI 1I6HI 1WCMI 2AKLA 3S2DI 4E2YA 2JS4A 1SFOI 3OW2Y 3BG0B 3CCV1 1YJWZ 1VLAA 2LFUA 2JUBA 4E31A 1N2FA 5FLMI 4RS4A 1YI2Z 4NBFA 4QTTA 1TWAI 1VQPZ 3F3PC 1VQK1 2H85A 3S16I 2M48A 1VQ7Z 3GTQI 3G4S1 3CC2Z 4A93I 5T67A 1RO0A 2NVQI 2OZKA 5D1OB 2P3YA 3CCRZ 1Q812 4Y7NI 3CCL1 1K8A1 4DK1A 2OOYB 3GTKI 1Y1VI 1TWGI 3G71Z 1KRLA 2OTJZ 3J81b 4EWCA 1VQN1 2OTL1 3CPWZ 1VQO1 1USPA 1VQ8Z 4HH4A 3GTJI 2RT9A 1QVGY 1QYPA 4NBCA 3S14I 3CCE1 3VMGA 1K8A2 2Q4ZA 2JMOA 3HOXI 5C3EI 1KC81
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K73 1;  3I56 Z;  3CCQ Z;  3G4S Z;  1VQ8 1;  1M1K 2;  1QVF Z;  1YIT 1;  3CCL Z;  1YHQ Z;  3CME Z;  3CC4 Z;  1Q82 1;  1YJN Z;  1VQL Z;  1N8R 1;  1VQ5 Z;  1NJI 1;  3CPW Y;  3CCV Z;  2QEX Z;  1K9M 1;  1W2B Z;  1Q7Y 1;  1VQ4 1;  1Q82 2;  1VQM Z;  1JJ2 Z;  3CXC Z;  3CC7 Z;  3I56 1;  1VQK Z;  3CCQ 1;  1KQS Z;  3G6E Z;  3CCU Z;  1VQ6 Z;  3CMA Z;  1YHQ 1;  3CME 1;  1VQO Z;  1VQ9 Z;  3CC4 1;  1KC8 2;  1K73 2;  1YJN 1;  1VQL 1;  3OW2 Y;  3CD6 1;  1Q86 1;  3CCV 1;  1YJW Z;  2QEX 1;  1YJ9 Z;  1YI2 Z;  1VQM 1;  2QA4 Z;  1VQP Z;  1M90 1;  1VQK 1;  1Q81 1;  1QVG Z;  1N8R 2;  3CCU 1;  3G6E 1;  1VQ7 Z;  1KD1 1;  1NJI 2;  3G4S 1;  3CC2 Z;  1VQ6 1;  3CMA 1;  1K9M 2;  1VQ9 1;  1Q7Y 2;  1VQN Z;  2OTL Z;  3CCR Z;  1Q81 2;  3CCL 1;  1K8A 1;  3CCS Z;  1KQS Y;  1YJW 1;  1VQ5 1;  1YJ9 1;  1YI2 1;  1S72 Z;  3CCE Z;  2QA4 1;  3CCM Z;  1VQP 1;  1QVF Y;  1M1K 1;  3CCJ Z;  3CC7 1;  1VQ7 1;  3G71 Z;  3OW2 Z;  3CC2 1;  1Q86 2;  2OTJ Z;  1YIJ Z;  3I55 Z;  1VQN 1;  2OTL 1;  3CCR 1;  3CPW Z;  1VQO 1;  1M90 2;  1VQ8 Z;  3CCS 1;  1YIT Z;  1W2B Y;  1QVG Y;  1KD1 2;  1JJ2 Y;  3CXC Y;  1S72 1;  3CCE 1;  3CD6 Z;  3CCM 1;  1K8A 2;  3CCJ 1;  3G71 1;  2OTJ 1;  1YIJ 1;  1VQ4 Z;  3I55 1;  1KC8 1; 
#chains in the Genus database with same CATH topology
 1YUK A;  3G4S Z;  2DE6 A;  3FQM A;  1YUA A;  3HOW I;  3CCL Z;  3BG1 B;  1Z03 A;  1AA6 A;  3HOZ I;  1YJN Z;  1N8R 1;  5A2Q f;  1FDO A;  4MH4 A;  3H3V J;  2QEX Z;  4E30 A;  4MD8 A;  1TWF I;  3IFU A;  1Y8C A;  3I56 1;  3K7A I;  2DE5 A;  2HF1 A;  4MXU A;  3CME 1;  1VQO Z;  1KC8 2;  3GTL I;  3PO2 I;  3LUS A;  2E9H A;  2RHB A;  2O53 A;  2GTH A;  3GTM S;  3CD6 1;  2VPW A;  3NH8 A;  2NVY I;  4NBH A;  2PMZ A;  4MRI A;  2VUG A;  2AYD A;  1VQM 1;  2B63 I;  4HGY A;  1M90 1;  1Q81 1;  4NBD A;  1N8R 2;  2R7Z I;  3CCU 1;  1KD1 1;  3M4O I;  4A3M I;  1VQ9 1;  1K83 I;  3RZD I;  2JIO A;  1Z01 A;  3NH4 A;  2W03 A;  1RQF A;  4MON A;  2JR6 A;  1YJ9 1;  2QA4 1;  3D2L A;  1WII A;  2F4M A;  1RO2 A;  5CM2 M;  3CCJ Z;  3CC7 1;  5D1O A;  2NAP A;  4NBG A;  5A2Q b;  3OW2 Z;  5T6B A;  4NBB A;  4MD7 A;  1YIJ Z;  2IV2 X;  3I55 Z;  2JA6 I;  1LQL A;  3I4N I;  2I3C A;  1M90 2;  3ESW A;  4A3F I;  2VUM I;  3CCS 1;  1YIT Z;  1W2B Y;  1KD1 2;  3S1N I;  5T64 A;  2Y0S A;  3S1Q I;  1S72 1;  1R9T I;  3MZL B;  3CD6 Z;  3CCM 1;  2K5R A;  3GCF A;  3GTO I;  1ZB9 A;  1VQ4 Z;  2QR1 B;  3S2H I;  3S15 I;  2RIQ A;  1K73 1;  4NB8 A;  3CCQ Z;  2VPZ A;  3IF8 A;  1YHQ Z;  2W04 A;  2JA7 I;  2LEX A;  1Z02 A;  1S7M A;  4E33 A;  2QKD A;  5FLX f;  1L1O C;  3CPW Y;  3T4N B;  3CCV Z;  1Q16 A;  1DL6 A;  2JA8 I;  1Q82 2;  5C4J I;  3CC7 Z;  1VQK Z;  2ZAE B;  4CL1 A;  1KQS Z;  4BXX I;  3F3F C;  4NBA A;  3KIF A;  1JWH C;  3RZO I;  3P5J B;  2WAQ A;  3CC4 1;  2JIQ A;  1WW9 A;  1ZB8 A;  4NOZ A;  1K73 2;  2V8I A;  1VQL 1;  3J80 f;  4E2X A;  3MON A;  3S1R I;  2Q51 A;  2V8K A;  4A3B I;  3MZK B;  5IP7 I;  3NDJ A;  2IZ3 A;  1WJ2 A;  3G6E 1;  4BY7 I;  1VQ6 1;  3CMA 1;  1VQN Z;  2OTL Z;  2R6M A;  3IX0 A;  3PO3 I;  1YJW 1;  2JA5 I;  5IT9 f;  1VQ5 1;  4RVF A;  1YI2 1;  3CCE Z;  2QRC B;  1VQP 1;  1QVF Y;  4A3L I;  2M6N A;  1VQ7 1;  5FLX b;  3CC2 1;  1SIW A;  2K3R A;  3CCR 1;  5IP9 I;  3M3Y I;  2LIY A;  4E2Z A;  1JJ2 Y;  5C4X I;  3JAM f;  3CXC Y;  2VPY A;  2R92 I;  2YU9 I;  2RBL A;  4E2W A;  1P9N A;  5AN9 F;  3J80 b;  2QRE B;  3G71 1;  3CQZ I;  2V45 A;  3QWU A;  2OTJ 1;  1I50 I;  1Y1V S;  4DGL A;  3I56 Z;  2VF1 A;  2E2H I;  1VQ8 1;  2QLV B;  2EGT A;  2GU2 A;  4A3I I;  3CME Z;  3HOU I;  1RNI A;  2V8J A;  2PK7 A;  4DQY B;  3S1M I;  3TE5 B;  2JIP A;  1Q82 1;  2E7Z A;  4A3E I;  2G2K A;  3TDH B;  1VQ5 Z;  1NJI 1;  1Y1W I;  1TWC I;  3VB9 A;  1K9M 1;  3I4M I;  3HKZ A;  1W2B Z;  1Q7Y 1;  4Y52 I;  1RO4 A;  3NH5 A;  5IT9 b;  1VQM Z;  3Q87 A;  1X3W A;  3CCU Z;  5C44 I;  2DE7 A;  3I07 A;  3GTG I;  1VQ9 Z;  4E32 A;  4NB9 A;  1PFT A;  4NBE A;  1YJN 1;  1RLY A;  1Q86 1;  1ML8 A;  2QEX 1;  3KIH A;  1YJ9 Z;  3GKQ A;  3H0G I;  3JAM b;  3HOV I;  2QA4 Z;  3S17 I;  4RVG A;  2YAD A;  4AYB A;  2QRD B;  1QVG Z;  4A3C I;  1I3Q I;  3FKI I;  1NJI 2;  4A3K I;  1WZN A;  1K9M 2;  1QXF A;  1Q7Y 2;  1X3Z A;  3VTN A;  4RVD A;  3CCS Z;  1KQS Y;  2P28 A;  1USP B;  4RV9 A;  3GTP I;  1S72 Z;  4TNU A;  2HU9 A;  3CCM Z;  4S1T A;  3PO3 S;  3NDI A;  1M1K 1;  1X0T A;  5LL6 f;  2NVT I;  2WB1 A;  1Q86 2;  4X6A I;  3VMI A;  3FQQ A;  3HOY I;  2F4O A;  1NUI A;  2KPI A;  2JNY A;  3U50 C;  4BBR I;  3D9X A;  4BY1 I;  4NFR A;  4XX2 A;  3CCJ 1;  4A3G I;  4BBS I;  2J6A A;  1YIJ 1;  2VPX A;  2KI7 B;  3I55 1;  3VMH A;  4A3D I;  3EER A;  2O4H A;  3J7A 4;  4A3J I;  1M1K 2;  1QVF Z;  1YIT 1;  1TFI A;  3D6W A;  2BJO A;  2E2I I;  3EED A;  2RPR A;  4NH1 C;  3CC4 Z;  4QTU A;  2E2J I;  2NVX I;  3NFZ A;  1VQL Z;  4MD9 A;  4HGZ A;  1NP6 A;  3J81 f;  5D1P A;  2PM9 A;  2IZ4 A;  2R93 I;  2GTI A;  2OOX B;  1VQ4 1;  1JJ2 Z;  3CXC Z;  3CCQ 1;  1QF8 A;  3G6E Z;  1ZH1 A;  1VQ6 Z;  4RVH A;  3CMA Z;  1YHQ 1;  3GTM I;  1TWH I;  1I6H I;  1WCM I;  2AKL A;  3S2D I;  4E2Y A;  2JS4 A;  1SFO I;  3OW2 Y;  3BG0 B;  3CCV 1;  1YJW Z;  1VLA A;  2LFU A;  2JUB A;  4E31 A;  2JIR A;  1N2F A;  5FLM I;  4RS4 A;  1YI2 Z;  4NBF A;  4QTT A;  1TWA I;  1VQP Z;  3F3P C;  1VQK 1;  2H85 A;  3S16 I;  2M48 A;  1FDI A;  1VQ7 Z;  3GTQ I;  3G4S 1;  3CC2 Z;  4A93 I;  5T67 A;  1RO0 A;  2NVQ I;  2OZK A;  5D1O B;  2P3Y A;  3CCR Z;  1Q81 2;  4Y7N I;  3CCL 1;  1K8A 1;  4DK1 A;  2OOY B;  2V3V A;  3GTK I;  1Y1V I;  1TWG I;  3G71 Z;  1KRL A;  2OTJ Z;  3J81 b;  4EWC A;  2JIM A;  2OTL 1;  1VQN 1;  3CPW Z;  1VQO 1;  1USP A;  1VQ8 Z;  4HH4 A;  3GTJ I;  2RT9 A;  1QVG Y;  1QYP A;  4NBC A;  3S14 I;  3CCE 1;  3VMG A;  1K8A 2;  2Q4Z A;  3IR7 A;  2JMO A;  3HOX I;  5C3E I;  1KC8 1; 
#chains in the Genus database with same CATH homology
 1YUK A;  3G4S Z;  2DE6 A;  3FQM A;  1YUA A;  3HOW I;  3CCL Z;  3BG1 B;  1Z03 A;  3HOZ I;  1YJN Z;  1N8R 1;  5A2Q f;  4MH4 A;  3H3V J;  2QEX Z;  4E30 A;  4MD8 A;  1TWF I;  3IFU A;  3I56 1;  3K7A I;  2DE5 A;  2HF1 A;  4MXU A;  3CME 1;  1VQO Z;  1KC8 2;  3GTL I;  3PO2 I;  3LUS A;  2E9H A;  2RHB A;  2O53 A;  2GTH A;  3GTM S;  3CD6 1;  3NH8 A;  2NVY I;  4NBH A;  2PMZ A;  4MRI A;  2VUG A;  1VQM 1;  2B63 I;  4HGY A;  1M90 1;  1Q81 1;  4NBD A;  1N8R 2;  2R7Z I;  3CCU 1;  1KD1 1;  3M4O I;  4A3M I;  1VQ9 1;  1K83 I;  3RZD I;  1Z01 A;  3NH4 A;  2W03 A;  1RQF A;  4MON A;  2JR6 A;  1YJ9 1;  2QA4 1;  1WII A;  2F4M A;  1RO2 A;  5CM2 M;  3CCJ Z;  3CC7 1;  5D1O A;  4NBG A;  5A2Q b;  3OW2 Z;  5T6B A;  4NBB A;  4MD7 A;  1YIJ Z;  3I55 Z;  2JA6 I;  1LQL A;  3I4N I;  2I3C A;  1M90 2;  3ESW A;  4A3F I;  2VUM I;  3CCS 1;  1YIT Z;  1W2B Y;  1KD1 2;  3S1N I;  5T64 A;  2Y0S A;  3S1Q I;  1S72 1;  1R9T I;  3MZL B;  3CD6 Z;  3CCM 1;  2K5R A;  3GCF A;  3GTO I;  1ZB9 A;  1VQ4 Z;  2QR1 B;  3S2H I;  3S15 I;  2RIQ A;  1K73 1;  4NB8 A;  3CCQ Z;  3IF8 A;  1YHQ Z;  2W04 A;  2JA7 I;  1Z02 A;  1S7M A;  4E33 A;  2QKD A;  5FLX f;  1L1O C;  3CPW Y;  3T4N B;  3CCV Z;  1DL6 A;  2JA8 I;  1Q82 2;  5C4J I;  3CC7 Z;  1VQK Z;  2ZAE B;  4CL1 A;  1KQS Z;  4BXX I;  3F3F C;  4NBA A;  3KIF A;  1JWH C;  3RZO I;  3P5J B;  2WAQ A;  3CC4 1;  1WW9 A;  1ZB8 A;  4NOZ A;  1K73 2;  2V8I A;  1VQL 1;  3J80 f;  4E2X A;  3MON A;  3S1R I;  2Q51 A;  2V8K A;  4A3B I;  3MZK B;  5IP7 I;  3NDJ A;  2IZ3 A;  3G6E 1;  4BY7 I;  1VQ6 1;  3CMA 1;  1VQN Z;  2OTL Z;  2R6M A;  3IX0 A;  3PO3 I;  1YJW 1;  2JA5 I;  5IT9 f;  1VQ5 1;  4RVF A;  1YI2 1;  3CCE Z;  2QRC B;  1VQP 1;  1QVF Y;  4A3L I;  2M6N A;  1VQ7 1;  5FLX b;  3CC2 1;  2K3R A;  3CCR 1;  5IP9 I;  3M3Y I;  2LIY A;  4E2Z A;  1JJ2 Y;  5C4X I;  3JAM f;  3CXC Y;  2R92 I;  2YU9 I;  2RBL A;  4E2W A;  1P9N A;  5AN9 F;  3J80 b;  2QRE B;  3G71 1;  3CQZ I;  2OTJ 1;  3QWU A;  1I50 I;  1Y1V S;  4DGL A;  3I56 Z;  2VF1 A;  2E2H I;  1VQ8 1;  2QLV B;  2EGT A;  2GU2 A;  4A3I I;  3CME Z;  3HOU I;  1RNI A;  2V8J A;  2PK7 A;  4DQY B;  3S1M I;  3TE5 B;  1Q82 1;  4A3E I;  2G2K A;  3TDH B;  1VQ5 Z;  1NJI 1;  1Y1W I;  1TWC I;  3VB9 A;  1K9M 1;  3I4M I;  3HKZ A;  1W2B Z;  1Q7Y 1;  4Y52 I;  1RO4 A;  3NH5 A;  5IT9 b;  1VQM Z;  3Q87 A;  1X3W A;  3CCU Z;  5C44 I;  2DE7 A;  3I07 A;  3GTG I;  1VQ9 Z;  4E32 A;  4NB9 A;  1PFT A;  4NBE A;  1YJN 1;  1RLY A;  1Q86 1;  1ML8 A;  2QEX 1;  3KIH A;  1YJ9 Z;  3GKQ A;  3H0G I;  3JAM b;  3HOV I;  2QA4 Z;  3S17 I;  4RVG A;  2YAD A;  4AYB A;  2QRD B;  1QVG Z;  4A3C I;  1I3Q I;  3FKI I;  1NJI 2;  4A3K I;  1K9M 2;  1Q7Y 2;  1X3Z A;  3VTN A;  4RVD A;  3CCS Z;  1KQS Y;  2P28 A;  1USP B;  4RV9 A;  3GTP I;  1S72 Z;  4TNU A;  2HU9 A;  3CCM Z;  4S1T A;  3PO3 S;  3NDI A;  1M1K 1;  1X0T A;  5LL6 f;  2NVT I;  2WB1 A;  1Q86 2;  4X6A I;  3VMI A;  3FQQ A;  3HOY I;  2F4O A;  1NUI A;  2KPI A;  2JNY A;  3U50 C;  4BBR I;  3D9X A;  4BY1 I;  4NFR A;  4XX2 A;  3CCJ 1;  4A3G I;  4BBS I;  2J6A A;  1YIJ 1;  2KI7 B;  3I55 1;  3VMH A;  4A3D I;  3EER A;  2O4H A;  3J7A 4;  4A3J I;  1M1K 2;  1QVF Z;  1YIT 1;  1TFI A;  3D6W A;  2BJO A;  2E2I I;  3EED A;  2RPR A;  4NH1 C;  3CC4 Z;  4QTU A;  2E2J I;  2NVX I;  3NFZ A;  1VQL Z;  4MD9 A;  4HGZ A;  1NP6 A;  3J81 f;  5D1P A;  2PM9 A;  2IZ4 A;  2R93 I;  2GTI A;  2OOX B;  1VQ4 1;  1JJ2 Z;  3CXC Z;  3CCQ 1;  1QF8 A;  3G6E Z;  1ZH1 A;  1VQ6 Z;  4RVH A;  3CMA Z;  1YHQ 1;  3GTM I;  1TWH I;  1I6H I;  1WCM I;  2AKL A;  3S2D I;  4E2Y A;  2JS4 A;  1SFO I;  3OW2 Y;  3BG0 B;  3CCV 1;  1YJW Z;  1VLA A;  2LFU A;  2JUB A;  4E31 A;  1N2F A;  5FLM I;  4RS4 A;  1YI2 Z;  4NBF A;  4QTT A;  1TWA I;  1VQP Z;  3F3P C;  1VQK 1;  2H85 A;  3S16 I;  2M48 A;  1VQ7 Z;  3GTQ I;  3G4S 1;  3CC2 Z;  4A93 I;  5T67 A;  1RO0 A;  2NVQ I;  2OZK A;  5D1O B;  2P3Y A;  3CCR Z;  1Q81 2;  4Y7N I;  3CCL 1;  1K8A 1;  4DK1 A;  2OOY B;  3GTK I;  1Y1V I;  1TWG I;  3G71 Z;  1KRL A;  2OTJ Z;  3J81 b;  4EWC A;  1VQN 1;  2OTL 1;  3CPW Z;  1VQO 1;  1USP A;  1VQ8 Z;  4HH4 A;  3GTJ I;  2RT9 A;  1QVG Y;  1QYP A;  4NBC A;  3S14 I;  3CCE 1;  3VMG A;  1K8A 2;  2Q4Z A;  2JMO A;  3HOX I;  5C3E I;  1KC8 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...