2YU9I

Rna polymerase ii elongation complex in 150 mm mg+2 with utp
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural Basis of Transcription: Role of the Trigger Loop in Substrate Specificity and Catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 6
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2yu9I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2yu9I02
1TWAI 2J6AA 4NBGA 3I4MI 4A3EI 4NBFA 3S2DI 3GTLI 4QTUA 4QTTA 1ZB9A 3M3YI 4NOZA 3RZDI 2E2HI 3S14I 1Y1VI 4BXXI 2F4MA 4A3KI 4A3BI 1Y1VS 1RO4A 5C44I 2R92I 3S1QI 4BBSI 3I4NI 2NVYI 4A3DI 2AKLA 3VMHA 1N2FA 4A3JI 4NBCA 3S2HI 4NBAA 1PFTA 4NB8A 2JR6A 2JA7I 3U50C 3HOXI 1YUAA 1RLYA 2BJOA 5C3EI 2NVXI 4BBRI 4Y52I 3S1RI 3K7AI 1TWCI 1USPB 2R93I 3RZOI 1NUIA 3HOUI 3M4OI 3GTMI 1I6HI 4A3GI 1WW9A 3GTMS 1VLAA 3S17I 2NVQI 3CQZI 3FKII 1X3ZA 2DE5A 5C4XI 4NBDA 3LUSA 2P3YA 2JS4A 2NVTI 1QYPA 1ML8A 4A3II 3GTPI 3VB9A 1TWHI 4NBHA 1Y1WI 3HOVI 4MH4A 2PK7A 2JNYA 2E2II 3S1MI 1TFIA 3GCFA 4X6AI 4A3CI 2B63I 2F4OA 4A3MI 1DL6A 3HOZI 2R7ZI 4XX2A 2DE6A 1I3QI 3H0GI 3Q87A 4BY1I 3GTQI 1X3WA 2DE7A 3I07A 4A93I 4Y7NI 3GTGI 2JA6I 1ZB8A 4NBBA 4A3LI 3PO3I 1L1OC 5IP7I 1LQLA 4NBEA 3H3VJ 3PO3S 2HF1A 4A3FI 2K5RA 1K83I 1I50I 1TWFI 3ESWA 3EERA 5IP9I 2YU9I 3GTOI 1WCMI 3PO2I 4BY7I 4NB9A 3HOWI 3GTKI 3VMGA 3HOYI 2KPIA 5FLMI 2E2JI 3S15I 2JA5I 1USPA 3GKQA 3GTJI 1TWGI 3D6WA 3VMIA 2RBLA 1SFOI 2JA8I 3S16I 5CM2M 5C4JI 3S1NI 2VUMI 1R9TI
chains in the Genus database with same CATH superfamily
3D9XA 2Q51A 3CCMZ 2J6AA 1YI2Z 3I4MI 4A3EI 3GTLI 3OW2Y 4QTUA 2OOXB 3CCM1 4QTTA 1ZB9A 4MD7A 1YHQZ 1M1K1 3S14I 1Y1VI 4BBSI 1VQL1 1VQ51 1VQ9Z 2V8KA 1K731 3OW2Z 1VQ91 3S2HI 3BG0B 2QA4Z 5IT9b 4NB8A 3MONA 2JA7I 1P9NA 2QA41 2HU9A 3S1RI 1TWCI 3MZKB 1Z01A 3HOUI 3VTNA 2VUGA 1VLAA 3CQZI 3MZLB 5C4XI 2DE5A 5IT9f 4NBDA 3F3FC 3CMAZ 1RO2A 1AA6A 2RT9A 2JS4A 1YJ91 1QYPA 2W04A 1ML8A 4A3II 3NH8A 3J81b 1Q7Y1 2EGTA 2JNYA 3S1MI 1WJ2A 3GCFA 4X6AI 4A3MI 1VQNZ 3CXCY 1I3QI 3CCU1 1RO0A 3Q87A 2VPXA 1KC81 3J81f 3CCE1 1JJ2Y 1NJI2 4EWCA 4TNUA 1ZB8A 1Q862 2RHBA 4NBBA 3G6E1 3TDHB 1VQK1 3CXCZ 2OTJ1 1S72Z 2JIQA 1L1OC 1Q822 3PO3S 4DK1A 1K83I 1TWFI 4S1TA 1S721 1KD11 3T4NB 4E2XA 3PO2I 1JJ2Z 4RS4A 2KI7B 3CCSZ 3GTKI 5D1OB 3VMGA 2YADA 3S15I 4NH1C 1VQPZ 4RVFA 3CC2Z 3J80b 3IR7A 2IZ4A 1SFOI 4E2WA 3CCL1 1Q812 2JA8I 1SIWA 1QXFA 1N8R1 2VPWA 2V8JA 4HGYA 4NBGA 1VQ7Z 3J80f 1VQ4Z 4MD8A 3J7A4 3FQMA 2GU2A 1X0TA 3M3YI 1VQ71 2AYDA 3NDJA 2E2HI 3RZDI 1VQ41 3I56Z 4BXXI 4MRIA 4HGZA 2F4MA 4A3KI 1Y1VS 3S1QI 1JWHC 5C44I 2R92I 1YIJZ 2V8IA 3CCJZ 1K732 2NVYI 4RV9A 3I4NI 3CCJ1 4NBCA 2QKDA 1K9M2 1QVFY 2WAQA 5C3EI 2NVXI 2QEX1 3K7AI 2R93I 1USPB 1YITZ 3M4OI 3GTMI 1Y8CA 1YIT1 3TE5B 4A3GI 2Q4ZA 1VQLZ 1VQ5Z 4DGLA 3FKII 1X3ZA 5T67A 1QVFZ 2QR1B 2O4HA 1Q7Y2 2LFUA 1TWHI 2JIMA 4NFRA 1KRLA 1WIIA 4NBHA 1WZNA 1S7MA 3JAMb 1VQO1 5D1PA 1TFIA 4E30A 4A3CI 1DL6A 3HOZI 2DE6A 3H0GI 1KC82 3CC4Z 1RNIA 1X3WA 3CC41 3NDIA 1YJ9Z 2JA6I 3JAMf 1M901 4NBEA 3H3VJ 2HF1A 4A3FI 1KD12 2H85A 1I50I 2K5RA 1WCMI 4BY7I 3CCUZ 4NB9A 3HOWI 2I3CA 3QWUA 3HOYI 2ZAEB 1FDIA 2KPIA 5FLMI 1Q16A 3CCEZ 1TWGI 3CCQ1 2RBLA 3G6EZ 1VQKZ 2QRDB 3CPWY 3S16I 2OTJZ 5CM2M 5C4JI 3G71Z 5A2Qb 3S1NI 1R9TI 3IFUA 1TWAI 3G711 4DQYB 2JUBA 3KIFA 4E31A 2OTLZ 3CD6Z 2W03A 3CPWZ 3CCVZ 2OTL1 3CD61 3CCV1 5A2Qf 3CCLZ 3NH5A 3KIHA 5FLXb 1RO4A 3CME1 4A3DI 2AKLA 2E7ZA 3VMHA 1N2FA 4A3JI 2PM9A 2LIYA 4RVHA 3G4SZ 2JR6A 3HOXI 1YUAA 1RLYA 2BJOA 4Y52I 3G4S1 3RZOI 1NUIA 1VQM1 5FLXf 1QVGY 1M1K2 3GTMS 3S17I 3NFZA 2NVQI 1YJN1 2P3YA 2NVTI 5T64A 4RVDA 1FDOA 3CC71 1Y1WI 1QVGZ 3HOVI 4MH4A 2PK7A 2Y0SA 2QEXZ 1Q821 1K8A1 4XX2A 3GTQI 2VPYA 3I07A 4Y7NI 3IF8A 1ZH1A 3BG1B 1Q811 2V45A 1Z03A 4A3LI 3D2LA 1LQLA 1VQOZ 4HH4A 2O53A 5LL6f 5IP9I 3GTOI 2JIRA 1YI21 1VQ6Z 1VQ61 2NAPA 4MONA 2GTIA 1YHQ1 4E33A 5AN9F 1YUKA 2G2KA 4E2ZA 1K9M1 2PMZA 2M48A 2VPZA 4NBFA 3S2DI 2V3VA 4CL1A 3F3PC 1Z02A 4NOZA 3CCQZ 3NH4A 3FQQA 4MXUA 4A3BI 3P5JB 4E32A 2GTHA 3CMA1 4MD9A 3IX0A 5T6BA 1N8R2 3CCRZ 1NP6A 2WB1A 4NBAA 1KQSY 3I55Z 1PFTA 3CCR1 1RQFA 3U50C 3HKZA 4BBRI 2P28A 3I551 1I6HI 1VQN1 1WW9A 2M6NA 2R6MA 2IV2X 2QRCB 1KQSZ 3CMEZ 4E2YA 2VF1A 5D1OA 3LUSA 4AYBA 2OOYB 1W2BY 3GTPI 3VB9A 2E2II 2JIOA 2E9HA 1K8A2 1VQMZ 1QF8A 2B63I 2F4OA 2R7ZI 2LEXA 2RIQA 1W2BZ 4BY1I 3CCS1 1YJNZ 2OZKA 2DE7A 2QLVB 4A93I 1VQP1 3GTGI 3CC21 1NJI1 3CC7Z 1Q861 3PO3I 5IP7I 3EEDA 3ESWA 1VQ8Z 2K3RA 3EERA 2YU9I 1VQ81 1YJWZ 2E2JI 2JA5I 1USPA 3GKQA 3GTJI 1YJW1 2IZ3A 3I561 3D6WA 3VMIA 2RPRA 1YIJ1 2QREB 1M902 2JMOA 2VUMI 4RVGA 2JIPA
chains in the Genus database with same CATH topology
3D9XA 2Q51A 3CCMZ 2J6AA 1YI2Z 3I4MI 4A3EI 3GTLI 3OW2Y 4QTUA 2OOXB 3CCM1 4QTTA 1ZB9A 4MD7A 1YHQZ 1M1K1 3S14I 1Y1VI 4BBSI 1VQL1 1VQ51 1VQ9Z 2V8KA 1K731 3OW2Z 1VQ91 3S2HI 3BG0B 2QA4Z 5IT9b 4NB8A 3MONA 2JA7I 1P9NA 2QA41 2HU9A 3S1RI 1TWCI 3MZKB 1Z01A 3HOUI 3VTNA 2VUGA 1VLAA 3CQZI 3MZLB 5C4XI 2DE5A 5IT9f 4NBDA 3F3FC 3CMAZ 1RO2A 2RT9A 2JS4A 1YJ91 1QYPA 2W04A 1ML8A 4A3II 3NH8A 3J81b 1Q7Y1 2EGTA 2JNYA 3S1MI 3GCFA 4X6AI 4A3MI 1VQNZ 3CXCY 1I3QI 3CCU1 1RO0A 3Q87A 1KC81 3J81f 3CCE1 1JJ2Y 1NJI2 4EWCA 4TNUA 1ZB8A 1Q862 2RHBA 4NBBA 3G6E1 3TDHB 1VQK1 3CXCZ 2OTJ1 1S72Z 1L1OC 1Q822 3PO3S 4DK1A 1K83I 1TWFI 4S1TA 1S721 1KD11 3T4NB 4E2XA 3PO2I 1JJ2Z 4RS4A 2KI7B 3CCSZ 3GTKI 5D1OB 3VMGA 2YADA 3S15I 4NH1C 1VQPZ 4RVFA 3J80b 3CC2Z 2IZ4A 1SFOI 4E2WA 3CCL1 1Q812 2JA8I 1N8R1 2V8JA 4HGYA 4NBGA 1VQ7Z 3J80f 1VQ4Z 4MD8A 3J7A4 3FQMA 2GU2A 1X0TA 3M3YI 1VQ71 3NDJA 2E2HI 3RZDI 1VQ41 3I56Z 4BXXI 4MRIA 4HGZA 2F4MA 4A3KI 1Y1VS 3S1QI 1JWHC 5C44I 2R92I 1YIJZ 2V8IA 3CCJZ 1K732 2NVYI 4RV9A 3I4NI 3CCJ1 4NBCA 2QKDA 1K9M2 1QVFY 2WAQA 5C3EI 2NVXI 2QEX1 3K7AI 2R93I 1USPB 1YITZ 3M4OI 3GTMI 1YIT1 3TE5B 4A3GI 2Q4ZA 1VQLZ 1VQ5Z 4DGLA 3FKII 1X3ZA 5T67A 1QVFZ 2QR1B 2O4HA 1Q7Y2 2LFUA 1TWHI 4NFRA 1KRLA 1WIIA 4NBHA 1S7MA 3JAMb 1VQO1 5D1PA 1TFIA 4E30A 4A3CI 1DL6A 3HOZI 2DE6A 3H0GI 1KC82 3CC4Z 1RNIA 1X3WA 3CC41 3NDIA 1YJ9Z 2JA6I 3JAMf 1M901 4NBEA 3H3VJ 2HF1A 4A3FI 1KD12 2H85A 1I50I 2K5RA 1WCMI 4BY7I 3CCUZ 4NB9A 3HOWI 2I3CA 3QWUA 3HOYI 2ZAEB 2KPIA 5FLMI 3CCEZ 1TWGI 3CCQ1 2RBLA 3G6EZ 1VQKZ 2QRDB 3CPWY 3S16I 2OTJZ 5CM2M 5C4JI 3G71Z 5A2Qb 3S1NI 1R9TI 3IFUA 1TWAI 3G711 4DQYB 2JUBA 3KIFA 4E31A 2OTLZ 3CD6Z 2W03A 3CPWZ 3CCVZ 2OTL1 3CD61 3CCV1 5A2Qf 3CCLZ 3NH5A 3KIHA 5FLXb 1RO4A 3CME1 4A3DI 2AKLA 3VMHA 1N2FA 4A3JI 2PM9A 2LIYA 4RVHA 3G4SZ 2JR6A 3HOXI 1YUAA 1RLYA 2BJOA 4Y52I 3G4S1 3RZOI 1NUIA 1VQM1 5FLXf 1QVGY 1M1K2 3GTMS 3S17I 3NFZA 2NVQI 1YJN1 2P3YA 2NVTI 5T64A 4RVDA 3CC71 1Y1WI 1QVGZ 3HOVI 4MH4A 2PK7A 2Y0SA 2QEXZ 1Q821 1K8A1 4XX2A 3GTQI 3I07A 4Y7NI 3IF8A 1ZH1A 3BG1B 1Q811 1Z03A 4A3LI 1VQOZ 1LQLA 4HH4A 2O53A 5LL6f 5IP9I 3GTOI 1YI21 1VQ6Z 1VQ61 4MONA 2GTIA 1YHQ1 4E33A 5AN9F 1YUKA 2G2KA 4E2ZA 1K9M1 2PMZA 2M48A 4NBFA 3S2DI 4CL1A 3F3PC 1Z02A 4NOZA 3CCQZ 3NH4A 3FQQA 4MXUA 4A3BI 3P5JB 4E32A 2GTHA 3CMA1 4MD9A 3IX0A 5T6BA 1N8R2 3CCRZ 1NP6A 2WB1A 4NBAA 1KQSY 3I55Z 1PFTA 3CCR1 1RQFA 3U50C 3HKZA 4BBRI 2P28A 3I551 1I6HI 1VQN1 1WW9A 2M6NA 2R6MA 2QRCB 1KQSZ 3CMEZ 4E2YA 2VF1A 5D1OA 3LUSA 4AYBA 2OOYB 1W2BY 3GTPI 3VB9A 2E2II 2E9HA 1K8A2 1VQMZ 1QF8A 2B63I 2F4OA 2R7ZI 2RIQA 1W2BZ 4BY1I 3CCS1 1YJNZ 2OZKA 2DE7A 2QLVB 4A93I 1VQP1 3GTGI 3CC21 1NJI1 3CC7Z 1Q861 3PO3I 5IP7I 3EEDA 3ESWA 1VQ8Z 2K3RA 3EERA 2YU9I 1VQ81 1YJWZ 2E2JI 2JA5I 1USPA 3GKQA 3GTJI 1YJW1 2IZ3A 3I561 3D6WA 3VMIA 2RPRA 1YIJ1 2QREB 1M902 2JMOA 2VUMI 4RVGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWA I;  2J6A A;  4NBG A;  3I4M I;  4A3E I;  4NBF A;  3S2D I;  3GTL I;  4QTU A;  4QTT A;  1ZB9 A;  3M3Y I;  4NOZ A;  3RZD I;  2E2H I;  3S14 I;  1Y1V I;  4BXX I;  2F4M A;  4A3K I;  4A3B I;  1Y1V S;  1RO4 A;  5C44 I;  2R92 I;  3S1Q I;  4BBS I;  3I4N I;  2NVY I;  4A3D I;  2AKL A;  3VMH A;  1N2F A;  4A3J I;  4NBC A;  3S2H I;  4NBA A;  1PFT A;  4NB8 A;  2JR6 A;  2JA7 I;  3U50 C;  3HOX I;  1YUA A;  1RLY A;  2BJO A;  5C3E I;  2NVX I;  4BBR I;  4Y52 I;  3S1R I;  3K7A I;  1TWC I;  1USP B;  2R93 I;  3RZO I;  1NUI A;  3HOU I;  3M4O I;  3GTM I;  1I6H I;  4A3G I;  1WW9 A;  3GTM S;  1VLA A;  3S17 I;  2NVQ I;  3CQZ I;  3FKI I;  1X3Z A;  2DE5 A;  5C4X I;  4NBD A;  3LUS A;  2P3Y A;  2JS4 A;  2NVT I;  1QYP A;  1ML8 A;  4A3I I;  3GTP I;  3VB9 A;  1TWH I;  4NBH A;  1Y1W I;  3HOV I;  4MH4 A;  2PK7 A;  2JNY A;  2E2I I;  3S1M I;  1TFI A;  3GCF A;  4X6A I;  4A3C I;  2B63 I;  2F4O A;  4A3M I;  1DL6 A;  3HOZ I;  2R7Z I;  4XX2 A;  2DE6 A;  1I3Q I;  3H0G I;  3Q87 A;  4BY1 I;  3GTQ I;  1X3W A;  2DE7 A;  3I07 A;  4A93 I;  4Y7N I;  3GTG I;  2JA6 I;  1ZB8 A;  4NBB A;  4A3L I;  3PO3 I;  1L1O C;  5IP7 I;  1LQL A;  4NBE A;  3H3V J;  3PO3 S;  2HF1 A;  4A3F I;  2K5R A;  1K83 I;  1I50 I;  1TWF I;  3ESW A;  3EER A;  5IP9 I;  2YU9 I;  3GTO I;  1WCM I;  3PO2 I;  4BY7 I;  4NB9 A;  3HOW I;  3GTK I;  3VMG A;  3HOY I;  2KPI A;  5FLM I;  2E2J I;  3S15 I;  2JA5 I;  1USP A;  3GKQ A;  3GTJ I;  1TWG I;  3D6W A;  3VMI A;  2RBL A;  1SFO I;  2JA8 I;  3S16 I;  5CM2 M;  5C4J I;  3S1N I;  2VUM I;  1R9T I; 
#chains in the Genus database with same CATH topology
 3D9X A;  2Q51 A;  3CCM Z;  2J6A A;  1YI2 Z;  3I4M I;  4A3E I;  3GTL I;  3OW2 Y;  4QTU A;  2OOX B;  3CCM 1;  4QTT A;  1ZB9 A;  4MD7 A;  1YHQ Z;  1M1K 1;  3S14 I;  1Y1V I;  4BBS I;  1VQL 1;  1VQ5 1;  1VQ9 Z;  2V8K A;  1K73 1;  3OW2 Z;  1VQ9 1;  3S2H I;  3BG0 B;  2QA4 Z;  5IT9 b;  4NB8 A;  3MON A;  2JA7 I;  1P9N A;  2QA4 1;  2HU9 A;  3S1R I;  1TWC I;  3MZK B;  1Z01 A;  3HOU I;  3VTN A;  2VUG A;  1VLA A;  3CQZ I;  3MZL B;  5C4X I;  2DE5 A;  5IT9 f;  4NBD A;  3F3F C;  3CMA Z;  1RO2 A;  1AA6 A;  2RT9 A;  2JS4 A;  1YJ9 1;  1QYP A;  2W04 A;  1ML8 A;  4A3I I;  3NH8 A;  3J81 b;  1Q7Y 1;  2EGT A;  2JNY A;  3S1M I;  1WJ2 A;  3GCF A;  4X6A I;  4A3M I;  1VQN Z;  3CXC Y;  1I3Q I;  3CCU 1;  1RO0 A;  3Q87 A;  2VPX A;  1KC8 1;  3J81 f;  3CCE 1;  1JJ2 Y;  1NJI 2;  4EWC A;  4TNU A;  1ZB8 A;  1Q86 2;  2RHB A;  4NBB A;  3G6E 1;  3TDH B;  1VQK 1;  3CXC Z;  2OTJ 1;  1S72 Z;  2JIQ A;  1L1O C;  1Q82 2;  3PO3 S;  4DK1 A;  1K83 I;  1TWF I;  4S1T A;  1S72 1;  1KD1 1;  3T4N B;  4E2X A;  3PO2 I;  1JJ2 Z;  4RS4 A;  2KI7 B;  3CCS Z;  3GTK I;  5D1O B;  3VMG A;  2YAD A;  3S15 I;  4NH1 C;  1VQP Z;  4RVF A;  3CC2 Z;  3J80 b;  3IR7 A;  2IZ4 A;  1SFO I;  4E2W A;  3CCL 1;  1Q81 2;  2JA8 I;  1SIW A;  1QXF A;  1N8R 1;  2VPW A;  2V8J A;  4HGY A;  4NBG A;  1VQ7 Z;  3J80 f;  1VQ4 Z;  4MD8 A;  3J7A 4;  3FQM A;  2GU2 A;  1X0T A;  3M3Y I;  1VQ7 1;  2AYD A;  3NDJ A;  2E2H I;  3RZD I;  1VQ4 1;  3I56 Z;  4BXX I;  4MRI A;  4HGZ A;  2F4M A;  4A3K I;  1Y1V S;  3S1Q I;  1JWH C;  5C44 I;  2R92 I;  1YIJ Z;  2V8I A;  3CCJ Z;  1K73 2;  2NVY I;  4RV9 A;  3I4N I;  3CCJ 1;  4NBC A;  2QKD A;  1K9M 2;  1QVF Y;  2WAQ A;  5C3E I;  2NVX I;  2QEX 1;  3K7A I;  2R93 I;  1USP B;  1YIT Z;  3M4O I;  3GTM I;  1Y8C A;  1YIT 1;  3TE5 B;  4A3G I;  2Q4Z A;  1VQL Z;  1VQ5 Z;  4DGL A;  3FKI I;  1X3Z A;  5T67 A;  1QVF Z;  2QR1 B;  2O4H A;  1Q7Y 2;  2LFU A;  1TWH I;  2JIM A;  4NFR A;  1KRL A;  1WII A;  4NBH A;  1WZN A;  1S7M A;  3JAM b;  1VQO 1;  5D1P A;  1TFI A;  4E30 A;  4A3C I;  1DL6 A;  3HOZ I;  2DE6 A;  3H0G I;  1KC8 2;  3CC4 Z;  1RNI A;  1X3W A;  3CC4 1;  3NDI A;  1YJ9 Z;  2JA6 I;  3JAM f;  1M90 1;  4NBE A;  3H3V J;  2HF1 A;  4A3F I;  1KD1 2;  2H85 A;  1I50 I;  2K5R A;  1WCM I;  4BY7 I;  3CCU Z;  4NB9 A;  3HOW I;  2I3C A;  3QWU A;  3HOY I;  2ZAE B;  1FDI A;  2KPI A;  5FLM I;  1Q16 A;  3CCE Z;  1TWG I;  3CCQ 1;  2RBL A;  3G6E Z;  1VQK Z;  2QRD B;  3CPW Y;  3S16 I;  2OTJ Z;  5CM2 M;  5C4J I;  3G71 Z;  5A2Q b;  3S1N I;  1R9T I;  3IFU A;  1TWA I;  3G71 1;  4DQY B;  2JUB A;  3KIF A;  4E31 A;  2OTL Z;  3CD6 Z;  2W03 A;  3CPW Z;  3CCV Z;  2OTL 1;  3CD6 1;  3CCV 1;  5A2Q f;  3CCL Z;  3NH5 A;  3KIH A;  5FLX b;  1RO4 A;  3CME 1;  4A3D I;  2AKL A;  2E7Z A;  3VMH A;  1N2F A;  4A3J I;  2PM9 A;  2LIY A;  4RVH A;  3G4S Z;  2JR6 A;  3HOX I;  1YUA A;  1RLY A;  2BJO A;  4Y52 I;  3G4S 1;  3RZO I;  1NUI A;  1VQM 1;  5FLX f;  1QVG Y;  1M1K 2;  3GTM S;  3S17 I;  3NFZ A;  2NVQ I;  1YJN 1;  2P3Y A;  2NVT I;  5T64 A;  4RVD A;  1FDO A;  3CC7 1;  1Y1W I;  1QVG Z;  3HOV I;  4MH4 A;  2PK7 A;  2Y0S A;  2QEX Z;  1Q82 1;  1K8A 1;  4XX2 A;  3GTQ I;  2VPY A;  3I07 A;  4Y7N I;  3IF8 A;  1ZH1 A;  3BG1 B;  1Q81 1;  2V45 A;  1Z03 A;  4A3L I;  3D2L A;  1LQL A;  1VQO Z;  4HH4 A;  2O53 A;  5LL6 f;  5IP9 I;  3GTO I;  2JIR A;  1YI2 1;  1VQ6 Z;  1VQ6 1;  2NAP A;  4MON A;  2GTI A;  1YHQ 1;  4E33 A;  5AN9 F;  1YUK A;  2G2K A;  4E2Z A;  1K9M 1;  2PMZ A;  2M48 A;  2VPZ A;  4NBF A;  3S2D I;  2V3V A;  4CL1 A;  3F3P C;  1Z02 A;  4NOZ A;  3CCQ Z;  3NH4 A;  3FQQ A;  4MXU A;  4A3B I;  3P5J B;  4E32 A;  2GTH A;  3CMA 1;  4MD9 A;  3IX0 A;  5T6B A;  1N8R 2;  3CCR Z;  1NP6 A;  2WB1 A;  4NBA A;  1KQS Y;  3I55 Z;  1PFT A;  3CCR 1;  1RQF A;  3U50 C;  3HKZ A;  4BBR I;  2P28 A;  3I55 1;  1I6H I;  1VQN 1;  1WW9 A;  2M6N A;  2R6M A;  2IV2 X;  2QRC B;  1KQS Z;  3CME Z;  4E2Y A;  2VF1 A;  5D1O A;  3LUS A;  4AYB A;  2OOY B;  1W2B Y;  3GTP I;  3VB9 A;  2E2I I;  2JIO A;  2E9H A;  1K8A 2;  1VQM Z;  1QF8 A;  2B63 I;  2F4O A;  2R7Z I;  2LEX A;  2RIQ A;  1W2B Z;  4BY1 I;  3CCS 1;  1YJN Z;  2OZK A;  2DE7 A;  2QLV B;  4A93 I;  1VQP 1;  3GTG I;  3CC2 1;  1NJI 1;  3CC7 Z;  1Q86 1;  3PO3 I;  5IP7 I;  3EED A;  3ESW A;  1VQ8 Z;  2K3R A;  3EER A;  2YU9 I;  1VQ8 1;  1YJW Z;  2E2J I;  2JA5 I;  1USP A;  3GKQ A;  3GTJ I;  1YJW 1;  2IZ3 A;  3I56 1;  3D6W A;  3VMI A;  2RPR A;  1YIJ 1;  2QRE B;  1M90 2;  2JMO A;  2VUM I;  4RVG A;  2JIP A; 
#chains in the Genus database with same CATH homology
 3D9X A;  2Q51 A;  3CCM Z;  2J6A A;  1YI2 Z;  3I4M I;  4A3E I;  3GTL I;  3OW2 Y;  4QTU A;  2OOX B;  3CCM 1;  4QTT A;  1ZB9 A;  4MD7 A;  1YHQ Z;  1M1K 1;  3S14 I;  1Y1V I;  4BBS I;  1VQL 1;  1VQ5 1;  1VQ9 Z;  2V8K A;  1K73 1;  3OW2 Z;  1VQ9 1;  3S2H I;  3BG0 B;  2QA4 Z;  5IT9 b;  4NB8 A;  3MON A;  2JA7 I;  1P9N A;  2QA4 1;  2HU9 A;  3S1R I;  1TWC I;  3MZK B;  1Z01 A;  3HOU I;  3VTN A;  2VUG A;  1VLA A;  3CQZ I;  3MZL B;  5C4X I;  2DE5 A;  5IT9 f;  4NBD A;  3F3F C;  3CMA Z;  1RO2 A;  2RT9 A;  2JS4 A;  1YJ9 1;  1QYP A;  2W04 A;  1ML8 A;  4A3I I;  3NH8 A;  3J81 b;  1Q7Y 1;  2EGT A;  2JNY A;  3S1M I;  3GCF A;  4X6A I;  4A3M I;  1VQN Z;  3CXC Y;  1I3Q I;  3CCU 1;  1RO0 A;  3Q87 A;  1KC8 1;  3J81 f;  3CCE 1;  1JJ2 Y;  1NJI 2;  4EWC A;  4TNU A;  1ZB8 A;  1Q86 2;  2RHB A;  4NBB A;  3G6E 1;  3TDH B;  1VQK 1;  3CXC Z;  2OTJ 1;  1S72 Z;  1L1O C;  1Q82 2;  3PO3 S;  4DK1 A;  1K83 I;  1TWF I;  4S1T A;  1S72 1;  1KD1 1;  3T4N B;  4E2X A;  3PO2 I;  1JJ2 Z;  4RS4 A;  2KI7 B;  3CCS Z;  3GTK I;  5D1O B;  3VMG A;  2YAD A;  3S15 I;  4NH1 C;  1VQP Z;  4RVF A;  3J80 b;  3CC2 Z;  2IZ4 A;  1SFO I;  4E2W A;  3CCL 1;  1Q81 2;  2JA8 I;  1N8R 1;  2V8J A;  4HGY A;  4NBG A;  1VQ7 Z;  3J80 f;  1VQ4 Z;  4MD8 A;  3J7A 4;  3FQM A;  2GU2 A;  1X0T A;  3M3Y I;  1VQ7 1;  3NDJ A;  2E2H I;  3RZD I;  1VQ4 1;  3I56 Z;  4BXX I;  4MRI A;  4HGZ A;  2F4M A;  4A3K I;  1Y1V S;  3S1Q I;  1JWH C;  5C44 I;  2R92 I;  1YIJ Z;  2V8I A;  3CCJ Z;  1K73 2;  2NVY I;  4RV9 A;  3I4N I;  3CCJ 1;  4NBC A;  2QKD A;  1K9M 2;  1QVF Y;  2WAQ A;  5C3E I;  2NVX I;  2QEX 1;  3K7A I;  2R93 I;  1USP B;  1YIT Z;  3M4O I;  3GTM I;  1YIT 1;  3TE5 B;  4A3G I;  2Q4Z A;  1VQL Z;  1VQ5 Z;  4DGL A;  3FKI I;  1X3Z A;  5T67 A;  1QVF Z;  2QR1 B;  2O4H A;  1Q7Y 2;  2LFU A;  1TWH I;  4NFR A;  1KRL A;  1WII A;  4NBH A;  1S7M A;  3JAM b;  1VQO 1;  5D1P A;  1TFI A;  4E30 A;  4A3C I;  1DL6 A;  3HOZ I;  2DE6 A;  3H0G I;  1KC8 2;  3CC4 Z;  1RNI A;  1X3W A;  3CC4 1;  3NDI A;  1YJ9 Z;  2JA6 I;  3JAM f;  1M90 1;  4NBE A;  3H3V J;  2HF1 A;  4A3F I;  1KD1 2;  2H85 A;  1I50 I;  2K5R A;  1WCM I;  4BY7 I;  3CCU Z;  4NB9 A;  3HOW I;  2I3C A;  3QWU A;  3HOY I;  2ZAE B;  2KPI A;  5FLM I;  3CCE Z;  1TWG I;  3CCQ 1;  2RBL A;  3G6E Z;  1VQK Z;  2QRD B;  3CPW Y;  3S16 I;  2OTJ Z;  5CM2 M;  5C4J I;  3G71 Z;  5A2Q b;  3S1N I;  1R9T I;  3IFU A;  1TWA I;  3G71 1;  4DQY B;  2JUB A;  3KIF A;  4E31 A;  2OTL Z;  3CD6 Z;  2W03 A;  3CPW Z;  3CCV Z;  2OTL 1;  3CD6 1;  3CCV 1;  5A2Q f;  3CCL Z;  3NH5 A;  3KIH A;  5FLX b;  1RO4 A;  3CME 1;  4A3D I;  2AKL A;  3VMH A;  1N2F A;  4A3J I;  2PM9 A;  2LIY A;  4RVH A;  3G4S Z;  2JR6 A;  3HOX I;  1YUA A;  1RLY A;  2BJO A;  4Y52 I;  3G4S 1;  3RZO I;  1NUI A;  1VQM 1;  5FLX f;  1QVG Y;  1M1K 2;  3GTM S;  3S17 I;  3NFZ A;  2NVQ I;  1YJN 1;  2P3Y A;  2NVT I;  5T64 A;  4RVD A;  3CC7 1;  1Y1W I;  1QVG Z;  3HOV I;  4MH4 A;  2PK7 A;  2Y0S A;  2QEX Z;  1Q82 1;  1K8A 1;  4XX2 A;  3GTQ I;  3I07 A;  4Y7N I;  3IF8 A;  1ZH1 A;  3BG1 B;  1Q81 1;  1Z03 A;  4A3L I;  1VQO Z;  1LQL A;  4HH4 A;  2O53 A;  5LL6 f;  5IP9 I;  3GTO I;  1YI2 1;  1VQ6 Z;  1VQ6 1;  4MON A;  2GTI A;  1YHQ 1;  4E33 A;  5AN9 F;  1YUK A;  2G2K A;  4E2Z A;  1K9M 1;  2PMZ A;  2M48 A;  4NBF A;  3S2D I;  4CL1 A;  3F3P C;  1Z02 A;  4NOZ A;  3CCQ Z;  3NH4 A;  3FQQ A;  4MXU A;  4A3B I;  3P5J B;  4E32 A;  2GTH A;  3CMA 1;  4MD9 A;  3IX0 A;  5T6B A;  1N8R 2;  3CCR Z;  1NP6 A;  2WB1 A;  4NBA A;  1KQS Y;  3I55 Z;  1PFT A;  3CCR 1;  1RQF A;  3U50 C;  3HKZ A;  4BBR I;  2P28 A;  3I55 1;  1I6H I;  1VQN 1;  1WW9 A;  2M6N A;  2R6M A;  2QRC B;  1KQS Z;  3CME Z;  4E2Y A;  2VF1 A;  5D1O A;  3LUS A;  4AYB A;  2OOY B;  1W2B Y;  3GTP I;  3VB9 A;  2E2I I;  2E9H A;  1K8A 2;  1VQM Z;  1QF8 A;  2B63 I;  2F4O A;  2R7Z I;  2RIQ A;  1W2B Z;  4BY1 I;  3CCS 1;  1YJN Z;  2OZK A;  2DE7 A;  2QLV B;  4A93 I;  1VQP 1;  3GTG I;  3CC2 1;  1NJI 1;  3CC7 Z;  1Q86 1;  3PO3 I;  5IP7 I;  3EED A;  3ESW A;  1VQ8 Z;  2K3R A;  3EER A;  2YU9 I;  1VQ8 1;  1YJW Z;  2E2J I;  2JA5 I;  1USP A;  3GKQ A;  3GTJ I;  1YJW 1;  2IZ3 A;  3I56 1;  3D6W A;  3VMI A;  2RPR A;  1YIJ 1;  2QRE B;  1M90 2;  2JMO A;  2VUM I;  4RVG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...