2OTJZ

13-deoxytedanolide bound to the large subunit of haloarcula marismortui
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
b'RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
molecule tags Ribosome
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
total genus 16
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2007-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2otjZ00
1W2BY 3G4S1 3CCEZ 1K8A2 1VQ5Z 1QVFY 1VQ7Z 1YJNZ 3I561 1YJW1 1VQPZ 1YIT1 3OW2Y 3CCVZ 1K9M1 3CCQZ 2OTJ1 1JJ2Z 3G6E1 1W2BZ 1YI2Z 3CC4Z 1KQSY 1YHQ1 1KD11 1S72Z 1QVFZ 3CME1 2QA4Z 1VQ9Z 1KQSZ 3G6EZ 3CC71 1VQ4Z 1VQN1 1YITZ 3I551 1N8R2 3CC7Z 1NJI1 1VQK1 2OTL1 1Q862 1VQ71 1YJ9Z 1Q7Y1 1VQ91 2OTJZ 3CXCZ 1K732 1KC81 3CCJ1 1M902 3I56Z 1KD12 3CCV1 1VQM1 3CCQ1 1YIJZ 1K731 1VQOZ 1Q811 2QA41 1Q7Y2 1N8R1 1VQ41 1VQNZ 3CC41 3CMA1 1S721 1VQMZ 3G4SZ 3CCE1 3CC2Z 1VQL1 3CCMZ 1K9M2 3CD6Z 1VQKZ 2OTLZ 1YJWZ 2QEX1 1Q821 1Q812 1VQO1 3CCR1 3CD61 1YI21 3CCSZ 3OW2Z 3CMAZ 3CXCY 3CCJZ 1M1K1 1QVGY 3CCM1 1Q861 3CCL1 3CCUZ 1VQ8Z 1VQ61 1YIJ1 1QVGZ 3CCS1 3G711 2QEXZ 1YHQZ 1JJ2Y 1NJI2 3CMEZ 3CCRZ 1VQP1 3CPWZ 3CCU1 1VQ81 1KC82 1VQ6Z 3CC21 1VQLZ 1M901 3G71Z 1M1K2 1VQ51 3CPWY 1K8A1 3I55Z 1YJ91 1YJN1 3CCLZ 1Q822
chains in the Genus database with same CATH superfamily
3GTJI 4E31A 4BY7I 1P9NA 1TWHI 2VPYA 2M48A 5C4JI 1YJNZ 3HOWI 3VTNA 3D2LA 4NBEA 3OW2Y 3NDIA 1Q16A 1JJ2Z 4Y7NI 2HF1A 4RVHA 2RIQA 2VPXA 2V8JA 1YHQ1 1S72Z 4TNUA 4A3DI 2QA4Z 1VQ9Z 1VLAA 4BXXI 2OOXB 3P5JB 4A3BI 2RBLA 3EERA 1N8R2 2OTL1 2GTHA 3I4MI 2R7ZI 2O4HA 4E2XA 2ZAEB 1Q7Y1 3FQMA 3H3VJ 1FDOA 5T64A 2JUBA 4QTUA 3T4NB 2NVXI 1K732 2I3CA 3I56Z 2H85A 2Q4ZA 1VQM1 1YIJZ 5FLMI 1VQOZ 2QA41 3S2DI 5A2Qf 4MH4A 2JA5I 2AKLA 2K5RA 3IR7A 1JWHC 1VQL1 3CCMZ 2QREB 3FKII 3D9XA 5A2Qb 4NB8A 2OTLZ 3IX0A 3S16I 3QWUA 3HOZI 3CCR1 4MD9A 5AN9F 1QF8A 1QYPA 2LEXA 1Y1VS 2LIYA 2V8KA 1AA6A 1ML8A 4NBDA 3CMAZ 1Y1WI 1M1K1 2P28A 2R92I 1VQ61 2NVTI 1YIJ1 2JS4A 2QEXZ 1ZH1A 4RV9A 3CMEZ 3CPWZ 3CCU1 2YADA 1X3WA 1Y1VI 3VMHA 1VQLZ 1LQLA 2B63I 3CPWY 1K8A1 5D1OA 1YJN1 1L1OC 5LL6f 2HU9A 4HGYA 4S1TA 1W2BY 4NB9A 4NBFA 1WJ2A 4A3CI 3RZDI 3I561 1YIT1 3M3YI 2JR6A 2PMZA 3J81f 1SFOI 4A3LI 2E2HI 3GTMI 3VMIA 3S1NI 3J80f 1X3ZA 2JA6I 1YI2Z 1RO2A 3F3FC 3IFUA 4CL1A 3PO2I 1X0TA 3CME1 1KQSZ 3G6EZ 3EEDA 4DGLA 3HKZA 2J6AA 1YUAA 2DE5A 1NJI1 2F4MA 1VQK1 2YU9I 3GTOI 2QKDA 1YJ9Z 3KIFA 1KRLA 4A3EI 2JMOA 1USPA 3CCJ1 4Y52I 1M902 2VF1A 5C4XI 1USPB 1I3QI 3CCV1 3I07A 3CCQ1 2K3RA 3GCFA 5IT9f 2VUGA 4NBAA 1R9TI 3MZKB 2E9HA 4E33A 1RLYA 2GTIA 1S7MA 1K9M2 2E7ZA 1VQKZ 3ESWA 5FLXf 1Q821 2O53A 2QRDB 4QTTA 3CD61 1YI21 3OW2Z 3CCJZ 3CCL1 3CCUZ 4BBSI 1TWFI 1I6HI 1QVGZ 3CCS1 2JIQA 1Y8CA 3IF8A 1JJ2Y 1NJI2 1RQFA 4A3FI 1KC82 2P3YA 4RVDA 5T6BA 3I55Z 5C3EI 1YJ91 5D1OB 2KI7B 1WZNA 3KIHA 3G4S1 3CCEZ 1VQ5Z 3F3PC 2PK7A 1VQPZ 3VMGA 3CCVZ 3CCQZ 4A3GI 4AYBA 3G6E1 1Z01A 3NH5A 1WCMI 3RZOI 3M4OI 1QXFA 1KQSY 1QVFZ 3BG0B 3I4NI 1NUIA 1VQN1 2W03A 2JIMA 1ZB9A 2JIRA 4XX2A 3I551 3D6WA 3S1RI 3HOYI 2Q51A 1WW9A 2R6MA 2EGTA 3CC7Z 3HOVI 1Q862 3U50C 4NOZA 1TFIA 1WIIA 1VQ91 2Y0SA 2WB1A 2OOYB 2BJOA 3J7A4 2JA7I 3GTPI 4A3II 4A3MI 2DE6A 1KD12 1NP6A 2IZ4A 5D1PA 3S2HI 4X6AI 1VQNZ 1PFTA 3CC41 3FQQA 4A3JI 3CMA1 4NBHA 3G4SZ 3CCE1 3H0GI 1Z03A 3CC2Z 2RHBA 3Q87A 2G2KA 3MONA 2JA8I 3GKQA 5IP9I 3CD6Z 2W04A 2QEX1 1Z02A 2NVYI 4MONA 4HGZA 1VQO1 4E32A 1N2FA 3LUSA 1ZB8A 2V8IA 3CCSZ 4E2ZA 4MD8A 2E2JI 2NAPA 4E2WA 3CCM1 3JAMb 4NFRA 3HOUI 2AYDA 2LFUA 3J81b 3CCRZ 3S1MI 1VQ81 4A3KI 3CC21 2E2II 3G71Z 1VQ51 3BG1B 2WAQA 3NFZA 1RO0A 3CQZI 1K8A2 4BY1I 3NH4A 5IT9b 1QVFY 1VQ7Z 4MD7A 1YJW1 1K9M1 2IZ3A 2OTJ1 2F4OA 4NBGA 2DE7A 2VPWA 1W2BZ 5FLXb 4NBBA 3CC4Z 3S14I 1KD11 1I50I 1DL6A 5T67A 3S15I 3PO3S 3J80b 3GTKI 3CC71 1VQ4Z 2JIOA 4RVFA 2KPIA 1YITZ 4DK1A 4NH1C 2PM9A 1VQ71 4EWCA 3JAMf 3S17I 3TDHB 3TE5B 2OTJZ 2VPZA 2QR1B 3CXCZ 1KC81 5C44I 3PO3I 3MZLB 2RT9A 1TWCI 2GU2A 1K731 3GTQI 2QLVB 1Q811 2R93I 1Q7Y2 1N8R1 2IV2X 1VQ41 4MXUA 5IP7I 1K83I 2V3VA 1S721 1VQMZ 2RPRA 2VUMI 4E30A 2JNYA 3VB9A 4DQYB 2M6NA 1RO4A 1YJWZ 4A93I 3K7AI 1TWGI 4NBCA 1Q812 2QRCB 1SIWA 3NDJA 1TWAI 4BBRI 3GTMS 4MRIA 3CXCY 2V45A 1QVGY 1Q861 4E2YA 1VQ8Z 5CM2M 3G711 4RS4A 1YHQZ 3S1QI 4HH4A 1VQP1 2NVQI 3NH8A 3HOXI 1VQ6Z 1FDIA 1YUKA 2JIPA 4RVGA 1M901 3GTGI 1M1K2 1RNIA 2OZKA 3GTLI 3CCLZ 1Q822
chains in the Genus database with same CATH topology
3GTJI 4E31A 4BY7I 1P9NA 1TWHI 2M48A 5C4JI 1YJNZ 3HOWI 3VTNA 4NBEA 3OW2Y 3NDIA 1JJ2Z 4Y7NI 2HF1A 4RVHA 2RIQA 2V8JA 1YHQ1 1S72Z 4TNUA 4A3DI 2QA4Z 1VQ9Z 1VLAA 4BXXI 2OOXB 3P5JB 4A3BI 2RBLA 3EERA 1N8R2 2OTL1 2GTHA 3I4MI 2R7ZI 2O4HA 4E2XA 2ZAEB 1Q7Y1 3FQMA 3H3VJ 5T64A 2JUBA 4QTUA 3T4NB 2NVXI 1K732 2I3CA 3I56Z 2H85A 2Q4ZA 1VQM1 1YIJZ 5FLMI 1VQOZ 2QA41 3S2DI 5A2Qf 4MH4A 2JA5I 2AKLA 2K5RA 1JWHC 1VQL1 3CCMZ 2QREB 3FKII 3D9XA 5A2Qb 4NB8A 2OTLZ 3IX0A 3S16I 3QWUA 3HOZI 3CCR1 4MD9A 5AN9F 1QF8A 1QYPA 1Y1VS 2LIYA 2V8KA 3CMAZ 1ML8A 4NBDA 1Y1WI 1M1K1 2P28A 2R92I 1VQ61 2NVTI 1YIJ1 2JS4A 2QEXZ 1ZH1A 4RV9A 3CMEZ 3CPWZ 3CCU1 2YADA 1X3WA 1Y1VI 3VMHA 1VQLZ 1LQLA 2B63I 3CPWY 1K8A1 5D1OA 1YJN1 1L1OC 5LL6f 2HU9A 4HGYA 4S1TA 1W2BY 4NB9A 4NBFA 4A3CI 3RZDI 3I561 1YIT1 3M3YI 2JR6A 2PMZA 3J81f 1SFOI 4A3LI 2E2HI 3GTMI 3VMIA 3S1NI 3J80f 1X3ZA 2JA6I 1YI2Z 1RO2A 3F3FC 3IFUA 4CL1A 3PO2I 1X0TA 3CME1 1KQSZ 3G6EZ 3EEDA 4DGLA 3HKZA 2J6AA 1YUAA 2DE5A 1NJI1 2F4MA 1VQK1 2YU9I 3GTOI 2QKDA 1YJ9Z 3KIFA 1KRLA 4A3EI 2JMOA 1USPA 3CCJ1 4Y52I 1M902 2VF1A 5C4XI 1USPB 1I3QI 3CCV1 3I07A 3CCQ1 2K3RA 3GCFA 5IT9f 2VUGA 4NBAA 1R9TI 3MZKB 2E9HA 4E33A 1RLYA 2GTIA 1S7MA 1K9M2 1VQKZ 3ESWA 5FLXf 1Q821 2O53A 2QRDB 4QTTA 3CD61 1YI21 3OW2Z 3CCJZ 3CCL1 3CCUZ 4BBSI 1TWFI 1I6HI 1QVGZ 3CCS1 3IF8A 1JJ2Y 1NJI2 1RQFA 4A3FI 1KC82 2P3YA 4RVDA 5T6BA 3I55Z 5C3EI 1YJ91 5D1OB 2KI7B 3KIHA 3G4S1 3CCEZ 1VQ5Z 3F3PC 2PK7A 1VQPZ 3VMGA 3CCVZ 3CCQZ 4A3GI 4AYBA 3G6E1 1Z01A 3NH5A 1WCMI 3RZOI 3M4OI 1KQSY 1QVFZ 3BG0B 3I4NI 1NUIA 1VQN1 2W03A 1ZB9A 4XX2A 3I551 3D6WA 3S1RI 3HOYI 2Q51A 1WW9A 2R6MA 2EGTA 3CC7Z 3HOVI 1Q862 3U50C 4NOZA 1TFIA 1WIIA 1VQ91 2Y0SA 2WB1A 2OOYB 2BJOA 3J7A4 2JA7I 3GTPI 4A3II 4A3MI 2DE6A 1KD12 1NP6A 2IZ4A 5D1PA 3S2HI 4X6AI 1VQNZ 1PFTA 3CC41 3FQQA 4A3JI 3CMA1 4NBHA 3G4SZ 3CCE1 3H0GI 1Z03A 3CC2Z 2RHBA 3Q87A 2G2KA 3MONA 2JA8I 3GKQA 5IP9I 3CD6Z 2W04A 2QEX1 1Z02A 2NVYI 4MONA 4HGZA 1VQO1 4E32A 1N2FA 3LUSA 1ZB8A 2V8IA 3CCSZ 4E2ZA 4MD8A 2E2JI 4E2WA 3CCM1 3JAMb 4NFRA 3HOUI 2LFUA 3J81b 3CCRZ 3S1MI 1VQ81 4A3KI 3CC21 2E2II 3G71Z 1VQ51 3BG1B 2WAQA 3NFZA 1RO0A 3CQZI 1K8A2 4BY1I 3NH4A 5IT9b 1QVFY 1VQ7Z 4MD7A 1YJW1 1K9M1 2IZ3A 2OTJ1 2F4OA 4NBGA 1W2BZ 2DE7A 5FLXb 4NBBA 3CC4Z 3S14I 1KD11 1I50I 1DL6A 5T67A 3S15I 3PO3S 3J80b 3GTKI 3CC71 1VQ4Z 4RVFA 2KPIA 1YITZ 4DK1A 4NH1C 2PM9A 1VQ71 4EWCA 3JAMf 3S17I 3TDHB 3TE5B 2OTJZ 2QR1B 3CXCZ 1KC81 5C44I 3PO3I 3MZLB 2RT9A 1TWCI 2GU2A 1K731 3GTQI 2QLVB 1Q811 2R93I 1Q7Y2 1N8R1 1VQ41 4MXUA 5IP7I 1K83I 1S721 1VQMZ 2RPRA 2VUMI 4E30A 2JNYA 3VB9A 4DQYB 2M6NA 1RO4A 1YJWZ 4A93I 3K7AI 1TWGI 4NBCA 1Q812 2QRCB 3NDJA 1TWAI 4BBRI 3GTMS 4MRIA 3CXCY 1QVGY 1Q861 4E2YA 1VQ8Z 5CM2M 3G711 4RS4A 1YHQZ 3S1QI 4HH4A 1VQP1 2NVQI 3NH8A 3HOXI 1VQ6Z 1YUKA 4RVGA 1M901 3GTGI 1M1K2 1RNIA 2OZKA 3GTLI 3CCLZ 1Q822
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2B Y;  3G4S 1;  3CCE Z;  1K8A 2;  1VQ5 Z;  1QVF Y;  1VQ7 Z;  1YJN Z;  3I56 1;  1YJW 1;  1VQP Z;  1YIT 1;  3OW2 Y;  3CCV Z;  1K9M 1;  3CCQ Z;  2OTJ 1;  1JJ2 Z;  3G6E 1;  1W2B Z;  1YI2 Z;  3CC4 Z;  1KQS Y;  1YHQ 1;  1KD1 1;  1S72 Z;  1QVF Z;  3CME 1;  2QA4 Z;  1VQ9 Z;  1KQS Z;  3G6E Z;  3CC7 1;  1VQ4 Z;  1VQN 1;  1YIT Z;  3I55 1;  1N8R 2;  3CC7 Z;  1NJI 1;  1VQK 1;  2OTL 1;  1Q86 2;  1VQ7 1;  1YJ9 Z;  1Q7Y 1;  1VQ9 1;  2OTJ Z;  3CXC Z;  1K73 2;  1KC8 1;  3CCJ 1;  1M90 2;  3I56 Z;  1KD1 2;  3CCV 1;  1VQM 1;  3CCQ 1;  1YIJ Z;  1K73 1;  1VQO Z;  1Q81 1;  2QA4 1;  1Q7Y 2;  1N8R 1;  1VQ4 1;  1VQN Z;  3CC4 1;  3CMA 1;  1S72 1;  1VQM Z;  3G4S Z;  3CCE 1;  3CC2 Z;  1VQL 1;  3CCM Z;  1K9M 2;  3CD6 Z;  1VQK Z;  2OTL Z;  1YJW Z;  2QEX 1;  1Q82 1;  1Q81 2;  1VQO 1;  3CCR 1;  3CD6 1;  1YI2 1;  3CCS Z;  3OW2 Z;  3CMA Z;  3CXC Y;  3CCJ Z;  1M1K 1;  1QVG Y;  3CCM 1;  1Q86 1;  3CCL 1;  3CCU Z;  1VQ8 Z;  1VQ6 1;  1YIJ 1;  1QVG Z;  3CCS 1;  3G71 1;  2QEX Z;  1YHQ Z;  1JJ2 Y;  1NJI 2;  3CME Z;  3CCR Z;  1VQP 1;  3CPW Z;  3CCU 1;  1VQ8 1;  1KC8 2;  1VQ6 Z;  3CC2 1;  1VQL Z;  1M90 1;  3G71 Z;  1M1K 2;  1VQ5 1;  3CPW Y;  1K8A 1;  3I55 Z;  1YJ9 1;  1YJN 1;  3CCL Z;  1Q82 2; 
#chains in the Genus database with same CATH topology
 3GTJ I;  4E31 A;  4BY7 I;  1P9N A;  1TWH I;  2VPY A;  2M48 A;  5C4J I;  1YJN Z;  3HOW I;  3VTN A;  3D2L A;  4NBE A;  3OW2 Y;  3NDI A;  1Q16 A;  1JJ2 Z;  4Y7N I;  2HF1 A;  4RVH A;  2RIQ A;  2VPX A;  2V8J A;  1YHQ 1;  1S72 Z;  4TNU A;  4A3D I;  2QA4 Z;  1VQ9 Z;  1VLA A;  4BXX I;  2OOX B;  3P5J B;  4A3B I;  2RBL A;  3EER A;  1N8R 2;  2OTL 1;  2GTH A;  3I4M I;  2R7Z I;  2O4H A;  4E2X A;  2ZAE B;  1Q7Y 1;  3FQM A;  3H3V J;  1FDO A;  5T64 A;  2JUB A;  4QTU A;  3T4N B;  2NVX I;  1K73 2;  2I3C A;  3I56 Z;  2H85 A;  2Q4Z A;  1VQM 1;  1YIJ Z;  5FLM I;  1VQO Z;  2QA4 1;  3S2D I;  5A2Q f;  4MH4 A;  2JA5 I;  2AKL A;  2K5R A;  3IR7 A;  1JWH C;  1VQL 1;  3CCM Z;  2QRE B;  3FKI I;  3D9X A;  5A2Q b;  4NB8 A;  2OTL Z;  3IX0 A;  3S16 I;  3QWU A;  3HOZ I;  3CCR 1;  4MD9 A;  5AN9 F;  1QF8 A;  1QYP A;  2LEX A;  1Y1V S;  2LIY A;  2V8K A;  1AA6 A;  1ML8 A;  4NBD A;  3CMA Z;  1Y1W I;  1M1K 1;  2P28 A;  2R92 I;  1VQ6 1;  2NVT I;  1YIJ 1;  2JS4 A;  2QEX Z;  1ZH1 A;  4RV9 A;  3CME Z;  3CPW Z;  3CCU 1;  2YAD A;  1X3W A;  1Y1V I;  3VMH A;  1VQL Z;  1LQL A;  2B63 I;  3CPW Y;  1K8A 1;  5D1O A;  1YJN 1;  1L1O C;  5LL6 f;  2HU9 A;  4HGY A;  4S1T A;  1W2B Y;  4NB9 A;  4NBF A;  1WJ2 A;  4A3C I;  3RZD I;  3I56 1;  1YIT 1;  3M3Y I;  2JR6 A;  2PMZ A;  3J81 f;  1SFO I;  4A3L I;  2E2H I;  3GTM I;  3VMI A;  3S1N I;  3J80 f;  1X3Z A;  2JA6 I;  1YI2 Z;  1RO2 A;  3F3F C;  3IFU A;  4CL1 A;  3PO2 I;  1X0T A;  3CME 1;  1KQS Z;  3G6E Z;  3EED A;  4DGL A;  3HKZ A;  2J6A A;  1YUA A;  2DE5 A;  1NJI 1;  2F4M A;  1VQK 1;  2YU9 I;  3GTO I;  2QKD A;  1YJ9 Z;  3KIF A;  1KRL A;  4A3E I;  2JMO A;  1USP A;  3CCJ 1;  4Y52 I;  1M90 2;  2VF1 A;  5C4X I;  1USP B;  1I3Q I;  3CCV 1;  3I07 A;  3CCQ 1;  2K3R A;  3GCF A;  5IT9 f;  2VUG A;  4NBA A;  1R9T I;  3MZK B;  2E9H A;  4E33 A;  1RLY A;  2GTI A;  1S7M A;  1K9M 2;  2E7Z A;  1VQK Z;  3ESW A;  5FLX f;  1Q82 1;  2O53 A;  2QRD B;  4QTT A;  3CD6 1;  1YI2 1;  3OW2 Z;  3CCJ Z;  3CCL 1;  3CCU Z;  4BBS I;  1TWF I;  1I6H I;  1QVG Z;  3CCS 1;  2JIQ A;  1Y8C A;  3IF8 A;  1JJ2 Y;  1NJI 2;  1RQF A;  4A3F I;  1KC8 2;  2P3Y A;  4RVD A;  5T6B A;  3I55 Z;  5C3E I;  1YJ9 1;  5D1O B;  2KI7 B;  1WZN A;  3KIH A;  3G4S 1;  3CCE Z;  1VQ5 Z;  3F3P C;  2PK7 A;  1VQP Z;  3VMG A;  3CCV Z;  3CCQ Z;  4A3G I;  4AYB A;  3G6E 1;  1Z01 A;  3NH5 A;  1WCM I;  3RZO I;  3M4O I;  1QXF A;  1KQS Y;  1QVF Z;  3BG0 B;  3I4N I;  1NUI A;  1VQN 1;  2W03 A;  2JIM A;  1ZB9 A;  2JIR A;  4XX2 A;  3I55 1;  3D6W A;  3S1R I;  3HOY I;  2Q51 A;  1WW9 A;  2R6M A;  2EGT A;  3CC7 Z;  3HOV I;  1Q86 2;  3U50 C;  4NOZ A;  1TFI A;  1WII A;  1VQ9 1;  2Y0S A;  2WB1 A;  2OOY B;  2BJO A;  3J7A 4;  2JA7 I;  3GTP I;  4A3I I;  4A3M I;  2DE6 A;  1KD1 2;  1NP6 A;  2IZ4 A;  5D1P A;  3S2H I;  4X6A I;  1VQN Z;  1PFT A;  3CC4 1;  3FQQ A;  4A3J I;  3CMA 1;  4NBH A;  3G4S Z;  3CCE 1;  3H0G I;  1Z03 A;  3CC2 Z;  2RHB A;  3Q87 A;  2G2K A;  3MON A;  2JA8 I;  3GKQ A;  5IP9 I;  3CD6 Z;  2W04 A;  2QEX 1;  1Z02 A;  2NVY I;  4MON A;  4HGZ A;  1VQO 1;  4E32 A;  1N2F A;  3LUS A;  1ZB8 A;  2V8I A;  3CCS Z;  4E2Z A;  4MD8 A;  2E2J I;  2NAP A;  4E2W A;  3CCM 1;  3JAM b;  4NFR A;  3HOU I;  2AYD A;  2LFU A;  3J81 b;  3CCR Z;  3S1M I;  1VQ8 1;  4A3K I;  3CC2 1;  2E2I I;  3G71 Z;  1VQ5 1;  3BG1 B;  2WAQ A;  3NFZ A;  1RO0 A;  3CQZ I;  1K8A 2;  4BY1 I;  3NH4 A;  5IT9 b;  1QVF Y;  1VQ7 Z;  4MD7 A;  1YJW 1;  1K9M 1;  2IZ3 A;  2OTJ 1;  2F4O A;  4NBG A;  2DE7 A;  2VPW A;  1W2B Z;  5FLX b;  4NBB A;  3CC4 Z;  3S14 I;  1KD1 1;  1I50 I;  1DL6 A;  5T67 A;  3S15 I;  3PO3 S;  3J80 b;  3GTK I;  3CC7 1;  1VQ4 Z;  2JIO A;  4RVF A;  2KPI A;  1YIT Z;  4DK1 A;  4NH1 C;  2PM9 A;  1VQ7 1;  4EWC A;  3JAM f;  3S17 I;  3TDH B;  3TE5 B;  2OTJ Z;  2VPZ A;  2QR1 B;  3CXC Z;  1KC8 1;  5C44 I;  3PO3 I;  3MZL B;  2RT9 A;  1TWC I;  2GU2 A;  1K73 1;  3GTQ I;  2QLV B;  1Q81 1;  2R93 I;  1Q7Y 2;  1N8R 1;  2IV2 X;  1VQ4 1;  4MXU A;  5IP7 I;  1K83 I;  2V3V A;  1S72 1;  1VQM Z;  2RPR A;  2VUM I;  4E30 A;  2JNY A;  3VB9 A;  4DQY B;  2M6N A;  1RO4 A;  1YJW Z;  4A93 I;  3K7A I;  1TWG I;  4NBC A;  1Q81 2;  2QRC B;  1SIW A;  3NDJ A;  1TWA I;  4BBR I;  3GTM S;  4MRI A;  3CXC Y;  2V45 A;  1QVG Y;  1Q86 1;  4E2Y A;  1VQ8 Z;  5CM2 M;  3G71 1;  4RS4 A;  1YHQ Z;  3S1Q I;  4HH4 A;  1VQP 1;  2NVQ I;  3NH8 A;  3HOX I;  1VQ6 Z;  1FDI A;  1YUK A;  2JIP A;  4RVG A;  1M90 1;  3GTG I;  1M1K 2;  1RNI A;  2OZK A;  3GTL I;  3CCL Z;  1Q82 2; 
#chains in the Genus database with same CATH homology
 3GTJ I;  4E31 A;  4BY7 I;  1P9N A;  1TWH I;  2M48 A;  5C4J I;  1YJN Z;  3HOW I;  3VTN A;  4NBE A;  3OW2 Y;  3NDI A;  1JJ2 Z;  4Y7N I;  2HF1 A;  4RVH A;  2RIQ A;  2V8J A;  1YHQ 1;  1S72 Z;  4TNU A;  4A3D I;  2QA4 Z;  1VQ9 Z;  1VLA A;  4BXX I;  2OOX B;  3P5J B;  4A3B I;  2RBL A;  3EER A;  1N8R 2;  2OTL 1;  2GTH A;  3I4M I;  2R7Z I;  2O4H A;  4E2X A;  2ZAE B;  1Q7Y 1;  3FQM A;  3H3V J;  5T64 A;  2JUB A;  4QTU A;  3T4N B;  2NVX I;  1K73 2;  2I3C A;  3I56 Z;  2H85 A;  2Q4Z A;  1VQM 1;  1YIJ Z;  5FLM I;  1VQO Z;  2QA4 1;  3S2D I;  5A2Q f;  4MH4 A;  2JA5 I;  2AKL A;  2K5R A;  1JWH C;  1VQL 1;  3CCM Z;  2QRE B;  3FKI I;  3D9X A;  5A2Q b;  4NB8 A;  2OTL Z;  3IX0 A;  3S16 I;  3QWU A;  3HOZ I;  3CCR 1;  4MD9 A;  5AN9 F;  1QF8 A;  1QYP A;  1Y1V S;  2LIY A;  2V8K A;  3CMA Z;  1ML8 A;  4NBD A;  1Y1W I;  1M1K 1;  2P28 A;  2R92 I;  1VQ6 1;  2NVT I;  1YIJ 1;  2JS4 A;  2QEX Z;  1ZH1 A;  4RV9 A;  3CME Z;  3CPW Z;  3CCU 1;  2YAD A;  1X3W A;  1Y1V I;  3VMH A;  1VQL Z;  1LQL A;  2B63 I;  3CPW Y;  1K8A 1;  5D1O A;  1YJN 1;  1L1O C;  5LL6 f;  2HU9 A;  4HGY A;  4S1T A;  1W2B Y;  4NB9 A;  4NBF A;  4A3C I;  3RZD I;  3I56 1;  1YIT 1;  3M3Y I;  2JR6 A;  2PMZ A;  3J81 f;  1SFO I;  4A3L I;  2E2H I;  3GTM I;  3VMI A;  3S1N I;  3J80 f;  1X3Z A;  2JA6 I;  1YI2 Z;  1RO2 A;  3F3F C;  3IFU A;  4CL1 A;  3PO2 I;  1X0T A;  3CME 1;  1KQS Z;  3G6E Z;  3EED A;  4DGL A;  3HKZ A;  2J6A A;  1YUA A;  2DE5 A;  1NJI 1;  2F4M A;  1VQK 1;  2YU9 I;  3GTO I;  2QKD A;  1YJ9 Z;  3KIF A;  1KRL A;  4A3E I;  2JMO A;  1USP A;  3CCJ 1;  4Y52 I;  1M90 2;  2VF1 A;  5C4X I;  1USP B;  1I3Q I;  3CCV 1;  3I07 A;  3CCQ 1;  2K3R A;  3GCF A;  5IT9 f;  2VUG A;  4NBA A;  1R9T I;  3MZK B;  2E9H A;  4E33 A;  1RLY A;  2GTI A;  1S7M A;  1K9M 2;  1VQK Z;  3ESW A;  5FLX f;  1Q82 1;  2O53 A;  2QRD B;  4QTT A;  3CD6 1;  1YI2 1;  3OW2 Z;  3CCJ Z;  3CCL 1;  3CCU Z;  4BBS I;  1TWF I;  1I6H I;  1QVG Z;  3CCS 1;  3IF8 A;  1JJ2 Y;  1NJI 2;  1RQF A;  4A3F I;  1KC8 2;  2P3Y A;  4RVD A;  5T6B A;  3I55 Z;  5C3E I;  1YJ9 1;  5D1O B;  2KI7 B;  3KIH A;  3G4S 1;  3CCE Z;  1VQ5 Z;  3F3P C;  2PK7 A;  1VQP Z;  3VMG A;  3CCV Z;  3CCQ Z;  4A3G I;  4AYB A;  3G6E 1;  1Z01 A;  3NH5 A;  1WCM I;  3RZO I;  3M4O I;  1KQS Y;  1QVF Z;  3BG0 B;  3I4N I;  1NUI A;  1VQN 1;  2W03 A;  1ZB9 A;  4XX2 A;  3I55 1;  3D6W A;  3S1R I;  3HOY I;  2Q51 A;  1WW9 A;  2R6M A;  2EGT A;  3CC7 Z;  3HOV I;  1Q86 2;  3U50 C;  4NOZ A;  1TFI A;  1WII A;  1VQ9 1;  2Y0S A;  2WB1 A;  2OOY B;  2BJO A;  3J7A 4;  2JA7 I;  3GTP I;  4A3I I;  4A3M I;  2DE6 A;  1KD1 2;  1NP6 A;  2IZ4 A;  5D1P A;  3S2H I;  4X6A I;  1VQN Z;  1PFT A;  3CC4 1;  3FQQ A;  4A3J I;  3CMA 1;  4NBH A;  3G4S Z;  3CCE 1;  3H0G I;  1Z03 A;  3CC2 Z;  2RHB A;  3Q87 A;  2G2K A;  3MON A;  2JA8 I;  3GKQ A;  5IP9 I;  3CD6 Z;  2W04 A;  2QEX 1;  1Z02 A;  2NVY I;  4MON A;  4HGZ A;  1VQO 1;  4E32 A;  1N2F A;  3LUS A;  1ZB8 A;  2V8I A;  3CCS Z;  4E2Z A;  4MD8 A;  2E2J I;  4E2W A;  3CCM 1;  3JAM b;  4NFR A;  3HOU I;  2LFU A;  3J81 b;  3CCR Z;  3S1M I;  1VQ8 1;  4A3K I;  3CC2 1;  2E2I I;  3G71 Z;  1VQ5 1;  3BG1 B;  2WAQ A;  3NFZ A;  1RO0 A;  3CQZ I;  1K8A 2;  4BY1 I;  3NH4 A;  5IT9 b;  1QVF Y;  1VQ7 Z;  4MD7 A;  1YJW 1;  1K9M 1;  2IZ3 A;  2OTJ 1;  2F4O A;  4NBG A;  1W2B Z;  2DE7 A;  5FLX b;  4NBB A;  3CC4 Z;  3S14 I;  1KD1 1;  1I50 I;  1DL6 A;  5T67 A;  3S15 I;  3PO3 S;  3J80 b;  3GTK I;  3CC7 1;  1VQ4 Z;  4RVF A;  2KPI A;  1YIT Z;  4DK1 A;  4NH1 C;  2PM9 A;  1VQ7 1;  4EWC A;  3JAM f;  3S17 I;  3TDH B;  3TE5 B;  2OTJ Z;  2QR1 B;  3CXC Z;  1KC8 1;  5C44 I;  3PO3 I;  3MZL B;  2RT9 A;  1TWC I;  2GU2 A;  1K73 1;  3GTQ I;  2QLV B;  1Q81 1;  2R93 I;  1Q7Y 2;  1N8R 1;  1VQ4 1;  4MXU A;  5IP7 I;  1K83 I;  1S72 1;  1VQM Z;  2RPR A;  2VUM I;  4E30 A;  2JNY A;  3VB9 A;  4DQY B;  2M6N A;  1RO4 A;  1YJW Z;  4A93 I;  3K7A I;  1TWG I;  4NBC A;  1Q81 2;  2QRC B;  3NDJ A;  1TWA I;  4BBR I;  3GTM S;  4MRI A;  3CXC Y;  1QVG Y;  1Q86 1;  4E2Y A;  1VQ8 Z;  5CM2 M;  3G71 1;  4RS4 A;  1YHQ Z;  3S1Q I;  4HH4 A;  1VQP 1;  2NVQ I;  3NH8 A;  3HOX I;  1VQ6 Z;  1YUK A;  4RVG A;  1M90 1;  3GTG I;  1M1K 2;  1RNI A;  2OZK A;  3GTL I;  3CCL Z;  1Q82 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...