2YU9I

Rna polymerase ii elongation complex in 150 mm mg+2 with utp
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Transcription: Role of the Trigger Loop in Substrate Specificity and Catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
total genus 6
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2yu9I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2yu9I02
4BBRI 3GTMI 3M4OI 3I4MI 3GTOI 1N2FA 2JR6A 5C4XI 3EERA 3FKII 3Q87A 5IP7I 3GTJI 3D6WA 2PK7A 1YUAA 1VLAA 3VMGA 3PO2I 3S2HI 4QTTA 3H3VJ 5C4JI 1I3QI 4NBFA 5IP9I 4A3KI 1SFOI 3RZOI 2P3YA 3HOWI 1NUIA 4A3DI 3S17I 3S16I 1RLYA 2F4OA 3I07A 2DE7A 2VUMI 3ESWA 2R7ZI 1QYPA 1Y1VI 2NVTI 4BY1I 3VMIA 1WCMI 5C3EI 1I50I 1TWCI 4Y7NI 4NBDA 2R93I 1TWHI 4NBBA 3HOYI 3H0GI 1USPB 3I4NI 2JA6I 3HOUI 4A3JI 3PO3I 4X6AI 4BBSI 1TWGI 1ML8A 2E2HI 3S1QI 3S15I 2R92I 3VB9A 1ZB8A 1TWAI 2E2II 3M3YI 2JA8I 2NVYI 2RBLA 3S1NI 4XX2A 3GTMS 3GTGI 3LUSA 1TWFI 1RO4A 4NBCA 1USPA 3S1RI 3HOVI 1Y1VS 4NBAA 2E2JI 2HF1A 3CQZI 1K83I 2F4MA 4NB9A 5CM2M 2NVXI 3GKQA 4A3II 3GTPI 4A3MI 5C44I 4MH4A 3S14I 2AKLA 4A3LI 3VMHA 1Y1WI 2BJOA 3GTLI 1R9TI 1L1OC 4NBGA 4NB8A 4A3FI 2J6AA 2B63I 4Y52I 3K7AI 3GCFA 4A3BI 2JNYA 4QTUA 1TFIA 1ZB9A 1X3ZA 2JS4A 4A3CI 3S2DI 4BY7I 3U50C 4A93I 4NBEA 5FLMI 3RZDI 1PFTA 4A3GI 2DE6A 1LQLA 1DL6A 3HOZI 2YU9I 4NBHA 1I6HI 2JA7I 2K5RA 3S1MI 3GTKI 2DE5A 1X3WA 3PO3S 3GTQI 2KPIA 1WW9A 4BXXI 4A3EI 2JA5I 4NOZA 2NVQI 3HOXI
chains in the Genus database with same CATH superfamily
3GTMI 2YADA 3I4MI 3EERA 1ZH1A 1KD12 3GTJI 3CC2Z 1YJ91 4E32A 3S2HI 3H3VJ 3KIHA 1I3QI 5IP9I 1Y8CA 1X0TA 2V3VA 2I3CA 4MRIA 1SFOI 3OW2Z 3RZOI 2P3YA 3HOWI 5T6BA 4A3DI 5A2Qb 3S16I 1RLYA 2F4OA 2WAQA 2QA4Z 4NH1C 1Q861 2JIRA 2VUMI 3CPWY 4MD9A 3CCU1 1W2BY 1Y1VI 2GTIA 3KIFA 2RIQA 4Y7NI 2RHBA 3CCJZ 2R93I 1YIJ1 2Y0SA 1JJ2Z 4MXUA 3CCV1 1USPB 4S1TA 1W2BZ 3PO3I 4A3JI 2QLVB 4BBSI 2O4HA 3IF8A 3G4SZ 3VB9A 2K3RA 2E2II 4RVHA 2H85A 3M3YI 3G711 2JA8I 2NVYI 4HH4A 4XX2A 3GTMS 2JIPA 3TDHB 1S721 1Q811 3HOVI 3EEDA 4NFRA 2VF1A 3J7A4 3CQZI 1VQPZ 1K731 2VPWA 1Q812 4EWCA 1NJI2 2NVXI 2ZAEB 3GKQA 5C44I 3S14I 3CD6Z 3VMHA 2BJOA 1YI2Z 1R9TI 3G6E1 4NBGA 3CC7Z 3MONA 1RNIA 3GCFA 2PMZA 3J81f 1RO0A 4TNUA 4A3CI 4DQYB 3HKZA 4A93I 1VQK1 2IZ3A 1YJNZ 3IX0A 3RZDI 3CMEZ 1KRLA 3CCEZ 3D9XA 1DL6A 3HOZI 2OTJZ 2AYDA 2QRDB 2JA7I 1VQLZ 3GTKI 2P28A 3NDIA 3CCE1 3CME1 5IT9b 3BG0B 3M4OI 1VQKZ 3J80f 2JR6A 5C4XI 3Q87A 1VQ51 3D6WA 2E9HA 3TE5B 3I561 2V8KA 4QTTA 1VQM1 2QREB 1QVFY 2Q51A 1YJWZ 1VQN1 1K9M1 2OZKA 1YITZ 3OW2Y 2M48A 1K9M2 2GTHA 1VQ81 4E30A 1KQSY 1VQP1 1QYPA 1KC81 1FDIA 3NH8A 1WCMI 5AN9F 1VQ8Z 1P9NA 2VUGA 1KC82 3G71Z 2IV2X 4HGYA 1YIT1 3HOYI 1JJ2Y 1KQSZ 4X6AI 1QXFA 1TWGI 2E2HI 5FLXb 2IZ4A 2R92I 3S15I 1VQMZ 2HU9A 1TWAI 1YUKA 3S1NI 3FQQA 1Q7Y2 3CCRZ 2M6NA 3GTGI 3LUSA 1TWFI 4NBCA 1VQ4Z 1USPA 3S1RI 1Z01A 1Q16A 4HGZA 2HF1A 1K83I 2F4MA 4NB9A 1YJW1 3GTPI 3VTNA 4E2YA 4A3MI 5LL6f 2RT9A 3I56Z 1RO2A 2NAPA 1Y1WI 2V8JA 2OTJ1 2KI7B 3T4NB 3QWUA 1YJN1 2JNYA 3FQMA 1ZB9A 2JS4A 5T67A 5D1PA 3U50C 2JIQA 3J80b 1WIIA 2DE6A 2V8IA 2W03A 1LQLA 5A2Qf 5IT9f 1Z02A 2LIYA 2DE5A 1X3WA 2EGTA 3CD61 2KPIA 4A3EI 1VQ41 3HOXI 3F3PC 3NH5A 3CCR1 5T64A 3FKII 3G6EZ 1M901 1YI21 2PK7A 5D1OB 2V45A 3PO2I 2LEXA 2VPXA 4A3KI 2G2KA 1NUIA 4E2XA 1Q822 3S17I 3IFUA 2DE7A 1M1K1 2LFUA 3ESWA 3NH4A 3CCM1 1Z03A 2NVTI 4BY1I 3VMIA 3CCUZ 1I50I 1TWCI 3CMAZ 1VQNZ 4NBDA 2QA41 2O53A 3H0GI 3NFZA 1YIJZ 1K8A1 3CCJ1 2JA6I 3HOUI 4RVFA 1ML8A 1VQ5Z 3S1QI 3J81b 1VQ9Z 2RBLA 3MZKB 3CC21 2JUBA 4NBAA 2E2JI 1AA6A 3CC4Z 1RQFA 5CM2M 1VQL1 4RVDA 4MH4A 1Q862 5FLXf 1S7MA 4A3LI 2R6MA 1Q7Y1 4NB8A 4A3FI 2J6AA 1VQ6Z 2B63I 4Y52I 4A3BI 3JAMf 1N8R1 3CC71 3MZLB 3CCQ1 3S2DI 1K8A2 3BG1B 4E33A 1N8R2 4NBEA 1VQ7Z 4A3GI 3CCSZ 3S1MI 3CXCZ 2OOXB 4E2WA 3PO3S 3CCL1 3GTQI 1S72Z 4NOZA 1K732 4BBRI 1NJI1 3GTOI 1N2FA 3G4S1 5IP7I 2QKDA 1YUAA 1VLAA 3VMGA 3CCVZ 5C4JI 2WB1A 4NBFA 2GU2A 2QR1B 1QVGZ 4MONA 4CL1A 4MD7A 2OTLZ 1NP6A 3I55Z 2OOYB 3I07A 4E2ZA 3CC41 2R7ZI 4RVGA 5C3EI 2W04A 4DK1A 3JAMb 5D1OA 1TWHI 4NBBA 1VQ91 2RPRA 1Q821 3I4NI 4AYBA 3D2LA 2OTL1 2Q4ZA 1YJ9Z 2VPZA 1WJ2A 1ZB8A 3CPWZ 1QVFZ 3CMA1 1RO4A 3I551 1Y1VS 3CCMZ 3NDJA 2E7ZA 2QEX1 1SIWA 1QF8A 1M902 4A3II 2QRCB 2JIOA 4MD8A 2AKLA 3CCLZ 4RV9A 1QVGY 1VQOZ 3GTLI 1L1OC 3CCS1 1YHQ1 1KD11 1VQ71 3K7AI 1YHQZ 3CXCY 4QTUA 1TFIA 1X3ZA 1M1K2 2VPYA 4BY7I 1VQO1 1WZNA 3IR7A 5FLMI 1PFTA 4DGLA 1JWHC 2YU9I 2JIMA 4NBHA 1I6HI 2K5RA 2PM9A 4RS4A 3P5JB 4BXXI 1WW9A 1FDOA 2JMOA 2QEXZ 3CCQZ 2JA5I 2NVQI 4E31A 3F3FC 1VQ61
chains in the Genus database with same CATH topology
3GTMI 2YADA 3I4MI 3EERA 1ZH1A 1KD12 3GTJI 3CC2Z 1YJ91 4E32A 3S2HI 3H3VJ 3KIHA 1I3QI 5IP9I 1X0TA 2I3CA 4MRIA 1SFOI 3OW2Z 3RZOI 2P3YA 3HOWI 5T6BA 4A3DI 5A2Qb 3S16I 1RLYA 2F4OA 2WAQA 2QA4Z 4NH1C 1Q861 2VUMI 3CPWY 4MD9A 3CCU1 1W2BY 1Y1VI 2GTIA 3KIFA 2RIQA 4Y7NI 2RHBA 3CCJZ 2R93I 1YIJ1 2Y0SA 1JJ2Z 4MXUA 3CCV1 1USPB 4S1TA 1W2BZ 3PO3I 4A3JI 2QLVB 4BBSI 2O4HA 3IF8A 3G4SZ 3VB9A 2K3RA 2E2II 4RVHA 2H85A 3M3YI 3G711 2JA8I 2NVYI 4HH4A 4XX2A 3GTMS 3TDHB 1S721 1Q811 3HOVI 3EEDA 4NFRA 2VF1A 3J7A4 3CQZI 1VQPZ 1K731 1Q812 4EWCA 1NJI2 2NVXI 2ZAEB 3GKQA 5C44I 3S14I 3CD6Z 3VMHA 2BJOA 1YI2Z 1R9TI 3G6E1 4NBGA 3CC7Z 3MONA 1RNIA 3GCFA 2PMZA 3J81f 1RO0A 4TNUA 4A3CI 4DQYB 3HKZA 4A93I 1VQK1 2IZ3A 1YJNZ 3IX0A 3RZDI 3CMEZ 1KRLA 3CCEZ 3D9XA 1DL6A 3HOZI 2OTJZ 2QRDB 2JA7I 1VQLZ 3GTKI 2P28A 3NDIA 3CCE1 3CME1 5IT9b 3BG0B 3M4OI 1VQKZ 3J80f 2JR6A 5C4XI 3Q87A 1VQ51 3D6WA 2E9HA 3TE5B 3I561 2V8KA 4QTTA 1VQM1 2QREB 1QVFY 2Q51A 1YJWZ 1VQN1 1K9M1 2OZKA 1YITZ 3OW2Y 2M48A 1K9M2 2GTHA 1VQ81 4E30A 1KQSY 1VQP1 1QYPA 1KC81 3NH8A 1WCMI 5AN9F 1VQ8Z 1P9NA 2VUGA 1KC82 3G71Z 4HGYA 1YIT1 3HOYI 1JJ2Y 1KQSZ 4X6AI 1TWGI 2E2HI 5FLXb 2IZ4A 2R92I 3S15I 1VQMZ 2HU9A 1TWAI 1YUKA 3S1NI 3FQQA 1Q7Y2 3CCRZ 2M6NA 3GTGI 3LUSA 1TWFI 4NBCA 1VQ4Z 1USPA 3S1RI 1Z01A 4HGZA 2HF1A 1K83I 2F4MA 4NB9A 1YJW1 3GTPI 3VTNA 4E2YA 4A3MI 5LL6f 2RT9A 3I56Z 1RO2A 1Y1WI 2V8JA 2OTJ1 2KI7B 3T4NB 1YJN1 3QWUA 2JNYA 3FQMA 1ZB9A 2JS4A 5T67A 5D1PA 3U50C 3J80b 1WIIA 2DE6A 2V8IA 2W03A 1LQLA 5A2Qf 5IT9f 1Z02A 2LIYA 2DE5A 1X3WA 2EGTA 3CD61 2KPIA 4A3EI 1VQ41 3HOXI 3F3PC 3NH5A 3CCR1 5T64A 3FKII 3G6EZ 1M901 1YI21 2PK7A 5D1OB 3PO2I 4A3KI 2G2KA 1NUIA 4E2XA 1Q822 3S17I 3IFUA 2DE7A 1M1K1 2LFUA 3ESWA 3NH4A 3CCM1 1Z03A 2NVTI 4BY1I 3VMIA 3CCUZ 1I50I 1TWCI 3CMAZ 1VQNZ 4NBDA 2QA41 2O53A 3H0GI 3NFZA 1YIJZ 1K8A1 3CCJ1 2JA6I 3HOUI 4RVFA 1ML8A 1VQ5Z 3S1QI 3J81b 1VQ9Z 2RBLA 3MZKB 3CC21 2JUBA 4NBAA 2E2JI 3CC4Z 1RQFA 5CM2M 1VQL1 4RVDA 4MH4A 1Q862 5FLXf 1S7MA 4A3LI 2R6MA 1Q7Y1 4NB8A 4A3FI 2J6AA 1VQ6Z 2B63I 4Y52I 4A3BI 3JAMf 1N8R1 3CC71 3MZLB 3CCQ1 3S2DI 1K8A2 3BG1B 4E33A 1N8R2 4NBEA 1VQ7Z 4A3GI 3CCSZ 3S1MI 3CXCZ 2OOXB 4E2WA 3PO3S 3CCL1 3GTQI 1S72Z 4NOZA 1K732 4BBRI 1NJI1 3GTOI 1N2FA 3G4S1 5IP7I 2QKDA 1YUAA 1VLAA 3VMGA 3CCVZ 5C4JI 2WB1A 4NBFA 2GU2A 2QR1B 1QVGZ 4MONA 4CL1A 4MD7A 2OTLZ 1NP6A 3I55Z 2OOYB 3I07A 4E2ZA 3CC41 2R7ZI 4RVGA 5C3EI 2W04A 4DK1A 3JAMb 5D1OA 1TWHI 4NBBA 1VQ91 2RPRA 1Q821 3I4NI 4AYBA 2OTL1 2Q4ZA 1YJ9Z 1ZB8A 3CPWZ 1QVFZ 3CMA1 1RO4A 3I551 1Y1VS 3NDJA 3CCMZ 2QEX1 1QF8A 1M902 4A3II 2QRCB 4MD8A 2AKLA 3CCLZ 4RV9A 1QVGY 1VQOZ 3GTLI 1L1OC 3CCS1 1YHQ1 1KD11 1VQ71 3K7AI 1YHQZ 3CXCY 4QTUA 1TFIA 1X3ZA 1M1K2 4BY7I 1VQO1 5FLMI 1PFTA 4DGLA 1JWHC 2YU9I 4NBHA 1I6HI 2K5RA 2PM9A 4RS4A 3P5JB 4BXXI 1WW9A 2JMOA 2QEXZ 3CCQZ 2JA5I 2NVQI 4E31A 3F3FC 1VQ61
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BBR I;  3GTM I;  3M4O I;  3I4M I;  3GTO I;  1N2F A;  2JR6 A;  5C4X I;  3EER A;  3FKI I;  3Q87 A;  5IP7 I;  3GTJ I;  3D6W A;  2PK7 A;  1YUA A;  1VLA A;  3VMG A;  3PO2 I;  3S2H I;  4QTT A;  3H3V J;  5C4J I;  1I3Q I;  4NBF A;  5IP9 I;  4A3K I;  1SFO I;  3RZO I;  2P3Y A;  3HOW I;  1NUI A;  4A3D I;  3S17 I;  3S16 I;  1RLY A;  2F4O A;  3I07 A;  2DE7 A;  2VUM I;  3ESW A;  2R7Z I;  1QYP A;  1Y1V I;  2NVT I;  4BY1 I;  3VMI A;  1WCM I;  5C3E I;  1I50 I;  1TWC I;  4Y7N I;  4NBD A;  2R93 I;  1TWH I;  4NBB A;  3HOY I;  3H0G I;  1USP B;  3I4N I;  2JA6 I;  3HOU I;  4A3J I;  3PO3 I;  4X6A I;  4BBS I;  1TWG I;  1ML8 A;  2E2H I;  3S1Q I;  3S15 I;  2R92 I;  3VB9 A;  1ZB8 A;  1TWA I;  2E2I I;  3M3Y I;  2JA8 I;  2NVY I;  2RBL A;  3S1N I;  4XX2 A;  3GTM S;  3GTG I;  3LUS A;  1TWF I;  1RO4 A;  4NBC A;  1USP A;  3S1R I;  3HOV I;  1Y1V S;  4NBA A;  2E2J I;  2HF1 A;  3CQZ I;  1K83 I;  2F4M A;  4NB9 A;  5CM2 M;  2NVX I;  3GKQ A;  4A3I I;  3GTP I;  4A3M I;  5C44 I;  4MH4 A;  3S14 I;  2AKL A;  4A3L I;  3VMH A;  1Y1W I;  2BJO A;  3GTL I;  1R9T I;  1L1O C;  4NBG A;  4NB8 A;  4A3F I;  2J6A A;  2B63 I;  4Y52 I;  3K7A I;  3GCF A;  4A3B I;  2JNY A;  4QTU A;  1TFI A;  1ZB9 A;  1X3Z A;  2JS4 A;  4A3C I;  3S2D I;  4BY7 I;  3U50 C;  4A93 I;  4NBE A;  5FLM I;  3RZD I;  1PFT A;  4A3G I;  2DE6 A;  1LQL A;  1DL6 A;  3HOZ I;  2YU9 I;  4NBH A;  1I6H I;  2JA7 I;  2K5R A;  3S1M I;  3GTK I;  2DE5 A;  1X3W A;  3PO3 S;  3GTQ I;  2KPI A;  1WW9 A;  4BXX I;  4A3E I;  2JA5 I;  4NOZ A;  2NVQ I;  3HOX I; 
#chains in the Genus database with same CATH topology
 3GTM I;  2YAD A;  3I4M I;  3EER A;  1ZH1 A;  1KD1 2;  3GTJ I;  3CC2 Z;  1YJ9 1;  4E32 A;  3S2H I;  3H3V J;  3KIH A;  1I3Q I;  5IP9 I;  1Y8C A;  1X0T A;  2V3V A;  2I3C A;  4MRI A;  1SFO I;  3OW2 Z;  3RZO I;  2P3Y A;  3HOW I;  5T6B A;  4A3D I;  5A2Q b;  3S16 I;  1RLY A;  2F4O A;  2WAQ A;  2QA4 Z;  4NH1 C;  1Q86 1;  2JIR A;  2VUM I;  3CPW Y;  4MD9 A;  3CCU 1;  1W2B Y;  1Y1V I;  2GTI A;  3KIF A;  2RIQ A;  4Y7N I;  2RHB A;  3CCJ Z;  2R93 I;  1YIJ 1;  2Y0S A;  1JJ2 Z;  4MXU A;  3CCV 1;  1USP B;  4S1T A;  1W2B Z;  3PO3 I;  4A3J I;  2QLV B;  4BBS I;  2O4H A;  3IF8 A;  3G4S Z;  3VB9 A;  2K3R A;  2E2I I;  4RVH A;  2H85 A;  3M3Y I;  3G71 1;  2JA8 I;  2NVY I;  4HH4 A;  4XX2 A;  3GTM S;  2JIP A;  3TDH B;  1S72 1;  1Q81 1;  3HOV I;  3EED A;  4NFR A;  2VF1 A;  3J7A 4;  3CQZ I;  1VQP Z;  1K73 1;  2VPW A;  1Q81 2;  4EWC A;  1NJI 2;  2NVX I;  2ZAE B;  3GKQ A;  5C44 I;  3S14 I;  3CD6 Z;  3VMH A;  2BJO A;  1YI2 Z;  1R9T I;  3G6E 1;  4NBG A;  3CC7 Z;  3MON A;  1RNI A;  3GCF A;  2PMZ A;  3J81 f;  1RO0 A;  4TNU A;  4A3C I;  4DQY B;  3HKZ A;  4A93 I;  1VQK 1;  2IZ3 A;  1YJN Z;  3IX0 A;  3RZD I;  3CME Z;  1KRL A;  3CCE Z;  3D9X A;  1DL6 A;  3HOZ I;  2OTJ Z;  2AYD A;  2QRD B;  2JA7 I;  1VQL Z;  3GTK I;  2P28 A;  3NDI A;  3CCE 1;  3CME 1;  5IT9 b;  3BG0 B;  3M4O I;  1VQK Z;  3J80 f;  2JR6 A;  5C4X I;  3Q87 A;  1VQ5 1;  3D6W A;  2E9H A;  3TE5 B;  3I56 1;  2V8K A;  4QTT A;  1VQM 1;  2QRE B;  1QVF Y;  2Q51 A;  1YJW Z;  1VQN 1;  1K9M 1;  2OZK A;  1YIT Z;  3OW2 Y;  2M48 A;  1K9M 2;  2GTH A;  1VQ8 1;  4E30 A;  1KQS Y;  1VQP 1;  1QYP A;  1KC8 1;  1FDI A;  3NH8 A;  1WCM I;  5AN9 F;  1VQ8 Z;  1P9N A;  2VUG A;  1KC8 2;  3G71 Z;  2IV2 X;  4HGY A;  1YIT 1;  3HOY I;  1JJ2 Y;  1KQS Z;  4X6A I;  1QXF A;  1TWG I;  2E2H I;  5FLX b;  2IZ4 A;  2R92 I;  3S15 I;  1VQM Z;  2HU9 A;  1TWA I;  1YUK A;  3S1N I;  3FQQ A;  1Q7Y 2;  3CCR Z;  2M6N A;  3GTG I;  3LUS A;  1TWF I;  4NBC A;  1VQ4 Z;  1USP A;  3S1R I;  1Z01 A;  1Q16 A;  4HGZ A;  2HF1 A;  1K83 I;  2F4M A;  4NB9 A;  1YJW 1;  3GTP I;  3VTN A;  4E2Y A;  4A3M I;  5LL6 f;  2RT9 A;  3I56 Z;  1RO2 A;  2NAP A;  1Y1W I;  2V8J A;  2OTJ 1;  2KI7 B;  3T4N B;  3QWU A;  1YJN 1;  2JNY A;  3FQM A;  1ZB9 A;  2JS4 A;  5T67 A;  5D1P A;  3U50 C;  2JIQ A;  3J80 b;  1WII A;  2DE6 A;  2V8I A;  2W03 A;  1LQL A;  5A2Q f;  5IT9 f;  1Z02 A;  2LIY A;  2DE5 A;  1X3W A;  2EGT A;  3CD6 1;  2KPI A;  4A3E I;  1VQ4 1;  3HOX I;  3F3P C;  3NH5 A;  3CCR 1;  5T64 A;  3FKI I;  3G6E Z;  1M90 1;  1YI2 1;  2PK7 A;  5D1O B;  2V45 A;  3PO2 I;  2LEX A;  2VPX A;  4A3K I;  2G2K A;  1NUI A;  4E2X A;  1Q82 2;  3S17 I;  3IFU A;  2DE7 A;  1M1K 1;  2LFU A;  3ESW A;  3NH4 A;  3CCM 1;  1Z03 A;  2NVT I;  4BY1 I;  3VMI A;  3CCU Z;  1I50 I;  1TWC I;  3CMA Z;  1VQN Z;  4NBD A;  2QA4 1;  2O53 A;  3H0G I;  3NFZ A;  1YIJ Z;  1K8A 1;  3CCJ 1;  2JA6 I;  3HOU I;  4RVF A;  1ML8 A;  1VQ5 Z;  3S1Q I;  3J81 b;  1VQ9 Z;  2RBL A;  3MZK B;  3CC2 1;  2JUB A;  4NBA A;  2E2J I;  1AA6 A;  3CC4 Z;  1RQF A;  5CM2 M;  1VQL 1;  4RVD A;  4MH4 A;  1Q86 2;  5FLX f;  1S7M A;  4A3L I;  2R6M A;  1Q7Y 1;  4NB8 A;  4A3F I;  2J6A A;  1VQ6 Z;  2B63 I;  4Y52 I;  4A3B I;  3JAM f;  1N8R 1;  3CC7 1;  3MZL B;  3CCQ 1;  3S2D I;  1K8A 2;  3BG1 B;  4E33 A;  1N8R 2;  4NBE A;  1VQ7 Z;  4A3G I;  3CCS Z;  3S1M I;  3CXC Z;  2OOX B;  4E2W A;  3PO3 S;  3CCL 1;  3GTQ I;  1S72 Z;  4NOZ A;  1K73 2;  4BBR I;  1NJI 1;  3GTO I;  1N2F A;  3G4S 1;  5IP7 I;  2QKD A;  1YUA A;  1VLA A;  3VMG A;  3CCV Z;  5C4J I;  2WB1 A;  4NBF A;  2GU2 A;  2QR1 B;  1QVG Z;  4MON A;  4CL1 A;  4MD7 A;  2OTL Z;  1NP6 A;  3I55 Z;  2OOY B;  3I07 A;  4E2Z A;  3CC4 1;  2R7Z I;  4RVG A;  5C3E I;  2W04 A;  4DK1 A;  3JAM b;  5D1O A;  1TWH I;  4NBB A;  1VQ9 1;  2RPR A;  1Q82 1;  3I4N I;  4AYB A;  3D2L A;  2OTL 1;  2Q4Z A;  1YJ9 Z;  2VPZ A;  1WJ2 A;  1ZB8 A;  3CPW Z;  1QVF Z;  3CMA 1;  1RO4 A;  3I55 1;  1Y1V S;  3CCM Z;  3NDJ A;  2E7Z A;  2QEX 1;  1SIW A;  1QF8 A;  1M90 2;  4A3I I;  2QRC B;  2JIO A;  4MD8 A;  2AKL A;  3CCL Z;  4RV9 A;  1QVG Y;  1VQO Z;  3GTL I;  1L1O C;  3CCS 1;  1YHQ 1;  1KD1 1;  1VQ7 1;  3K7A I;  1YHQ Z;  3CXC Y;  4QTU A;  1TFI A;  1X3Z A;  1M1K 2;  2VPY A;  4BY7 I;  1VQO 1;  1WZN A;  3IR7 A;  5FLM I;  1PFT A;  4DGL A;  1JWH C;  2YU9 I;  2JIM A;  4NBH A;  1I6H I;  2K5R A;  2PM9 A;  4RS4 A;  3P5J B;  4BXX I;  1WW9 A;  1FDO A;  2JMO A;  2QEX Z;  3CCQ Z;  2JA5 I;  2NVQ I;  4E31 A;  3F3F C;  1VQ6 1; 
#chains in the Genus database with same CATH homology
 3GTM I;  2YAD A;  3I4M I;  3EER A;  1ZH1 A;  1KD1 2;  3GTJ I;  3CC2 Z;  1YJ9 1;  4E32 A;  3S2H I;  3H3V J;  3KIH A;  1I3Q I;  5IP9 I;  1X0T A;  2I3C A;  4MRI A;  1SFO I;  3OW2 Z;  3RZO I;  2P3Y A;  3HOW I;  5T6B A;  4A3D I;  5A2Q b;  3S16 I;  1RLY A;  2F4O A;  2WAQ A;  2QA4 Z;  4NH1 C;  1Q86 1;  2VUM I;  3CPW Y;  4MD9 A;  3CCU 1;  1W2B Y;  1Y1V I;  2GTI A;  3KIF A;  2RIQ A;  4Y7N I;  2RHB A;  3CCJ Z;  2R93 I;  1YIJ 1;  2Y0S A;  1JJ2 Z;  4MXU A;  3CCV 1;  1USP B;  4S1T A;  1W2B Z;  3PO3 I;  4A3J I;  2QLV B;  4BBS I;  2O4H A;  3IF8 A;  3G4S Z;  3VB9 A;  2K3R A;  2E2I I;  4RVH A;  2H85 A;  3M3Y I;  3G71 1;  2JA8 I;  2NVY I;  4HH4 A;  4XX2 A;  3GTM S;  3TDH B;  1S72 1;  1Q81 1;  3HOV I;  3EED A;  4NFR A;  2VF1 A;  3J7A 4;  3CQZ I;  1VQP Z;  1K73 1;  1Q81 2;  4EWC A;  1NJI 2;  2NVX I;  2ZAE B;  3GKQ A;  5C44 I;  3S14 I;  3CD6 Z;  3VMH A;  2BJO A;  1YI2 Z;  1R9T I;  3G6E 1;  4NBG A;  3CC7 Z;  3MON A;  1RNI A;  3GCF A;  2PMZ A;  3J81 f;  1RO0 A;  4TNU A;  4A3C I;  4DQY B;  3HKZ A;  4A93 I;  1VQK 1;  2IZ3 A;  1YJN Z;  3IX0 A;  3RZD I;  3CME Z;  1KRL A;  3CCE Z;  3D9X A;  1DL6 A;  3HOZ I;  2OTJ Z;  2QRD B;  2JA7 I;  1VQL Z;  3GTK I;  2P28 A;  3NDI A;  3CCE 1;  3CME 1;  5IT9 b;  3BG0 B;  3M4O I;  1VQK Z;  3J80 f;  2JR6 A;  5C4X I;  3Q87 A;  1VQ5 1;  3D6W A;  2E9H A;  3TE5 B;  3I56 1;  2V8K A;  4QTT A;  1VQM 1;  2QRE B;  1QVF Y;  2Q51 A;  1YJW Z;  1VQN 1;  1K9M 1;  2OZK A;  1YIT Z;  3OW2 Y;  2M48 A;  1K9M 2;  2GTH A;  1VQ8 1;  4E30 A;  1KQS Y;  1VQP 1;  1QYP A;  1KC8 1;  3NH8 A;  1WCM I;  5AN9 F;  1VQ8 Z;  1P9N A;  2VUG A;  1KC8 2;  3G71 Z;  4HGY A;  1YIT 1;  3HOY I;  1JJ2 Y;  1KQS Z;  4X6A I;  1TWG I;  2E2H I;  5FLX b;  2IZ4 A;  2R92 I;  3S15 I;  1VQM Z;  2HU9 A;  1TWA I;  1YUK A;  3S1N I;  3FQQ A;  1Q7Y 2;  3CCR Z;  2M6N A;  3GTG I;  3LUS A;  1TWF I;  4NBC A;  1VQ4 Z;  1USP A;  3S1R I;  1Z01 A;  4HGZ A;  2HF1 A;  1K83 I;  2F4M A;  4NB9 A;  1YJW 1;  3GTP I;  3VTN A;  4E2Y A;  4A3M I;  5LL6 f;  2RT9 A;  3I56 Z;  1RO2 A;  1Y1W I;  2V8J A;  2OTJ 1;  2KI7 B;  3T4N B;  1YJN 1;  3QWU A;  2JNY A;  3FQM A;  1ZB9 A;  2JS4 A;  5T67 A;  5D1P A;  3U50 C;  3J80 b;  1WII A;  2DE6 A;  2V8I A;  2W03 A;  1LQL A;  5A2Q f;  5IT9 f;  1Z02 A;  2LIY A;  2DE5 A;  1X3W A;  2EGT A;  3CD6 1;  2KPI A;  4A3E I;  1VQ4 1;  3HOX I;  3F3P C;  3NH5 A;  3CCR 1;  5T64 A;  3FKI I;  3G6E Z;  1M90 1;  1YI2 1;  2PK7 A;  5D1O B;  3PO2 I;  4A3K I;  2G2K A;  1NUI A;  4E2X A;  1Q82 2;  3S17 I;  3IFU A;  2DE7 A;  1M1K 1;  2LFU A;  3ESW A;  3NH4 A;  3CCM 1;  1Z03 A;  2NVT I;  4BY1 I;  3VMI A;  3CCU Z;  1I50 I;  1TWC I;  3CMA Z;  1VQN Z;  4NBD A;  2QA4 1;  2O53 A;  3H0G I;  3NFZ A;  1YIJ Z;  1K8A 1;  3CCJ 1;  2JA6 I;  3HOU I;  4RVF A;  1ML8 A;  1VQ5 Z;  3S1Q I;  3J81 b;  1VQ9 Z;  2RBL A;  3MZK B;  3CC2 1;  2JUB A;  4NBA A;  2E2J I;  3CC4 Z;  1RQF A;  5CM2 M;  1VQL 1;  4RVD A;  4MH4 A;  1Q86 2;  5FLX f;  1S7M A;  4A3L I;  2R6M A;  1Q7Y 1;  4NB8 A;  4A3F I;  2J6A A;  1VQ6 Z;  2B63 I;  4Y52 I;  4A3B I;  3JAM f;  1N8R 1;  3CC7 1;  3MZL B;  3CCQ 1;  3S2D I;  1K8A 2;  3BG1 B;  4E33 A;  1N8R 2;  4NBE A;  1VQ7 Z;  4A3G I;  3CCS Z;  3S1M I;  3CXC Z;  2OOX B;  4E2W A;  3PO3 S;  3CCL 1;  3GTQ I;  1S72 Z;  4NOZ A;  1K73 2;  4BBR I;  1NJI 1;  3GTO I;  1N2F A;  3G4S 1;  5IP7 I;  2QKD A;  1YUA A;  1VLA A;  3VMG A;  3CCV Z;  5C4J I;  2WB1 A;  4NBF A;  2GU2 A;  2QR1 B;  1QVG Z;  4MON A;  4CL1 A;  4MD7 A;  2OTL Z;  1NP6 A;  3I55 Z;  2OOY B;  3I07 A;  4E2Z A;  3CC4 1;  2R7Z I;  4RVG A;  5C3E I;  2W04 A;  4DK1 A;  3JAM b;  5D1O A;  1TWH I;  4NBB A;  1VQ9 1;  2RPR A;  1Q82 1;  3I4N I;  4AYB A;  2OTL 1;  2Q4Z A;  1YJ9 Z;  1ZB8 A;  3CPW Z;  1QVF Z;  3CMA 1;  1RO4 A;  3I55 1;  1Y1V S;  3NDJ A;  3CCM Z;  2QEX 1;  1QF8 A;  1M90 2;  4A3I I;  2QRC B;  4MD8 A;  2AKL A;  3CCL Z;  4RV9 A;  1QVG Y;  1VQO Z;  3GTL I;  1L1O C;  3CCS 1;  1YHQ 1;  1KD1 1;  1VQ7 1;  3K7A I;  1YHQ Z;  3CXC Y;  4QTU A;  1TFI A;  1X3Z A;  1M1K 2;  4BY7 I;  1VQO 1;  5FLM I;  1PFT A;  4DGL A;  1JWH C;  2YU9 I;  4NBH A;  1I6H I;  2K5R A;  2PM9 A;  4RS4 A;  3P5J B;  4BXX I;  1WW9 A;  2JMO A;  2QEX Z;  3CCQ Z;  2JA5 I;  2NVQ I;  4E31 A;  3F3F C;  1VQ6 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...