2YU9I

Rna polymerase ii elongation complex in 150 mm mg+2 with utp
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural Basis of Transcription: Role of the Trigger Loop in Substrate Specificity and Catalysis
pubmed doi rcsb
total genus 6
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2yu9I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2yu9I02
1NUIA 3GTGI 2VUMI 4A3DI 1TWCI 3GTMI 4A3II 2JR6A 4NBCA 3S14I 3PO3I 1LQLA 2P3YA 2K5RA 3GTPI 1WCMI 1X3WA 2DE6A 3EERA 1YUAA 1SFOI 1L1OC 3FKII 3S17I 2R93I 2E2JI 1Y1VI 3I4NI 3I4MI 4NBBA 3Q87A 5IP7I 5C4JI 3VMGA 1K83I 3S2HI 3VMHA 2E2HI 4Y7NI 3VB9A 1TWFI 2NVXI 1ML8A 3HOXI 3GTKI 2JA7I 3U50C 5CM2M 4BY1I 3H3VJ 3RZOI 4X6AI 4A93I 3S16I 3GTMS 4NBGA 4MH4A 3RZDI 1I3QI 4NBFA 3VMIA 3M3YI 1TFIA 3GCFA 4QTTA 3PO3S 1PFTA 4A3FI 4NBEA 1I6HI 3LUSA 1TWGI 3GKQA 4A3MI 2BJOA 2J6AA 3HOVI 2E2II 1Y1VS 4BBSI 2F4MA 2JS4A 1DL6A 3PO2I 3GTJI 3GTQI 4QTUA 3GTLI 3HOUI 1ZB8A 4A3LI 2JA6I 2JA8I 2RBLA 1I50I 2JNYA 5C3EI 4A3EI 3M4OI 4BXXI 4NBDA 2R92I 3HOWI 3GTOI 1TWAI 1Y1WI 3S2DI 3S1RI 3I07A 4NBAA 1R9TI 4Y52I 5C4XI 4A3BI 4XX2A 1RLYA 2NVYI 2B63I 2YU9I 1QYPA 3ESWA 3H0GI 5IP9I 4A3JI 4NB8A 4NB9A 2NVQI 4A3KI 2AKLA 2DE7A 3HOZI 1WW9A 4NBHA 1RO4A 1VLAA 3S1NI 4A3CI 1USPB 2R7ZI 1ZB9A 2NVTI 1USPA 2PK7A 3S15I 2KPIA 4BY7I 3S1MI 4NOZA 4BBRI 3CQZI 3K7AI 3HOYI 2F4OA 5C44I 2JA5I 2HF1A 5FLMI 1X3ZA 3S1QI 1TWHI 3D6WA 4A3GI 1N2FA 2DE5A
chains in the Genus database with same CATH superfamily
1VQLZ 3CXCZ 1KQSZ 1RO2A 1VQM1 1ZH1A 4NBCA 3J80f 3CCU1 2GTHA 2JUBA 4E2WA 1AA6A 1X3WA 1L1OC 3F3FC 5LL6f 3CCL1 3I4NI 3CCR1 3I4MI 1N8R2 3I56Z 2QEXZ 2IZ4A 3S2HI 3VMHA 2EGTA 2NAPA 3CCQZ 3CCS1 2E2HI 1VQ7Z 3MONA 3H3VJ 3RZOI 4A93I 3NH4A 3TDHB 4RVGA 4MH4A 3CMAZ 1YIT1 1I3QI 1QVFY 1S72Z 3M3YI 3PO3S 4NBEA 4DK1A 5T67A 4NH1C 3CPWZ 3LUSA 3D9XA 3JAMf 1K731 3GKQA 1RO0A 4A3MI 3QWUA 1Y1VS 1QVGZ 1M1K1 2G2KA 1VQ41 1DL6A 4QTUA 3HOUI 1ZB8A 1K732 1Q7Y1 2JA8I 3CC21 4E2XA 2RIQA 1M1K2 2OTJ1 1I50I 3M4OI 3CD61 4E30A 3CC7Z 2OTLZ 1YJ91 2JIPA 4NBAA 1JJ2Z 2V3VA 1Q7Y2 2YU9I 1FDIA 1VQOZ 2AKLA 2IZ3A 1VQPZ 4MXUA 2NVTI 3J80b 3CCJZ 3CCLZ 3NDIA 1VQ81 3HOYI 2V45A 3G4S1 2HF1A 1X3ZA 1VQ91 4A3GI 1Z02A 1Q812 1N2FA 2DE5A 4E2ZA 1TWCI 2KI7B 2V8IA 2JR6A 3J7A4 3G6E1 4RV9A 1Z01A 3PO3I 1LQLA 1RQFA 2P3YA 2RT9A 3CC4Z 2K5RA 3T4NB 3EERA 1JWHC 4E31A 1YUAA 3I551 1SFOI 1YJN1 3FKII 1FDOA 2O4HA 3S17I 2M6NA 2E2JI 3FQQA 1Y1VI 2K3RA 4NBBA 2R6MA 1KC81 3MZLB 1YIJ1 1Q16A 1YJWZ 1VQ4Z 2NVXI 1Y8CA 3JAMb 2V8KA 3CC2Z 4E32A 4X6AI 3F3PC 3GTMS 3CD6Z 4NBGA 3RZDI 4RVDA 4NBFA 1K8A1 2LEXA 1VQ6Z 1YI2Z 4A3FI 3NH8A 1K9M1 1I6HI 1TWGI 4DGLA 1YHQZ 2BJOA 3IX0A 2O53A 2PMZA 3CCEZ 3CMEZ 3HKZA 3PO2I 5AN9F 1K9M2 3G71Z 4MRIA 4E2YA 3GTLI 2Q4ZA 1QF8A 1WIIA 4E33A 4DQYB 2QR1B 2QREB 5C3EI 4A3EI 2JMOA 1VQ51 2R92I 3HOWI 4AYBA 3OW2Z 1VQ8Z 3S2DI 3NH5A 3CXCY 1KQSY 4HGZA 1VQ9Z 2QA41 4XX2A 2GU2A 2E9HA 3H0GI 2V8JA 4NB8A 4NB9A 1VQNZ 4A3KI 2OZKA 1Q861 3CCM1 2IV2X 1M901 2OOYB 1RO4A 1VLAA 3S1NI 2YADA 2R7ZI 1YJNZ 1WJ2A 2QLVB 3S1MI 1Q862 4BBRI 3CQZI 3BG1B 1P9NA 2F4OA 2JA5I 2VPYA 3S1QI 2HU9A 3P5JB 3BG0B 1VQL1 2RPRA 1VQMZ 4A3DI 3GTMI 4A3II 1Z03A 1W2BZ 2I3CA 3CCUZ 4RS4A 4MONA 3CPWY 3NDJA 2QRDB 1QVGY 2JIQA 2R93I 2H85A 3MZKB 3CCRZ 2WB1A 5D1OB 5IP7I 4CL1A 3I561 2E7ZA 2GTIA 3CCSZ 1X0TA 3CCQ1 3VB9A 3HOXI 1VQ71 2JA7I 3U50C 5CM2M 4BY1I 1JJ2Y 4NFRA 2LFUA 2LIYA 3S16I 1VQK1 2VF1A 1YITZ 3CMA1 1S7MA 5A2Qf 4QTTA 3D2LA 2OOXB 1PFTA 4MD7A 2QA4Z 5D1PA 2W03A 2J6AA 2E2II 4BBSI 2WAQA 2F4MA 2JS4A 2VUGA 4A3LI 2JA6I 5IT9f 1KC82 3EEDA 3KIHA 2VPXA 2OTJZ 2JNYA 3TE5B 4EWCA 4BXXI 3CC71 2QRCB 1TWAI 1Y1WI 1YJ9Z 3I07A 1R9TI 2NVYI 2B63I 1QYPA 3ESWA 1KD11 1VQO1 1QVFZ 4A3JI 1K8A2 2DE7A 1VQP1 1N8R1 2PM9A 1KD12 2ZAEB 2JIRA 3CCJ1 4NOZA 1RNIA 3IFUA 3G4SZ 5C44I 3D6WA 1NUIA 3GTGI 4RVFA 2VUMI 3J81b 3G6EZ 3FQMA 1WZNA 3S14I 5T6BA 3CC41 1VQKZ 3GTPI 1WCMI 1NP6A 1YUKA 2DE6A 3I55Z 2QKDA 5FLXf 2W04A 1M902 3Q87A 3CCV1 5A2Qb 5C4JI 3VMGA 1K83I 1YIJZ 1YJW1 4Y7NI 1TWFI 2P28A 1ML8A 3KIFA 4MD9A 3OW2Y 3GTKI 4HH4A 1Q821 3VMIA 1TFIA 3GCFA 3IR7A 1VQ61 1YI21 2VPZA 5IT9b 3IF8A 3J81f 1YHQ1 3HOVI 1Q822 2QEX1 5D1OA 2RHBA 5T64A 4HGYA 3CCE1 2JIMA 3CME1 3GTJI 3GTQI 3G711 1SIWA 1Q811 2JIOA 2RBLA 3VTNA 2AYDA 1VQ5Z 4NBDA 3GTOI 3S1RI 1S721 2Q51A 4Y52I 5C4XI 4A3BI 1W2BY 1RLYA 5IP9I 1QXFA 4RVHA 2M48A 1NJI1 2NVQI 1VQN1 3CCMZ 3HOZI 1WW9A 4NBHA 4A3CI 1USPB 1ZB9A 1USPA 2PK7A 1NJI2 2KPIA 4TNUA 3S15I 4BY7I 4MD8A 2OTL1 3NFZA 3K7AI 4S1TA 2VPWA 1KRLA 3CCVZ 5FLMI 2Y0SA 1TWHI 5FLXb
chains in the Genus database with same CATH topology
1VQLZ 3CXCZ 1KQSZ 1RO2A 1VQM1 1ZH1A 4NBCA 3J80f 3CCU1 2GTHA 2JUBA 4E2WA 1X3WA 1L1OC 3F3FC 5LL6f 3CCL1 3I4NI 3CCR1 3I4MI 1N8R2 3I56Z 2QEXZ 2IZ4A 3S2HI 3VMHA 2EGTA 3CCQZ 2E2HI 3CCS1 1VQ7Z 3MONA 3H3VJ 3RZOI 4A93I 3NH4A 3TDHB 4RVGA 4MH4A 3CMAZ 1YIT1 1I3QI 1QVFY 1S72Z 3M3YI 3PO3S 4NBEA 4DK1A 5T67A 4NH1C 3CPWZ 3LUSA 3D9XA 3JAMf 1K731 3GKQA 1RO0A 4A3MI 3QWUA 1Y1VS 1QVGZ 1M1K1 2G2KA 1VQ41 1DL6A 4QTUA 3HOUI 1ZB8A 1K732 1Q7Y1 2JA8I 3CC21 4E2XA 2RIQA 1M1K2 2OTJ1 1I50I 3M4OI 3CD61 4E30A 3CC7Z 2OTLZ 1YJ91 4NBAA 1JJ2Z 1Q7Y2 2YU9I 1VQOZ 2AKLA 2IZ3A 1VQPZ 4MXUA 2NVTI 3J80b 3CCJZ 3CCLZ 3NDIA 1VQ81 3HOYI 3G4S1 2HF1A 1X3ZA 1VQ91 4A3GI 1Z02A 1Q812 1N2FA 2DE5A 4E2ZA 1TWCI 2KI7B 2V8IA 2JR6A 3J7A4 3G6E1 4RV9A 1Z01A 3PO3I 1LQLA 1RQFA 2P3YA 2RT9A 3CC4Z 2K5RA 3T4NB 3EERA 1JWHC 4E31A 1YUAA 3I551 1SFOI 1YJN1 3FKII 2O4HA 3S17I 2M6NA 2E2JI 3FQQA 1Y1VI 2K3RA 4NBBA 2R6MA 1KC81 3MZLB 1YIJ1 1YJWZ 1VQ4Z 2NVXI 3JAMb 2V8KA 3CC2Z 4E32A 4X6AI 3F3PC 3GTMS 3CD6Z 4NBGA 3RZDI 4RVDA 4NBFA 1K8A1 1VQ6Z 1YI2Z 4A3FI 3NH8A 1K9M1 1I6HI 1TWGI 4DGLA 1YHQZ 2BJOA 3IX0A 2O53A 2PMZA 3CCEZ 3CMEZ 3HKZA 3PO2I 5AN9F 1K9M2 3G71Z 4MRIA 4E2YA 3GTLI 2Q4ZA 1QF8A 1WIIA 4E33A 4DQYB 2QR1B 2QREB 5C3EI 4A3EI 2JMOA 1VQ51 2R92I 3HOWI 4AYBA 3OW2Z 1VQ8Z 3S2DI 3NH5A 3CXCY 1KQSY 4HGZA 1VQ9Z 2QA41 4XX2A 2GU2A 2E9HA 3H0GI 2V8JA 4NB8A 4NB9A 1VQNZ 4A3KI 2OZKA 1Q861 3CCM1 1M901 2OOYB 1RO4A 1VLAA 3S1NI 2YADA 2R7ZI 1YJNZ 2QLVB 3S1MI 1Q862 4BBRI 3CQZI 3BG1B 1P9NA 2F4OA 2JA5I 3S1QI 2HU9A 3P5JB 3BG0B 1VQL1 2RPRA 1VQMZ 4A3DI 3GTMI 4A3II 1Z03A 1W2BZ 2I3CA 3CCUZ 4RS4A 4MONA 3CPWY 3NDJA 2QRDB 1QVGY 2R93I 2H85A 3MZKB 3CCRZ 2WB1A 5D1OB 5IP7I 4CL1A 3I561 2GTIA 3CCSZ 1X0TA 3CCQ1 3VB9A 3HOXI 1VQ71 2JA7I 3U50C 5CM2M 4BY1I 1JJ2Y 4NFRA 2LFUA 2LIYA 3S16I 1VQK1 2VF1A 1YITZ 3CMA1 1S7MA 5A2Qf 4QTTA 2OOXB 1PFTA 4MD7A 2QA4Z 5D1PA 2W03A 2J6AA 2E2II 4BBSI 2WAQA 2F4MA 2JS4A 2VUGA 4A3LI 2JA6I 5IT9f 1KC82 3EEDA 3KIHA 2OTJZ 2JNYA 3TE5B 4EWCA 4BXXI 3CC71 2QRCB 1TWAI 1Y1WI 1YJ9Z 3I07A 1R9TI 2NVYI 2B63I 1QYPA 3ESWA 1KD11 1VQO1 1QVFZ 4A3JI 1K8A2 2DE7A 1VQP1 1N8R1 2PM9A 1KD12 2ZAEB 3CCJ1 4NOZA 1RNIA 3IFUA 3G4SZ 5C44I 3D6WA 1NUIA 3GTGI 4RVFA 2VUMI 3J81b 3G6EZ 3FQMA 3S14I 5T6BA 3CC41 1VQKZ 3GTPI 1WCMI 1NP6A 1YUKA 2DE6A 3I55Z 2QKDA 5FLXf 2W04A 1M902 3Q87A 3CCV1 5A2Qb 5C4JI 3VMGA 1K83I 1YIJZ 1YJW1 4Y7NI 1TWFI 2P28A 1ML8A 3KIFA 4MD9A 3OW2Y 3GTKI 4HH4A 1Q821 3VMIA 1TFIA 3GCFA 1VQ61 1YI21 5IT9b 3IF8A 3J81f 1YHQ1 3HOVI 1Q822 2QEX1 5D1OA 2RHBA 5T64A 4HGYA 3CCE1 3CME1 3GTJI 3GTQI 3G711 1Q811 2RBLA 3VTNA 1VQ5Z 4NBDA 3GTOI 3S1RI 1S721 2Q51A 4Y52I 5C4XI 4A3BI 1W2BY 1RLYA 5IP9I 4RVHA 2M48A 1NJI1 2NVQI 1VQN1 3CCMZ 3HOZI 1WW9A 4NBHA 4A3CI 1USPB 1ZB9A 1USPA 2PK7A 1NJI2 2KPIA 4TNUA 3S15I 4BY7I 4MD8A 2OTL1 3NFZA 3K7AI 4S1TA 1KRLA 3CCVZ 5FLMI 2Y0SA 1TWHI 5FLXb
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NUI A;  3GTG I;  2VUM I;  4A3D I;  1TWC I;  3GTM I;  4A3I I;  2JR6 A;  4NBC A;  3S14 I;  3PO3 I;  1LQL A;  2P3Y A;  2K5R A;  3GTP I;  1WCM I;  1X3W A;  2DE6 A;  3EER A;  1YUA A;  1SFO I;  1L1O C;  3FKI I;  3S17 I;  2R93 I;  2E2J I;  1Y1V I;  3I4N I;  3I4M I;  4NBB A;  3Q87 A;  5IP7 I;  5C4J I;  3VMG A;  1K83 I;  3S2H I;  3VMH A;  2E2H I;  4Y7N I;  3VB9 A;  1TWF I;  2NVX I;  1ML8 A;  3HOX I;  3GTK I;  2JA7 I;  3U50 C;  5CM2 M;  4BY1 I;  3H3V J;  3RZO I;  4X6A I;  4A93 I;  3S16 I;  3GTM S;  4NBG A;  4MH4 A;  3RZD I;  1I3Q I;  4NBF A;  3VMI A;  3M3Y I;  1TFI A;  3GCF A;  4QTT A;  3PO3 S;  1PFT A;  4A3F I;  4NBE A;  1I6H I;  3LUS A;  1TWG I;  3GKQ A;  4A3M I;  2BJO A;  2J6A A;  3HOV I;  2E2I I;  1Y1V S;  4BBS I;  2F4M A;  2JS4 A;  1DL6 A;  3PO2 I;  3GTJ I;  3GTQ I;  4QTU A;  3GTL I;  3HOU I;  1ZB8 A;  4A3L I;  2JA6 I;  2JA8 I;  2RBL A;  1I50 I;  2JNY A;  5C3E I;  4A3E I;  3M4O I;  4BXX I;  4NBD A;  2R92 I;  3HOW I;  3GTO I;  1TWA I;  1Y1W I;  3S2D I;  3S1R I;  3I07 A;  4NBA A;  1R9T I;  4Y52 I;  5C4X I;  4A3B I;  4XX2 A;  1RLY A;  2NVY I;  2B63 I;  2YU9 I;  1QYP A;  3ESW A;  3H0G I;  5IP9 I;  4A3J I;  4NB8 A;  4NB9 A;  2NVQ I;  4A3K I;  2AKL A;  2DE7 A;  3HOZ I;  1WW9 A;  4NBH A;  1RO4 A;  1VLA A;  3S1N I;  4A3C I;  1USP B;  2R7Z I;  1ZB9 A;  2NVT I;  1USP A;  2PK7 A;  3S15 I;  2KPI A;  4BY7 I;  3S1M I;  4NOZ A;  4BBR I;  3CQZ I;  3K7A I;  3HOY I;  2F4O A;  5C44 I;  2JA5 I;  2HF1 A;  5FLM I;  1X3Z A;  3S1Q I;  1TWH I;  3D6W A;  4A3G I;  1N2F A;  2DE5 A; 
#chains in the Genus database with same CATH topology
 1VQL Z;  3CXC Z;  1KQS Z;  1RO2 A;  1VQM 1;  1ZH1 A;  4NBC A;  3J80 f;  3CCU 1;  2GTH A;  2JUB A;  4E2W A;  1AA6 A;  1X3W A;  1L1O C;  3F3F C;  5LL6 f;  3CCL 1;  3I4N I;  3CCR 1;  3I4M I;  1N8R 2;  3I56 Z;  2QEX Z;  2IZ4 A;  3S2H I;  3VMH A;  2EGT A;  2NAP A;  3CCQ Z;  3CCS 1;  2E2H I;  1VQ7 Z;  3MON A;  3H3V J;  3RZO I;  4A93 I;  3NH4 A;  3TDH B;  4RVG A;  4MH4 A;  3CMA Z;  1YIT 1;  1I3Q I;  1QVF Y;  1S72 Z;  3M3Y I;  3PO3 S;  4NBE A;  4DK1 A;  5T67 A;  4NH1 C;  3CPW Z;  3LUS A;  3D9X A;  3JAM f;  1K73 1;  3GKQ A;  1RO0 A;  4A3M I;  3QWU A;  1Y1V S;  1QVG Z;  1M1K 1;  2G2K A;  1VQ4 1;  1DL6 A;  4QTU A;  3HOU I;  1ZB8 A;  1K73 2;  1Q7Y 1;  2JA8 I;  3CC2 1;  4E2X A;  2RIQ A;  1M1K 2;  2OTJ 1;  1I50 I;  3M4O I;  3CD6 1;  4E30 A;  3CC7 Z;  2OTL Z;  1YJ9 1;  2JIP A;  4NBA A;  1JJ2 Z;  2V3V A;  1Q7Y 2;  2YU9 I;  1FDI A;  1VQO Z;  2AKL A;  2IZ3 A;  1VQP Z;  4MXU A;  2NVT I;  3J80 b;  3CCJ Z;  3CCL Z;  3NDI A;  1VQ8 1;  3HOY I;  2V45 A;  3G4S 1;  2HF1 A;  1X3Z A;  1VQ9 1;  4A3G I;  1Z02 A;  1Q81 2;  1N2F A;  2DE5 A;  4E2Z A;  1TWC I;  2KI7 B;  2V8I A;  2JR6 A;  3J7A 4;  3G6E 1;  4RV9 A;  1Z01 A;  3PO3 I;  1LQL A;  1RQF A;  2P3Y A;  2RT9 A;  3CC4 Z;  2K5R A;  3T4N B;  3EER A;  1JWH C;  4E31 A;  1YUA A;  3I55 1;  1SFO I;  1YJN 1;  3FKI I;  1FDO A;  2O4H A;  3S17 I;  2M6N A;  2E2J I;  3FQQ A;  1Y1V I;  2K3R A;  4NBB A;  2R6M A;  1KC8 1;  3MZL B;  1YIJ 1;  1Q16 A;  1YJW Z;  1VQ4 Z;  2NVX I;  1Y8C A;  3JAM b;  2V8K A;  3CC2 Z;  4E32 A;  4X6A I;  3F3P C;  3GTM S;  3CD6 Z;  4NBG A;  3RZD I;  4RVD A;  4NBF A;  1K8A 1;  2LEX A;  1VQ6 Z;  1YI2 Z;  4A3F I;  3NH8 A;  1K9M 1;  1I6H I;  1TWG I;  4DGL A;  1YHQ Z;  2BJO A;  3IX0 A;  2O53 A;  2PMZ A;  3CCE Z;  3CME Z;  3HKZ A;  3PO2 I;  5AN9 F;  1K9M 2;  3G71 Z;  4MRI A;  4E2Y A;  3GTL I;  2Q4Z A;  1QF8 A;  1WII A;  4E33 A;  4DQY B;  2QR1 B;  2QRE B;  5C3E I;  4A3E I;  2JMO A;  1VQ5 1;  2R92 I;  3HOW I;  4AYB A;  3OW2 Z;  1VQ8 Z;  3S2D I;  3NH5 A;  3CXC Y;  1KQS Y;  4HGZ A;  1VQ9 Z;  2QA4 1;  4XX2 A;  2GU2 A;  2E9H A;  3H0G I;  2V8J A;  4NB8 A;  4NB9 A;  1VQN Z;  4A3K I;  2OZK A;  1Q86 1;  3CCM 1;  2IV2 X;  1M90 1;  2OOY B;  1RO4 A;  1VLA A;  3S1N I;  2YAD A;  2R7Z I;  1YJN Z;  1WJ2 A;  2QLV B;  3S1M I;  1Q86 2;  4BBR I;  3CQZ I;  3BG1 B;  1P9N A;  2F4O A;  2JA5 I;  2VPY A;  3S1Q I;  2HU9 A;  3P5J B;  3BG0 B;  1VQL 1;  2RPR A;  1VQM Z;  4A3D I;  3GTM I;  4A3I I;  1Z03 A;  1W2B Z;  2I3C A;  3CCU Z;  4RS4 A;  4MON A;  3CPW Y;  3NDJ A;  2QRD B;  1QVG Y;  2JIQ A;  2R93 I;  2H85 A;  3MZK B;  3CCR Z;  2WB1 A;  5D1O B;  5IP7 I;  4CL1 A;  3I56 1;  2E7Z A;  2GTI A;  3CCS Z;  1X0T A;  3CCQ 1;  3VB9 A;  3HOX I;  1VQ7 1;  2JA7 I;  3U50 C;  5CM2 M;  4BY1 I;  1JJ2 Y;  4NFR A;  2LFU A;  2LIY A;  3S16 I;  1VQK 1;  2VF1 A;  1YIT Z;  3CMA 1;  1S7M A;  5A2Q f;  4QTT A;  3D2L A;  2OOX B;  1PFT A;  4MD7 A;  2QA4 Z;  5D1P A;  2W03 A;  2J6A A;  2E2I I;  4BBS I;  2WAQ A;  2F4M A;  2JS4 A;  2VUG A;  4A3L I;  2JA6 I;  5IT9 f;  1KC8 2;  3EED A;  3KIH A;  2VPX A;  2OTJ Z;  2JNY A;  3TE5 B;  4EWC A;  4BXX I;  3CC7 1;  2QRC B;  1TWA I;  1Y1W I;  1YJ9 Z;  3I07 A;  1R9T I;  2NVY I;  2B63 I;  1QYP A;  3ESW A;  1KD1 1;  1VQO 1;  1QVF Z;  4A3J I;  1K8A 2;  2DE7 A;  1VQP 1;  1N8R 1;  2PM9 A;  1KD1 2;  2ZAE B;  2JIR A;  3CCJ 1;  4NOZ A;  1RNI A;  3IFU A;  3G4S Z;  5C44 I;  3D6W A;  1NUI A;  3GTG I;  4RVF A;  2VUM I;  3J81 b;  3G6E Z;  3FQM A;  1WZN A;  3S14 I;  5T6B A;  3CC4 1;  1VQK Z;  3GTP I;  1WCM I;  1NP6 A;  1YUK A;  2DE6 A;  3I55 Z;  2QKD A;  5FLX f;  2W04 A;  1M90 2;  3Q87 A;  3CCV 1;  5A2Q b;  5C4J I;  3VMG A;  1K83 I;  1YIJ Z;  1YJW 1;  4Y7N I;  1TWF I;  2P28 A;  1ML8 A;  3KIF A;  4MD9 A;  3OW2 Y;  3GTK I;  4HH4 A;  1Q82 1;  3VMI A;  1TFI A;  3GCF A;  3IR7 A;  1VQ6 1;  1YI2 1;  2VPZ A;  5IT9 b;  3IF8 A;  3J81 f;  1YHQ 1;  3HOV I;  1Q82 2;  2QEX 1;  5D1O A;  2RHB A;  5T64 A;  4HGY A;  3CCE 1;  2JIM A;  3CME 1;  3GTJ I;  3GTQ I;  3G71 1;  1SIW A;  1Q81 1;  2JIO A;  2RBL A;  3VTN A;  2AYD A;  1VQ5 Z;  4NBD A;  3GTO I;  3S1R I;  1S72 1;  2Q51 A;  4Y52 I;  5C4X I;  4A3B I;  1W2B Y;  1RLY A;  5IP9 I;  1QXF A;  4RVH A;  2M48 A;  1NJI 1;  2NVQ I;  1VQN 1;  3CCM Z;  3HOZ I;  1WW9 A;  4NBH A;  4A3C I;  1USP B;  1ZB9 A;  1USP A;  2PK7 A;  1NJI 2;  2KPI A;  4TNU A;  3S15 I;  4BY7 I;  4MD8 A;  2OTL 1;  3NFZ A;  3K7A I;  4S1T A;  2VPW A;  1KRL A;  3CCV Z;  5FLM I;  2Y0S A;  1TWH I;  5FLX b; 
#chains in the Genus database with same CATH homology
 1VQL Z;  3CXC Z;  1KQS Z;  1RO2 A;  1VQM 1;  1ZH1 A;  4NBC A;  3J80 f;  3CCU 1;  2GTH A;  2JUB A;  4E2W A;  1X3W A;  1L1O C;  3F3F C;  5LL6 f;  3CCL 1;  3I4N I;  3CCR 1;  3I4M I;  1N8R 2;  3I56 Z;  2QEX Z;  2IZ4 A;  3S2H I;  3VMH A;  2EGT A;  3CCQ Z;  2E2H I;  3CCS 1;  1VQ7 Z;  3MON A;  3H3V J;  3RZO I;  4A93 I;  3NH4 A;  3TDH B;  4RVG A;  4MH4 A;  3CMA Z;  1YIT 1;  1I3Q I;  1QVF Y;  1S72 Z;  3M3Y I;  3PO3 S;  4NBE A;  4DK1 A;  5T67 A;  4NH1 C;  3CPW Z;  3LUS A;  3D9X A;  3JAM f;  1K73 1;  3GKQ A;  1RO0 A;  4A3M I;  3QWU A;  1Y1V S;  1QVG Z;  1M1K 1;  2G2K A;  1VQ4 1;  1DL6 A;  4QTU A;  3HOU I;  1ZB8 A;  1K73 2;  1Q7Y 1;  2JA8 I;  3CC2 1;  4E2X A;  2RIQ A;  1M1K 2;  2OTJ 1;  1I50 I;  3M4O I;  3CD6 1;  4E30 A;  3CC7 Z;  2OTL Z;  1YJ9 1;  4NBA A;  1JJ2 Z;  1Q7Y 2;  2YU9 I;  1VQO Z;  2AKL A;  2IZ3 A;  1VQP Z;  4MXU A;  2NVT I;  3J80 b;  3CCJ Z;  3CCL Z;  3NDI A;  1VQ8 1;  3HOY I;  3G4S 1;  2HF1 A;  1X3Z A;  1VQ9 1;  4A3G I;  1Z02 A;  1Q81 2;  1N2F A;  2DE5 A;  4E2Z A;  1TWC I;  2KI7 B;  2V8I A;  2JR6 A;  3J7A 4;  3G6E 1;  4RV9 A;  1Z01 A;  3PO3 I;  1LQL A;  1RQF A;  2P3Y A;  2RT9 A;  3CC4 Z;  2K5R A;  3T4N B;  3EER A;  1JWH C;  4E31 A;  1YUA A;  3I55 1;  1SFO I;  1YJN 1;  3FKI I;  2O4H A;  3S17 I;  2M6N A;  2E2J I;  3FQQ A;  1Y1V I;  2K3R A;  4NBB A;  2R6M A;  1KC8 1;  3MZL B;  1YIJ 1;  1YJW Z;  1VQ4 Z;  2NVX I;  3JAM b;  2V8K A;  3CC2 Z;  4E32 A;  4X6A I;  3F3P C;  3GTM S;  3CD6 Z;  4NBG A;  3RZD I;  4RVD A;  4NBF A;  1K8A 1;  1VQ6 Z;  1YI2 Z;  4A3F I;  3NH8 A;  1K9M 1;  1I6H I;  1TWG I;  4DGL A;  1YHQ Z;  2BJO A;  3IX0 A;  2O53 A;  2PMZ A;  3CCE Z;  3CME Z;  3HKZ A;  3PO2 I;  5AN9 F;  1K9M 2;  3G71 Z;  4MRI A;  4E2Y A;  3GTL I;  2Q4Z A;  1QF8 A;  1WII A;  4E33 A;  4DQY B;  2QR1 B;  2QRE B;  5C3E I;  4A3E I;  2JMO A;  1VQ5 1;  2R92 I;  3HOW I;  4AYB A;  3OW2 Z;  1VQ8 Z;  3S2D I;  3NH5 A;  3CXC Y;  1KQS Y;  4HGZ A;  1VQ9 Z;  2QA4 1;  4XX2 A;  2GU2 A;  2E9H A;  3H0G I;  2V8J A;  4NB8 A;  4NB9 A;  1VQN Z;  4A3K I;  2OZK A;  1Q86 1;  3CCM 1;  1M90 1;  2OOY B;  1RO4 A;  1VLA A;  3S1N I;  2YAD A;  2R7Z I;  1YJN Z;  2QLV B;  3S1M I;  1Q86 2;  4BBR I;  3CQZ I;  3BG1 B;  1P9N A;  2F4O A;  2JA5 I;  3S1Q I;  2HU9 A;  3P5J B;  3BG0 B;  1VQL 1;  2RPR A;  1VQM Z;  4A3D I;  3GTM I;  4A3I I;  1Z03 A;  1W2B Z;  2I3C A;  3CCU Z;  4RS4 A;  4MON A;  3CPW Y;  3NDJ A;  2QRD B;  1QVG Y;  2R93 I;  2H85 A;  3MZK B;  3CCR Z;  2WB1 A;  5D1O B;  5IP7 I;  4CL1 A;  3I56 1;  2GTI A;  3CCS Z;  1X0T A;  3CCQ 1;  3VB9 A;  3HOX I;  1VQ7 1;  2JA7 I;  3U50 C;  5CM2 M;  4BY1 I;  1JJ2 Y;  4NFR A;  2LFU A;  2LIY A;  3S16 I;  1VQK 1;  2VF1 A;  1YIT Z;  3CMA 1;  1S7M A;  5A2Q f;  4QTT A;  2OOX B;  1PFT A;  4MD7 A;  2QA4 Z;  5D1P A;  2W03 A;  2J6A A;  2E2I I;  4BBS I;  2WAQ A;  2F4M A;  2JS4 A;  2VUG A;  4A3L I;  2JA6 I;  5IT9 f;  1KC8 2;  3EED A;  3KIH A;  2OTJ Z;  2JNY A;  3TE5 B;  4EWC A;  4BXX I;  3CC7 1;  2QRC B;  1TWA I;  1Y1W I;  1YJ9 Z;  3I07 A;  1R9T I;  2NVY I;  2B63 I;  1QYP A;  3ESW A;  1KD1 1;  1VQO 1;  1QVF Z;  4A3J I;  1K8A 2;  2DE7 A;  1VQP 1;  1N8R 1;  2PM9 A;  1KD1 2;  2ZAE B;  3CCJ 1;  4NOZ A;  1RNI A;  3IFU A;  3G4S Z;  5C44 I;  3D6W A;  1NUI A;  3GTG I;  4RVF A;  2VUM I;  3J81 b;  3G6E Z;  3FQM A;  3S14 I;  5T6B A;  3CC4 1;  1VQK Z;  3GTP I;  1WCM I;  1NP6 A;  1YUK A;  2DE6 A;  3I55 Z;  2QKD A;  5FLX f;  2W04 A;  1M90 2;  3Q87 A;  3CCV 1;  5A2Q b;  5C4J I;  3VMG A;  1K83 I;  1YIJ Z;  1YJW 1;  4Y7N I;  1TWF I;  2P28 A;  1ML8 A;  3KIF A;  4MD9 A;  3OW2 Y;  3GTK I;  4HH4 A;  1Q82 1;  3VMI A;  1TFI A;  3GCF A;  1VQ6 1;  1YI2 1;  5IT9 b;  3IF8 A;  3J81 f;  1YHQ 1;  3HOV I;  1Q82 2;  2QEX 1;  5D1O A;  2RHB A;  5T64 A;  4HGY A;  3CCE 1;  3CME 1;  3GTJ I;  3GTQ I;  3G71 1;  1Q81 1;  2RBL A;  3VTN A;  1VQ5 Z;  4NBD A;  3GTO I;  3S1R I;  1S72 1;  2Q51 A;  4Y52 I;  5C4X I;  4A3B I;  1W2B Y;  1RLY A;  5IP9 I;  4RVH A;  2M48 A;  1NJI 1;  2NVQ I;  1VQN 1;  3CCM Z;  3HOZ I;  1WW9 A;  4NBH A;  4A3C I;  1USP B;  1ZB9 A;  1USP A;  2PK7 A;  1NJI 2;  2KPI A;  4TNU A;  3S15 I;  4BY7 I;  4MD8 A;  2OTL 1;  3NFZ A;  3K7A I;  4S1T A;  1KRL A;  3CCV Z;  5FLM I;  2Y0S A;  1TWH I;  5FLX b; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...