2YU9I

Rna polymerase ii elongation complex in 150 mm mg+2 with utp
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
119
structure length
119
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural Basis of Transcription: Role of the Trigger Loop in Substrate Specificity and Catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 6
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2yu9I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2yu9I02
4A3EI 3Q87A 4NB9A 1X3WA 1Y1VI 2NVYI 4NBEA 4BBRI 3CQZI 1DL6A 3S1RI 3I07A 4NBAA 2BJOA 4A3FI 3GTGI 3PO3S 2E2JI 4A3GI 3PO3I 5IP9I 5CM2M 3GTMS 3GKQA 4NOZA 3I4MI 2JA5I 3GTMI 1TFIA 3GTQI 1I6HI 1Y1WI 3LUSA 3S17I 3D6WA 5IP7I 2KPIA 4XX2A 3H3VJ 4A3BI 2NVTI 5C4JI 1I50I 4Y52I 1K83I 4NB8A 4NBFA 3PO2I 3HOYI 2F4MA 4A3KI 4QTTA 3RZDI 1ZB8A 3HOUI 3VMIA 4A3MI 2J6AA 4BY1I 3H0GI 1L1OC 2JA7I 3S2DI 2NVXI 4BBSI 3GTKI 5C4XI 1ML8A 1PFTA 2JS4A 1X3ZA 2JR6A 2K5RA 3HOXI 2JA8I 3M4OI 2R7ZI 3VB9A 1I3QI 5C44I 1ZB9A 1QYPA 2JNYA 3U50C 4A3LI 3HOVI 3S2HI 2NVQI 4A3JI 3VMHA 3S15I 2YU9I 3M3YI 3HOZI 1VLAA 2RBLA 1TWCI 1WCMI 3VMGA 2B63I 4A3DI 5C3EI 4BXXI 4NBGA 2DE5A 3K7AI 2E2II 4NBBA 1TWGI 4A3II 2HF1A 3EERA 3S16I 3S1MI 4Y7NI 4BY7I 3GCFA 4QTUA 3ESWA 3GTPI 3S1NI 1LQLA 3GTOI 1TWAI 1N2FA 1Y1VS 2PK7A 1USPB 2R92I 4X6AI 1WW9A 2DE6A 3I4NI 1R9TI 4A3CI 2F4OA 4MH4A 2VUMI 1RLYA 3HOWI 4A93I 3RZOI 1NUIA 2DE7A 1TWHI 2E2HI 2JA6I 3GTJI 3S14I 3S1QI 1YUAA 1USPA 4NBHA 3FKII 2AKLA 2P3YA 1TWFI 4NBDA 1SFOI 3GTLI 4NBCA 5FLMI 1RO4A 2R93I
chains in the Genus database with same CATH superfamily
3CD6Z 2NVYI 3CXCZ 1VQNZ 3NH8A 2V8IA 1W2BY 2QRDB 1YJNZ 4NOZA 2QKDA 1VQ51 1QVGY 1TFIA 1VQ81 5IT9f 1K9M2 2RT9A 2V8KA 1VQOZ 3H3VJ 2NVTI 1VQKZ 1I50I 5FLXb 1K8A2 3CCS1 3CCQ1 2AYDA 4E2XA 2WB1A 4A3KI 1YHQ1 1ZB8A 3HOUI 4A3MI 2E9HA 1Q862 2V3VA 2J6AA 1M902 2IV2X 5C4XI 1VQMZ 1VQLZ 4RVGA 2YADA 1I3QI 4E31A 1ZB9A 2Q4ZA 3IF8A 2K3RA 3VMHA 3F3FC 2YU9I 3J81f 3M3YI 3HOZI 1TWCI 4A3DI 2B63I 4BXXI 5D1OB 1W2BZ 1VQN1 1VQ4Z 1N8R1 1S721 3GCFA 4QTUA 1QVGZ 3S1NI 3GTOI 1Y1VS 2PK7A 4MD7A 2R92I 1ZH1A 3CCV1 1YI2Z 4TNUA 2QLVB 1WW9A 5D1OA 3G6EZ 3I4NI 1VQ61 1VQO1 3I561 1WJ2A 2VUGA 3MONA 2JA6I 3GTJI 3NH4A 1VQ5Z 3CME1 1RO0A 3G71Z 1Q7Y1 2I3CA 2GU2A 4NBCA 5FLMI 2LIYA 1VQM1 1YHQZ 1RO4A 2OOYB 4MXUA 1VQL1 4E32A 3Q87A 3OW2Z 1X3WA 1RO2A 1Y1VI 3D2LA 4E2YA 4A3FI 1Q16A 3G4SZ 2E2JI 4A3GI 1Y8CA 2PMZA 3CCR1 3KIHA 3PO3I 2KI7B 4E2WA 2JUBA 4RVFA 5A2Qf 2JA5I 3GTMI 2ZAEB 1Y1WI 1NJI2 3S17I 4S1TA 3CMAZ 4A3BI 1VQ41 2F4MA 1KQSY 4QTTA 3D9XA 1YI21 2QR1B 3G6E1 2IZ3A 2Y0SA 2Q51A 1VQ9Z 2JA7I 2NVXI 1S72Z 3J80b 3GTKI 3FQMA 3CCVZ 4DK1A 3M4OI 3CCM1 2W03A 1VQ6Z 2JNYA 2R6MA 3NFZA 4RVDA 3I56Z 3G711 4A3LI 4A3JI 2JIPA 4RV9A 2E7ZA 3NDJA 4HH4A 1VQ7Z 1K731 4NH1C 5IT9b 3CMEZ 1AA6A 5FLXf 4NBGA 2HU9A 4NBBA 3G4S1 3S1MI 1YIJZ 3MZLB 4BY7I 1N8R2 3NDIA 3ESWA 3GTPI 1LQLA 3NH5A 2NAPA 1M1K1 3IR7A 4E33A 3CMA1 1KQSZ 4MH4A 3CCRZ 1FDIA 1NUIA 2E2HI 1VQP1 1YUAA 3FKII 2AKLA 2P3YA 1VQ91 3J81b 1X0TA 3GTLI 1RNIA 2VPWA 2JIMA 3HKZA 1YJW1 4BBRI 3CQZI 3P5JB 5T67A 1KC81 3S1RI 3I07A 2BJOA 2V8JA 3PO3S 1Q811 1QXFA 3CCL1 1VQ71 3CCJZ 5CM2M 3GTMS 3CCMZ 2M48A 2EGTA 3GTQI 1I6HI 3CC7Z 3LUSA 3D6WA 5IP7I 1Z03A 4XX2A 1YIJ1 5C4JI 2OOXB 2OTJ1 3IFUA 4NBFA 4NB8A 1Z01A 2QA4Z 2VPXA 3PO2I 2OZKA 2P28A 4HGZA 3RZDI 1KD11 3VMIA 1QF8A 5T64A 4EWCA 3EEDA 1L1OC 1WIIA 2RHBA 1Z02A 3CCEZ 1Q821 1YJ9Z 1ML8A 1PFTA 2QRCB 2G2KA 2JR6A 2JA8I 3TE5B 3VB9A 2V45A 5C44I 3U50C 1QYPA 2VPZA 3HOVI 3S2HI 3QWUA 1VQPZ 5A2Qb 1KRLA 3MZKB 1VLAA 4AYBA 1SIWA 3TDHB 2O53A 3VMGA 3JAMf 3CCUZ 1WZNA 4A3II 3KIFA 2HF1A 3EERA 3S16I 2QEXZ 2H85A 2IZ4A 1FDOA 3CCJ1 1YJWZ 4CL1A 1N2FA 1USPB 3J7A4 3J80f 2DE6A 3CC71 1M1K2 4RVHA 4A3CI 3CCLZ 3HOWI 2QA41 3S14I 1USPA 3I551 3CC41 4DQYB 1NJI1 1YUKA 1TWFI 2RPRA 2QREB 2OTJZ 3CCE1 3CC21 1SFOI 1YJ91 2JIQA 4RS4A 2GTHA 2R93I 3BG0B 4A3EI 1QVFY 4NB9A 4E30A 3IX0A 2JMOA 4NBEA 1DL6A 4NBAA 3GTGI 1KC82 2LFUA 2OTL1 4MD9A 5IP9I 1Q812 3F3PC 3GKQA 2GTIA 1K9M1 3I4MI 4MD8A 3CPWY 3CCU1 1JJ2Y 1K8A1 2KPIA 1RQFA 3OW2Y 1Q7Y2 1S7MA 2QEX1 1K83I 4Y52I 5D1PA 3HOYI 2M6NA 1JWHC 1Q861 1M901 3CD61 2VPYA 1KD12 4BY1I 3H0GI 3S2DI 4BBSI 4HGYA 1Q822 2JS4A 1X3ZA 2K5RA 3HOXI 1YITZ 1YJN1 2O4HA 2R7ZI 5LL6f 4DGLA 3FQQA 2LEXA 2JIOA 3CXCY 2NVQI 1QVFZ 3S15I 1VQK1 3I55Z 3CC4Z 2RBLA 2WAQA 3T4NB 1WCMI 5C3EI 1VQ8Z 2E2II 2DE5A 3K7AI 4E2ZA 1TWGI 3CC2Z 2W04A 3VTNA 4Y7NI 3CCSZ 2VF1A 3BG1B 3CCQZ 3CPWZ 1TWAI 4MONA 1JJ2Z 4X6AI 1P9NA 5T6BA 2JIRA 2PM9A 1R9TI 1NP6A 2F4OA 2OTLZ 2VUMI 1RLYA 4A93I 3RZOI 2DE7A 1TWHI 2RIQA 3S1QI 4NBHA 1K732 4NFRA 4NBDA 5AN9F 4MRIA 3JAMb 1YIT1
chains in the Genus database with same CATH topology
3CD6Z 2NVYI 3CXCZ 1VQNZ 3NH8A 2V8IA 1W2BY 2QRDB 1YJNZ 4NOZA 2QKDA 1VQ51 1QVGY 1TFIA 1VQ81 5IT9f 1K9M2 2RT9A 2V8KA 1VQOZ 3H3VJ 2NVTI 1VQKZ 1I50I 5FLXb 1K8A2 3CCS1 3CCQ1 4E2XA 2WB1A 4A3KI 1YHQ1 1ZB8A 3HOUI 4A3MI 2E9HA 1Q862 2J6AA 1M902 5C4XI 1VQMZ 1VQLZ 4RVGA 2YADA 1I3QI 4E31A 1ZB9A 2Q4ZA 3IF8A 2K3RA 3VMHA 3F3FC 2YU9I 3J81f 3M3YI 3HOZI 1TWCI 4A3DI 2B63I 4BXXI 5D1OB 1W2BZ 1VQN1 1VQ4Z 1N8R1 1S721 3GCFA 4QTUA 1QVGZ 3S1NI 3GTOI 1Y1VS 2PK7A 4MD7A 2R92I 1ZH1A 3CCV1 1YI2Z 4TNUA 2QLVB 1WW9A 5D1OA 3G6EZ 3I4NI 1VQ61 1VQO1 3I561 2VUGA 3MONA 2JA6I 3GTJI 3NH4A 1VQ5Z 3CME1 1RO0A 3G71Z 1Q7Y1 2I3CA 2GU2A 4NBCA 5FLMI 2LIYA 1VQM1 1YHQZ 1RO4A 2OOYB 4MXUA 1VQL1 4E32A 3Q87A 3OW2Z 1X3WA 1RO2A 1Y1VI 4E2YA 4A3FI 3G4SZ 2E2JI 4A3GI 2PMZA 3CCR1 3KIHA 3PO3I 2KI7B 4E2WA 2JUBA 4RVFA 5A2Qf 2JA5I 3GTMI 2ZAEB 1Y1WI 1NJI2 3S17I 4S1TA 3CMAZ 4A3BI 1VQ41 2F4MA 1KQSY 4QTTA 3D9XA 1YI21 2QR1B 3G6E1 2IZ3A 2Y0SA 2Q51A 1VQ9Z 2JA7I 2NVXI 1S72Z 3J80b 3GTKI 3FQMA 3CCVZ 4DK1A 3M4OI 3CCM1 2W03A 1VQ6Z 2JNYA 2R6MA 3NFZA 4RVDA 3I56Z 3G711 4A3LI 4A3JI 4RV9A 3NDJA 4HH4A 1VQ7Z 1K731 4NH1C 5IT9b 3CMEZ 5FLXf 4NBGA 2HU9A 4NBBA 3G4S1 3S1MI 1YIJZ 3MZLB 4BY7I 1N8R2 3NDIA 3ESWA 3GTPI 1LQLA 3NH5A 1M1K1 4E33A 3CMA1 1KQSZ 4MH4A 3CCRZ 1NUIA 2E2HI 1VQP1 1YUAA 3FKII 2AKLA 2P3YA 1VQ91 3J81b 1X0TA 3GTLI 1RNIA 3HKZA 1YJW1 4BBRI 3CQZI 3P5JB 5T67A 1KC81 3S1RI 3I07A 2BJOA 2V8JA 3PO3S 1Q811 3CCL1 1VQ71 3CCJZ 5CM2M 3GTMS 3CCMZ 2M48A 2EGTA 3GTQI 1I6HI 3CC7Z 3LUSA 3D6WA 5IP7I 1Z03A 4XX2A 1YIJ1 5C4JI 2OOXB 2OTJ1 3IFUA 4NBFA 4NB8A 1Z01A 2QA4Z 3PO2I 2OZKA 2P28A 4HGZA 3RZDI 1KD11 3VMIA 1QF8A 5T64A 4EWCA 3EEDA 1L1OC 1WIIA 2RHBA 1Z02A 3CCEZ 1Q821 1YJ9Z 1ML8A 1PFTA 2QRCB 2G2KA 2JR6A 2JA8I 3TE5B 3VB9A 5C44I 3U50C 1QYPA 3HOVI 3S2HI 3QWUA 1VQPZ 5A2Qb 1KRLA 3MZKB 1VLAA 4AYBA 3TDHB 2O53A 3VMGA 3JAMf 3CCUZ 4A3II 3KIFA 2HF1A 3EERA 3S16I 2QEXZ 2H85A 2IZ4A 3CCJ1 1YJWZ 4CL1A 1N2FA 1USPB 3J7A4 3J80f 2DE6A 3CC71 1M1K2 4RVHA 4A3CI 3CCLZ 3HOWI 2QA41 3S14I 1USPA 3I551 3CC41 4DQYB 1NJI1 1YUKA 1TWFI 2RPRA 2QREB 2OTJZ 3CCE1 3CC21 1SFOI 1YJ91 4RS4A 2GTHA 2R93I 3BG0B 4A3EI 1QVFY 4NB9A 4E30A 3IX0A 2JMOA 4NBEA 1DL6A 4NBAA 3GTGI 1KC82 2LFUA 2OTL1 4MD9A 5IP9I 1Q812 3F3PC 3GKQA 2GTIA 1K9M1 3I4MI 4MD8A 3CPWY 3CCU1 1JJ2Y 1K8A1 2KPIA 1RQFA 3OW2Y 1Q7Y2 1S7MA 2QEX1 1K83I 4Y52I 5D1PA 3HOYI 2M6NA 1JWHC 1Q861 1M901 3CD61 1KD12 4BY1I 3H0GI 3S2DI 4BBSI 4HGYA 1Q822 2JS4A 1X3ZA 2K5RA 3HOXI 1YITZ 1YJN1 2O4HA 2R7ZI 5LL6f 4DGLA 3FQQA 3CXCY 2NVQI 1QVFZ 3S15I 1VQK1 3I55Z 3CC4Z 2RBLA 2WAQA 3T4NB 1WCMI 5C3EI 1VQ8Z 2E2II 2DE5A 3K7AI 4E2ZA 1TWGI 3CC2Z 2W04A 3VTNA 4Y7NI 3CCSZ 2VF1A 3BG1B 3CCQZ 3CPWZ 1TWAI 4MONA 1JJ2Z 4X6AI 1P9NA 5T6BA 2PM9A 1R9TI 1NP6A 2F4OA 2OTLZ 2VUMI 1RLYA 4A93I 3RZOI 2DE7A 1TWHI 2RIQA 3S1QI 4NBHA 1K732 4NFRA 4NBDA 5AN9F 4MRIA 3JAMb 1YIT1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3E I;  3Q87 A;  4NB9 A;  1X3W A;  1Y1V I;  2NVY I;  4NBE A;  4BBR I;  3CQZ I;  1DL6 A;  3S1R I;  3I07 A;  4NBA A;  2BJO A;  4A3F I;  3GTG I;  3PO3 S;  2E2J I;  4A3G I;  3PO3 I;  5IP9 I;  5CM2 M;  3GTM S;  3GKQ A;  4NOZ A;  3I4M I;  2JA5 I;  3GTM I;  1TFI A;  3GTQ I;  1I6H I;  1Y1W I;  3LUS A;  3S17 I;  3D6W A;  5IP7 I;  2KPI A;  4XX2 A;  3H3V J;  4A3B I;  2NVT I;  5C4J I;  1I50 I;  4Y52 I;  1K83 I;  4NB8 A;  4NBF A;  3PO2 I;  3HOY I;  2F4M A;  4A3K I;  4QTT A;  3RZD I;  1ZB8 A;  3HOU I;  3VMI A;  4A3M I;  2J6A A;  4BY1 I;  3H0G I;  1L1O C;  2JA7 I;  3S2D I;  2NVX I;  4BBS I;  3GTK I;  5C4X I;  1ML8 A;  1PFT A;  2JS4 A;  1X3Z A;  2JR6 A;  2K5R A;  3HOX I;  2JA8 I;  3M4O I;  2R7Z I;  3VB9 A;  1I3Q I;  5C44 I;  1ZB9 A;  1QYP A;  2JNY A;  3U50 C;  4A3L I;  3HOV I;  3S2H I;  2NVQ I;  4A3J I;  3VMH A;  3S15 I;  2YU9 I;  3M3Y I;  3HOZ I;  1VLA A;  2RBL A;  1TWC I;  1WCM I;  3VMG A;  2B63 I;  4A3D I;  5C3E I;  4BXX I;  4NBG A;  2DE5 A;  3K7A I;  2E2I I;  4NBB A;  1TWG I;  4A3I I;  2HF1 A;  3EER A;  3S16 I;  3S1M I;  4Y7N I;  4BY7 I;  3GCF A;  4QTU A;  3ESW A;  3GTP I;  3S1N I;  1LQL A;  3GTO I;  1TWA I;  1N2F A;  1Y1V S;  2PK7 A;  1USP B;  2R92 I;  4X6A I;  1WW9 A;  2DE6 A;  3I4N I;  1R9T I;  4A3C I;  2F4O A;  4MH4 A;  2VUM I;  1RLY A;  3HOW I;  4A93 I;  3RZO I;  1NUI A;  2DE7 A;  1TWH I;  2E2H I;  2JA6 I;  3GTJ I;  3S14 I;  3S1Q I;  1YUA A;  1USP A;  4NBH A;  3FKI I;  2AKL A;  2P3Y A;  1TWF I;  4NBD A;  1SFO I;  3GTL I;  4NBC A;  5FLM I;  1RO4 A;  2R93 I; 
#chains in the Genus database with same CATH topology
 3CD6 Z;  2NVY I;  3CXC Z;  1VQN Z;  3NH8 A;  2V8I A;  1W2B Y;  2QRD B;  1YJN Z;  4NOZ A;  2QKD A;  1VQ5 1;  1QVG Y;  1TFI A;  1VQ8 1;  5IT9 f;  1K9M 2;  2RT9 A;  2V8K A;  1VQO Z;  3H3V J;  2NVT I;  1VQK Z;  1I50 I;  5FLX b;  1K8A 2;  3CCS 1;  3CCQ 1;  2AYD A;  4E2X A;  2WB1 A;  4A3K I;  1YHQ 1;  1ZB8 A;  3HOU I;  4A3M I;  2E9H A;  1Q86 2;  2V3V A;  2J6A A;  1M90 2;  2IV2 X;  5C4X I;  1VQM Z;  1VQL Z;  4RVG A;  2YAD A;  1I3Q I;  4E31 A;  1ZB9 A;  2Q4Z A;  3IF8 A;  2K3R A;  3VMH A;  3F3F C;  2YU9 I;  3J81 f;  3M3Y I;  3HOZ I;  1TWC I;  4A3D I;  2B63 I;  4BXX I;  5D1O B;  1W2B Z;  1VQN 1;  1VQ4 Z;  1N8R 1;  1S72 1;  3GCF A;  4QTU A;  1QVG Z;  3S1N I;  3GTO I;  1Y1V S;  2PK7 A;  4MD7 A;  2R92 I;  1ZH1 A;  3CCV 1;  1YI2 Z;  4TNU A;  2QLV B;  1WW9 A;  5D1O A;  3G6E Z;  3I4N I;  1VQ6 1;  1VQO 1;  3I56 1;  1WJ2 A;  2VUG A;  3MON A;  2JA6 I;  3GTJ I;  3NH4 A;  1VQ5 Z;  3CME 1;  1RO0 A;  3G71 Z;  1Q7Y 1;  2I3C A;  2GU2 A;  4NBC A;  5FLM I;  2LIY A;  1VQM 1;  1YHQ Z;  1RO4 A;  2OOY B;  4MXU A;  1VQL 1;  4E32 A;  3Q87 A;  3OW2 Z;  1X3W A;  1RO2 A;  1Y1V I;  3D2L A;  4E2Y A;  4A3F I;  1Q16 A;  3G4S Z;  2E2J I;  4A3G I;  1Y8C A;  2PMZ A;  3CCR 1;  3KIH A;  3PO3 I;  2KI7 B;  4E2W A;  2JUB A;  4RVF A;  5A2Q f;  2JA5 I;  3GTM I;  2ZAE B;  1Y1W I;  1NJI 2;  3S17 I;  4S1T A;  3CMA Z;  4A3B I;  1VQ4 1;  2F4M A;  1KQS Y;  4QTT A;  3D9X A;  1YI2 1;  2QR1 B;  3G6E 1;  2IZ3 A;  2Y0S A;  2Q51 A;  1VQ9 Z;  2JA7 I;  2NVX I;  1S72 Z;  3J80 b;  3GTK I;  3FQM A;  3CCV Z;  4DK1 A;  3M4O I;  3CCM 1;  2W03 A;  1VQ6 Z;  2JNY A;  2R6M A;  3NFZ A;  4RVD A;  3I56 Z;  3G71 1;  4A3L I;  4A3J I;  2JIP A;  4RV9 A;  2E7Z A;  3NDJ A;  4HH4 A;  1VQ7 Z;  1K73 1;  4NH1 C;  5IT9 b;  3CME Z;  1AA6 A;  5FLX f;  4NBG A;  2HU9 A;  4NBB A;  3G4S 1;  3S1M I;  1YIJ Z;  3MZL B;  4BY7 I;  1N8R 2;  3NDI A;  3ESW A;  3GTP I;  1LQL A;  3NH5 A;  2NAP A;  1M1K 1;  3IR7 A;  4E33 A;  3CMA 1;  1KQS Z;  4MH4 A;  3CCR Z;  1FDI A;  1NUI A;  2E2H I;  1VQP 1;  1YUA A;  3FKI I;  2AKL A;  2P3Y A;  1VQ9 1;  3J81 b;  1X0T A;  3GTL I;  1RNI A;  2VPW A;  2JIM A;  3HKZ A;  1YJW 1;  4BBR I;  3CQZ I;  3P5J B;  5T67 A;  1KC8 1;  3S1R I;  3I07 A;  2BJO A;  2V8J A;  3PO3 S;  1Q81 1;  1QXF A;  3CCL 1;  1VQ7 1;  3CCJ Z;  5CM2 M;  3GTM S;  3CCM Z;  2M48 A;  2EGT A;  3GTQ I;  1I6H I;  3CC7 Z;  3LUS A;  3D6W A;  5IP7 I;  1Z03 A;  4XX2 A;  1YIJ 1;  5C4J I;  2OOX B;  2OTJ 1;  3IFU A;  4NBF A;  4NB8 A;  1Z01 A;  2QA4 Z;  2VPX A;  3PO2 I;  2OZK A;  2P28 A;  4HGZ A;  3RZD I;  1KD1 1;  3VMI A;  1QF8 A;  5T64 A;  4EWC A;  3EED A;  1L1O C;  1WII A;  2RHB A;  1Z02 A;  3CCE Z;  1Q82 1;  1YJ9 Z;  1ML8 A;  1PFT A;  2QRC B;  2G2K A;  2JR6 A;  2JA8 I;  3TE5 B;  3VB9 A;  2V45 A;  5C44 I;  3U50 C;  1QYP A;  2VPZ A;  3HOV I;  3S2H I;  3QWU A;  1VQP Z;  5A2Q b;  1KRL A;  3MZK B;  1VLA A;  4AYB A;  1SIW A;  3TDH B;  2O53 A;  3VMG A;  3JAM f;  3CCU Z;  1WZN A;  4A3I I;  3KIF A;  2HF1 A;  3EER A;  3S16 I;  2QEX Z;  2H85 A;  2IZ4 A;  1FDO A;  3CCJ 1;  1YJW Z;  4CL1 A;  1N2F A;  1USP B;  3J7A 4;  3J80 f;  2DE6 A;  3CC7 1;  1M1K 2;  4RVH A;  4A3C I;  3CCL Z;  3HOW I;  2QA4 1;  3S14 I;  1USP A;  3I55 1;  3CC4 1;  4DQY B;  1NJI 1;  1YUK A;  1TWF I;  2RPR A;  2QRE B;  2OTJ Z;  3CCE 1;  3CC2 1;  1SFO I;  1YJ9 1;  2JIQ A;  4RS4 A;  2GTH A;  2R93 I;  3BG0 B;  4A3E I;  1QVF Y;  4NB9 A;  4E30 A;  3IX0 A;  2JMO A;  4NBE A;  1DL6 A;  4NBA A;  3GTG I;  1KC8 2;  2LFU A;  2OTL 1;  4MD9 A;  5IP9 I;  1Q81 2;  3F3P C;  3GKQ A;  2GTI A;  1K9M 1;  3I4M I;  4MD8 A;  3CPW Y;  3CCU 1;  1JJ2 Y;  1K8A 1;  2KPI A;  1RQF A;  3OW2 Y;  1Q7Y 2;  1S7M A;  2QEX 1;  1K83 I;  4Y52 I;  5D1P A;  3HOY I;  2M6N A;  1JWH C;  1Q86 1;  1M90 1;  3CD6 1;  2VPY A;  1KD1 2;  4BY1 I;  3H0G I;  3S2D I;  4BBS I;  4HGY A;  1Q82 2;  2JS4 A;  1X3Z A;  2K5R A;  3HOX I;  1YIT Z;  1YJN 1;  2O4H A;  2R7Z I;  5LL6 f;  4DGL A;  3FQQ A;  2LEX A;  2JIO A;  3CXC Y;  2NVQ I;  1QVF Z;  3S15 I;  1VQK 1;  3I55 Z;  3CC4 Z;  2RBL A;  2WAQ A;  3T4N B;  1WCM I;  5C3E I;  1VQ8 Z;  2E2I I;  2DE5 A;  3K7A I;  4E2Z A;  1TWG I;  3CC2 Z;  2W04 A;  3VTN A;  4Y7N I;  3CCS Z;  2VF1 A;  3BG1 B;  3CCQ Z;  3CPW Z;  1TWA I;  4MON A;  1JJ2 Z;  4X6A I;  1P9N A;  5T6B A;  2JIR A;  2PM9 A;  1R9T I;  1NP6 A;  2F4O A;  2OTL Z;  2VUM I;  1RLY A;  4A93 I;  3RZO I;  2DE7 A;  1TWH I;  2RIQ A;  3S1Q I;  4NBH A;  1K73 2;  4NFR A;  4NBD A;  5AN9 F;  4MRI A;  3JAM b;  1YIT 1; 
#chains in the Genus database with same CATH homology
 3CD6 Z;  2NVY I;  3CXC Z;  1VQN Z;  3NH8 A;  2V8I A;  1W2B Y;  2QRD B;  1YJN Z;  4NOZ A;  2QKD A;  1VQ5 1;  1QVG Y;  1TFI A;  1VQ8 1;  5IT9 f;  1K9M 2;  2RT9 A;  2V8K A;  1VQO Z;  3H3V J;  2NVT I;  1VQK Z;  1I50 I;  5FLX b;  1K8A 2;  3CCS 1;  3CCQ 1;  4E2X A;  2WB1 A;  4A3K I;  1YHQ 1;  1ZB8 A;  3HOU I;  4A3M I;  2E9H A;  1Q86 2;  2J6A A;  1M90 2;  5C4X I;  1VQM Z;  1VQL Z;  4RVG A;  2YAD A;  1I3Q I;  4E31 A;  1ZB9 A;  2Q4Z A;  3IF8 A;  2K3R A;  3VMH A;  3F3F C;  2YU9 I;  3J81 f;  3M3Y I;  3HOZ I;  1TWC I;  4A3D I;  2B63 I;  4BXX I;  5D1O B;  1W2B Z;  1VQN 1;  1VQ4 Z;  1N8R 1;  1S72 1;  3GCF A;  4QTU A;  1QVG Z;  3S1N I;  3GTO I;  1Y1V S;  2PK7 A;  4MD7 A;  2R92 I;  1ZH1 A;  3CCV 1;  1YI2 Z;  4TNU A;  2QLV B;  1WW9 A;  5D1O A;  3G6E Z;  3I4N I;  1VQ6 1;  1VQO 1;  3I56 1;  2VUG A;  3MON A;  2JA6 I;  3GTJ I;  3NH4 A;  1VQ5 Z;  3CME 1;  1RO0 A;  3G71 Z;  1Q7Y 1;  2I3C A;  2GU2 A;  4NBC A;  5FLM I;  2LIY A;  1VQM 1;  1YHQ Z;  1RO4 A;  2OOY B;  4MXU A;  1VQL 1;  4E32 A;  3Q87 A;  3OW2 Z;  1X3W A;  1RO2 A;  1Y1V I;  4E2Y A;  4A3F I;  3G4S Z;  2E2J I;  4A3G I;  2PMZ A;  3CCR 1;  3KIH A;  3PO3 I;  2KI7 B;  4E2W A;  2JUB A;  4RVF A;  5A2Q f;  2JA5 I;  3GTM I;  2ZAE B;  1Y1W I;  1NJI 2;  3S17 I;  4S1T A;  3CMA Z;  4A3B I;  1VQ4 1;  2F4M A;  1KQS Y;  4QTT A;  3D9X A;  1YI2 1;  2QR1 B;  3G6E 1;  2IZ3 A;  2Y0S A;  2Q51 A;  1VQ9 Z;  2JA7 I;  2NVX I;  1S72 Z;  3J80 b;  3GTK I;  3FQM A;  3CCV Z;  4DK1 A;  3M4O I;  3CCM 1;  2W03 A;  1VQ6 Z;  2JNY A;  2R6M A;  3NFZ A;  4RVD A;  3I56 Z;  3G71 1;  4A3L I;  4A3J I;  4RV9 A;  3NDJ A;  4HH4 A;  1VQ7 Z;  1K73 1;  4NH1 C;  5IT9 b;  3CME Z;  5FLX f;  4NBG A;  2HU9 A;  4NBB A;  3G4S 1;  3S1M I;  1YIJ Z;  3MZL B;  4BY7 I;  1N8R 2;  3NDI A;  3ESW A;  3GTP I;  1LQL A;  3NH5 A;  1M1K 1;  4E33 A;  3CMA 1;  1KQS Z;  4MH4 A;  3CCR Z;  1NUI A;  2E2H I;  1VQP 1;  1YUA A;  3FKI I;  2AKL A;  2P3Y A;  1VQ9 1;  3J81 b;  1X0T A;  3GTL I;  1RNI A;  3HKZ A;  1YJW 1;  4BBR I;  3CQZ I;  3P5J B;  5T67 A;  1KC8 1;  3S1R I;  3I07 A;  2BJO A;  2V8J A;  3PO3 S;  1Q81 1;  3CCL 1;  1VQ7 1;  3CCJ Z;  5CM2 M;  3GTM S;  3CCM Z;  2M48 A;  2EGT A;  3GTQ I;  1I6H I;  3CC7 Z;  3LUS A;  3D6W A;  5IP7 I;  1Z03 A;  4XX2 A;  1YIJ 1;  5C4J I;  2OOX B;  2OTJ 1;  3IFU A;  4NBF A;  4NB8 A;  1Z01 A;  2QA4 Z;  3PO2 I;  2OZK A;  2P28 A;  4HGZ A;  3RZD I;  1KD1 1;  3VMI A;  1QF8 A;  5T64 A;  4EWC A;  3EED A;  1L1O C;  1WII A;  2RHB A;  1Z02 A;  3CCE Z;  1Q82 1;  1YJ9 Z;  1ML8 A;  1PFT A;  2QRC B;  2G2K A;  2JR6 A;  2JA8 I;  3TE5 B;  3VB9 A;  5C44 I;  3U50 C;  1QYP A;  3HOV I;  3S2H I;  3QWU A;  1VQP Z;  5A2Q b;  1KRL A;  3MZK B;  1VLA A;  4AYB A;  3TDH B;  2O53 A;  3VMG A;  3JAM f;  3CCU Z;  4A3I I;  3KIF A;  2HF1 A;  3EER A;  3S16 I;  2QEX Z;  2H85 A;  2IZ4 A;  3CCJ 1;  1YJW Z;  4CL1 A;  1N2F A;  1USP B;  3J7A 4;  3J80 f;  2DE6 A;  3CC7 1;  1M1K 2;  4RVH A;  4A3C I;  3CCL Z;  3HOW I;  2QA4 1;  3S14 I;  1USP A;  3I55 1;  3CC4 1;  4DQY B;  1NJI 1;  1YUK A;  1TWF I;  2RPR A;  2QRE B;  2OTJ Z;  3CCE 1;  3CC2 1;  1SFO I;  1YJ9 1;  4RS4 A;  2GTH A;  2R93 I;  3BG0 B;  4A3E I;  1QVF Y;  4NB9 A;  4E30 A;  3IX0 A;  2JMO A;  4NBE A;  1DL6 A;  4NBA A;  3GTG I;  1KC8 2;  2LFU A;  2OTL 1;  4MD9 A;  5IP9 I;  1Q81 2;  3F3P C;  3GKQ A;  2GTI A;  1K9M 1;  3I4M I;  4MD8 A;  3CPW Y;  3CCU 1;  1JJ2 Y;  1K8A 1;  2KPI A;  1RQF A;  3OW2 Y;  1Q7Y 2;  1S7M A;  2QEX 1;  1K83 I;  4Y52 I;  5D1P A;  3HOY I;  2M6N A;  1JWH C;  1Q86 1;  1M90 1;  3CD6 1;  1KD1 2;  4BY1 I;  3H0G I;  3S2D I;  4BBS I;  4HGY A;  1Q82 2;  2JS4 A;  1X3Z A;  2K5R A;  3HOX I;  1YIT Z;  1YJN 1;  2O4H A;  2R7Z I;  5LL6 f;  4DGL A;  3FQQ A;  3CXC Y;  2NVQ I;  1QVF Z;  3S15 I;  1VQK 1;  3I55 Z;  3CC4 Z;  2RBL A;  2WAQ A;  3T4N B;  1WCM I;  5C3E I;  1VQ8 Z;  2E2I I;  2DE5 A;  3K7A I;  4E2Z A;  1TWG I;  3CC2 Z;  2W04 A;  3VTN A;  4Y7N I;  3CCS Z;  2VF1 A;  3BG1 B;  3CCQ Z;  3CPW Z;  1TWA I;  4MON A;  1JJ2 Z;  4X6A I;  1P9N A;  5T6B A;  2PM9 A;  1R9T I;  1NP6 A;  2F4O A;  2OTL Z;  2VUM I;  1RLY A;  4A93 I;  3RZO I;  2DE7 A;  1TWH I;  2RIQ A;  3S1Q I;  4NBH A;  1K73 2;  4NFR A;  4NBD A;  5AN9 F;  4MRI A;  3JAM b;  1YIT 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...