3CCM1

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccm100
1VQ9Z 1KQSZ 1YHQZ 1VQK1 3CCRZ 1YI21 3CCLZ 3CPWY 1M1K1 1VQ5Z 3CC2Z 2QEXZ 1YJWZ 1VQM1 1YJNZ 1K9M2 1VQ7Z 1Q811 3CCVZ 1Q861 3I56Z 3CD61 3CCMZ 3I551 1KD11 1N8R1 3CCS1 1VQO1 1QVFY 1S721 1VQPZ 3G4S1 1Q7Y1 1VQ6Z 2OTL1 1YIT1 3G6E1 1YIJ1 3G711 1VQ91 1NJI2 2OTJZ 3CMAZ 3CCR1 3CCL1 1KQSY 1VQ51 1KC81 3CCE1 2QEX1 3CC21 1YJW1 3CMEZ 1M901 1VQ71 3CCV1 3I561 3CC7Z 3CCM1 1K8A1 3CCUZ 1K731 3CCQZ 1YJ91 3CC4Z 1VQ8Z 1QVGZ 1VQP1 1JJ2Z 1K9M1 3CXCZ 1VQ61 3CMA1 1YHQ1 1VQ4Z 1YJN1 1Q822 3CCU1 1VQLZ 3OW2Z 3CCSZ 3CCJZ 1NJI1 3CCQ1 1S72Z 3CC41 1VQ81 2QA4Z 1Q812 1Q862 1W2BZ 1QVGY 3CPWZ 1VQNZ 1KD12 1JJ2Y 1N8R2 1VQKZ 3CXCY 1YI2Z 2OTJ1 3CCEZ 1VQ41 1VQMZ 1Q7Y2 3CME1 3CD6Z 1QVFZ 3I55Z 1VQL1 3CC71 3CCJ1 1VQOZ 1YJ9Z 1KC82 1M1K2 3OW2Y 1M902 2QA41 3G4SZ 1Q821 1K8A2 1VQN1 2OTLZ 1K732 1W2BY 1YITZ 3G6EZ 1YIJZ 3G71Z
chains in the Genus database with same CATH superfamily
1YHQZ 1X3WA 3CPWY 3VMIA 4A3KI 3GTLI 2VUMI 1VQ5Z 4RVFA 2QEXZ 3CC2Z 1ZB8A 2JIOA 4NBBA 4MH4A 1Q811 3CCVZ 4RS4A 4HH4A 3S14I 1R9TI 3CCS1 2JIRA 2QRDB 3KIFA 2GU2A 3GTQI 5C3EI 1Q7Y1 3GTKI 3T4NB 3JAMf 3MZLB 2F4MA 3G711 2NAPA 3J80b 2QKDA 3CCR1 3CCL1 3CCE1 1YJW1 2VPWA 2DE7A 1VQ71 1I3QI 5D1OB 3CCM1 1K8A1 2G2KA 4NBGA 3I07A 1YJ91 1RO0A 1Z03A 2QRCB 4E2ZA 1VQP1 1JJ2Z 2R6MA 3S1RI 3RZDI 3MONA 2JS4A 1YHQ1 3U50C 1Q822 5FLMI 2E2HI 3S17I 2KI7B 4XX2A 2JIPA 3CC41 1VQ81 1Y1VS 1JJ2Y 3NH5A 1FDOA 2PM9A 5C4JI 1SFOI 3RZOI 3S2DI 5T67A 1VQ41 2K3RA 1RNIA 1WJ2A 5CM2M 4BY7I 3HOYI 2GTHA 4RVHA 1KC82 5D1OA 1M902 4A93I 3GTMS 2R93I 5C4XI 3CQZI 2P28A 1Q821 1VQN1 2NVQI 1K732 3G71Z 1KQSZ 3CCRZ 3CCLZ 1YJWZ 3S1QI 4MRIA 1YJNZ 1K9M2 1VQ7Z 2NVTI 1Y1VI 5T64A 3CCMZ 3NH4A 3I551 2V3VA 4E31A 1TWFI 1KRLA 2ZAEB 1VQPZ 4BXXI 1RO4A 2NVYI 4E2YA 2JA6I 2OTL1 2R92I 2OTJZ 1P9NA 3IF8A 5AN9F 2VPZA 1I50I 1KQSY 1KC81 3HOZI 5A2Qf 1QYPA 1M901 2V8JA 4DGLA 3GTMI 2Y0SA 3TE5B 3EERA 1K731 3P5JB 4NBCA 1RLYA 1TWAI 3CC4Z 4QTTA 1VQ8Z 3LUSA 1QVGZ 3GKQA 2IZ4A 1K9M1 2OOYB 3CXCZ 3F3PC 4A3FI 1WZNA 1VQ4Z 2WAQA 5LL6f 1RQFA 1ML8A 2E7ZA 1YJN1 3ESWA 4MXUA 3H3VJ 3IR7A 4A3GI 3NH8A 3CCQ1 3IFUA 4E30A 3J81b 2QR1B 1QVGY 4A3JI 3VTNA 4TNUA 1KD12 1VQNZ 1S7MA 4E32A 2RHBA 1N8R2 3CXCY 2OTJ1 4A3BI 4RVDA 2HU9A 4A3LI 3M4OI 2JUBA 2RPRA 3HKZA 1WIIA 3QWUA 2HF1A 3S2HI 3I55Z 1VQL1 4RV9A 4NBEA 5IT9f 2I3CA 4E33A 3TDHB 4QTUA 3F3FC 2V8KA 1ZH1A 2OTLZ 2M48A 1Y1WI 1VQK1 2VF1A 1RO2A 5IP7I 3H0GI 4Y52I 2J6AA 4NBHA 2Q4ZA 4BBSI 1Z01A 1NUIA 1X0TA 1L1OC 1KD11 4MONA 1N8R1 1VQO1 3IX0A 1K83I 3PO3S 2PMZA 1YUKA 2E2II 4CL1A 2JIMA 2JIQA 2NVXI 2F4OA 2YADA 3G6E1 4NH1C 4NFRA 1VQ91 1YIJ1 3NFZA 1WW9A 1DL6A 5D1PA 4NB8A 3GTOI 2RT9A 2VPXA 3I561 4NBDA 3CC7Z 4A3DI 4DQYB 1YUAA 2P3YA 1ZB9A 1NP6A 2K5RA 2OOXB 3NDJA 3CCQZ 3HOXI 3BG0B 4E2XA 1Q16A 3GCFA 4A3MI 2DE5A 2JR6A 1VQ61 1QF8A 4S1TA 4BBRI 2KPIA 3CMA1 2VUGA 4E2WA 2EGTA 2B63I 3JAMb 3PO3I 5FLXf 1USPA 4A3CI 2E9HA 3CCU1 4MD9A 1VQLZ 3EEDA 4NBFA 2RIQA 1S72Z 2W04A 1Q862 1W2BZ 1Z02A 2YU9I 3J7A4 3PO2I 1VQKZ 1QXFA 1SIWA 1PFTA 4HGYA 1TWCI 5T6BA 2JNYA 1QVFZ 2VPYA 3CC71 5IP9I 3CCJ1 1VQOZ 4RVGA 2V8IA 3S1NI 2AKLA 2QA41 2Q51A 5C44I 5IT9b 2WB1A 3HOWI 4DK1A 1W2BY 3G6EZ 1YIJZ 3I4NI 1VQ9Z 3MZKB 2H85A 1YI21 3FQQA 1M1K1 2IV2X 2LFUA 1VQM1 3VB9A 2RBLA 4A3EI 1Q861 3I56Z 3CD61 2JA8I 1JWHC 2GTIA 3GTGI 1QVFY 1S721 3J80f 3G4S1 2JA5I 1VQ6Z 1YIT1 1NJI2 4BY1I 3CMAZ 2R7ZI 1Y8CA 2JA7I 1VQ51 1USPB 2QEX1 3CC21 3FKII 3CMEZ 3VMHA 3CCV1 3I4MI 3CCUZ 3J81f 4A3II 3D9XA 2E2JI 4Y7NI 3S1MI 2O53A 4HGZA 1VLAA 1LQLA 3NDIA 1TFIA 3S15I 3HOVI 1N2FA 2DE6A 2IZ3A 3VMGA 2V45A 1FDIA 3HOUI 3FQMA 4MD8A 3OW2Z 3CCSZ 3CCJZ 1NJI1 5A2Qb 5FLXb 4NBAA 3KIHA 3M3YI 4AYBA 4X6AI 2AYDA 2QA4Z 1Q812 1X3ZA 2W03A 3CPWZ 2LIYA 1AA6A 2PK7A 2QREB 2BJOA 4NOZA 1YI2Z 2M6NA 3CCEZ 2LEXA 3K7AI 2O4HA 4NB9A 2QLVB 1VQMZ 1Q7Y2 3CME1 3GTJI 3CD6Z 4EWCA 2OZKA 2JMOA 1YJ9Z 3GTPI 1TWHI 3S16I 1M1K2 3OW2Y 3D2LA 4MD7A 3Q87A 3G4SZ 1WCMI 3D6WA 1TWGI 1K8A2 1I6HI 3BG1B 1YITZ
chains in the Genus database with same CATH topology
1YHQZ 1X3WA 3CPWY 3VMIA 4A3KI 3GTLI 2VUMI 1VQ5Z 4RVFA 2QEXZ 3CC2Z 1ZB8A 4NBBA 4MH4A 1Q811 3CCVZ 4RS4A 4HH4A 3S14I 1R9TI 3CCS1 2QRDB 3KIFA 2GU2A 3GTQI 5C3EI 1Q7Y1 3GTKI 3T4NB 3JAMf 3MZLB 2F4MA 3G711 3J80b 2QKDA 3CCR1 3CCL1 3CCE1 1YJW1 2DE7A 1VQ71 1I3QI 5D1OB 3CCM1 1K8A1 2G2KA 4NBGA 3I07A 1YJ91 1RO0A 1Z03A 2QRCB 4E2ZA 1VQP1 1JJ2Z 2R6MA 3S1RI 3RZDI 3MONA 2JS4A 1YHQ1 3U50C 1Q822 5FLMI 2E2HI 3S17I 2KI7B 4XX2A 3CC41 1VQ81 1Y1VS 1JJ2Y 3NH5A 2PM9A 5C4JI 1SFOI 3RZOI 3S2DI 5T67A 1VQ41 2K3RA 1RNIA 5CM2M 4BY7I 3HOYI 2GTHA 4RVHA 1KC82 5D1OA 1M902 4A93I 3GTMS 2R93I 5C4XI 3CQZI 2P28A 1Q821 1VQN1 2NVQI 1K732 3G71Z 1KQSZ 3CCRZ 3CCLZ 1YJWZ 3S1QI 4MRIA 1YJNZ 1K9M2 1VQ7Z 2NVTI 1Y1VI 5T64A 3CCMZ 3NH4A 3I551 4E31A 1TWFI 1KRLA 2ZAEB 1VQPZ 4BXXI 1RO4A 2NVYI 4E2YA 2JA6I 2OTL1 2R92I 2OTJZ 1P9NA 3IF8A 5AN9F 1KQSY 1I50I 3HOZI 1KC81 5A2Qf 1QYPA 1M901 2V8JA 4DGLA 3GTMI 2Y0SA 3TE5B 3EERA 1K731 3P5JB 4NBCA 1RLYA 1TWAI 3CC4Z 4QTTA 1VQ8Z 3LUSA 1QVGZ 3GKQA 2IZ4A 1K9M1 2OOYB 3CXCZ 3F3PC 4A3FI 1VQ4Z 2WAQA 5LL6f 1RQFA 1ML8A 3H3VJ 1YJN1 3ESWA 4MXUA 4A3GI 3NH8A 3CCQ1 3IFUA 4E30A 3J81b 2QR1B 1QVGY 4A3JI 3VTNA 4TNUA 1KD12 1VQNZ 1S7MA 4E32A 2RHBA 1N8R2 3CXCY 2OTJ1 4A3BI 4RVDA 2HU9A 4A3LI 3M4OI 2JUBA 2RPRA 3HKZA 1WIIA 3QWUA 2HF1A 3S2HI 3I55Z 1VQL1 4RV9A 4NBEA 5IT9f 2I3CA 4E33A 3TDHB 4QTUA 3F3FC 2V8KA 1ZH1A 2OTLZ 2M48A 1Y1WI 1VQK1 2VF1A 1RO2A 5IP7I 3H0GI 4Y52I 2J6AA 4NBHA 2Q4ZA 4BBSI 1Z01A 1NUIA 1X0TA 1L1OC 1KD11 4MONA 1N8R1 1VQO1 3IX0A 1K83I 3PO3S 2PMZA 1YUKA 2E2II 4CL1A 2NVXI 2F4OA 2YADA 4NH1C 3G6E1 4NFRA 1VQ91 1YIJ1 3NFZA 1WW9A 1DL6A 5D1PA 4NB8A 3GTOI 2RT9A 3I561 4NBDA 3CC7Z 4A3DI 4DQYB 1YUAA 2P3YA 1ZB9A 1NP6A 2K5RA 2OOXB 3NDJA 3CCQZ 3HOXI 3BG0B 4E2XA 3GCFA 4A3MI 2DE5A 2JR6A 1VQ61 1QF8A 4S1TA 4BBRI 2KPIA 3CMA1 2VUGA 4E2WA 2EGTA 2B63I 3JAMb 3PO3I 5FLXf 1USPA 4A3CI 2E9HA 3CCU1 4MD9A 1VQLZ 3EEDA 4NBFA 2RIQA 1S72Z 2W04A 1Q862 1W2BZ 1Z02A 2YU9I 3J7A4 3PO2I 1VQKZ 1PFTA 4HGYA 1TWCI 5T6BA 2JNYA 1QVFZ 3CC71 5IP9I 3CCJ1 1VQOZ 4RVGA 2V8IA 3S1NI 2AKLA 2QA41 2Q51A 5C44I 5IT9b 2WB1A 3HOWI 4DK1A 1W2BY 3G6EZ 1YIJZ 3I4NI 1VQ9Z 3MZKB 2H85A 1YI21 3FQQA 1M1K1 2LFUA 1VQM1 3VB9A 2RBLA 4A3EI 1Q861 3I56Z 3CD61 2JA8I 1JWHC 2GTIA 3GTGI 1QVFY 1S721 3J80f 3G4S1 2JA5I 1VQ6Z 1YIT1 1NJI2 4BY1I 3CMAZ 2R7ZI 2JA7I 1VQ51 1USPB 2QEX1 3CC21 3FKII 3CMEZ 3VMHA 3CCV1 3I4MI 3CCUZ 3J81f 4A3II 3D9XA 2E2JI 4Y7NI 3S1MI 2O53A 4HGZA 1VLAA 1LQLA 3NDIA 1TFIA 3S15I 3HOVI 1N2FA 2DE6A 2IZ3A 3VMGA 3HOUI 3FQMA 4MD8A 3OW2Z 3CCSZ 3CCJZ 1NJI1 5A2Qb 5FLXb 4NBAA 3KIHA 3M3YI 4AYBA 4X6AI 2QA4Z 1Q812 1X3ZA 2W03A 3CPWZ 2LIYA 2PK7A 2QREB 2BJOA 4NOZA 1YI2Z 2M6NA 3CCEZ 3K7AI 2O4HA 4NB9A 2QLVB 1VQMZ 1Q7Y2 3CME1 3GTJI 3CD6Z 4EWCA 2OZKA 2JMOA 1YJ9Z 3GTPI 1TWHI 3S16I 1M1K2 3OW2Y 4MD7A 3Q87A 3G4SZ 1WCMI 3D6WA 1TWGI 1K8A2 1I6HI 3BG1B 1YITZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ9 Z;  1KQS Z;  1YHQ Z;  1VQK 1;  3CCR Z;  1YI2 1;  3CCL Z;  3CPW Y;  1M1K 1;  1VQ5 Z;  3CC2 Z;  2QEX Z;  1YJW Z;  1VQM 1;  1YJN Z;  1K9M 2;  1VQ7 Z;  1Q81 1;  3CCV Z;  1Q86 1;  3I56 Z;  3CD6 1;  3CCM Z;  3I55 1;  1KD1 1;  1N8R 1;  3CCS 1;  1VQO 1;  1QVF Y;  1S72 1;  1VQP Z;  3G4S 1;  1Q7Y 1;  1VQ6 Z;  2OTL 1;  1YIT 1;  3G6E 1;  1YIJ 1;  3G71 1;  1VQ9 1;  1NJI 2;  2OTJ Z;  3CMA Z;  3CCR 1;  3CCL 1;  1KQS Y;  1VQ5 1;  1KC8 1;  3CCE 1;  2QEX 1;  3CC2 1;  1YJW 1;  3CME Z;  1M90 1;  1VQ7 1;  3CCV 1;  3I56 1;  3CC7 Z;  3CCM 1;  1K8A 1;  3CCU Z;  1K73 1;  3CCQ Z;  1YJ9 1;  3CC4 Z;  1VQ8 Z;  1QVG Z;  1VQP 1;  1JJ2 Z;  1K9M 1;  3CXC Z;  1VQ6 1;  3CMA 1;  1YHQ 1;  1VQ4 Z;  1YJN 1;  1Q82 2;  3CCU 1;  1VQL Z;  3OW2 Z;  3CCS Z;  3CCJ Z;  1NJI 1;  3CCQ 1;  1S72 Z;  3CC4 1;  1VQ8 1;  2QA4 Z;  1Q81 2;  1Q86 2;  1W2B Z;  1QVG Y;  3CPW Z;  1VQN Z;  1KD1 2;  1JJ2 Y;  1N8R 2;  1VQK Z;  3CXC Y;  1YI2 Z;  2OTJ 1;  3CCE Z;  1VQ4 1;  1VQM Z;  1Q7Y 2;  3CME 1;  3CD6 Z;  1QVF Z;  3I55 Z;  1VQL 1;  3CC7 1;  3CCJ 1;  1VQO Z;  1YJ9 Z;  1KC8 2;  1M1K 2;  3OW2 Y;  1M90 2;  2QA4 1;  3G4S Z;  1Q82 1;  1K8A 2;  1VQN 1;  2OTL Z;  1K73 2;  1W2B Y;  1YIT Z;  3G6E Z;  1YIJ Z;  3G71 Z; 
#chains in the Genus database with same CATH topology
 1YHQ Z;  1X3W A;  3CPW Y;  3VMI A;  4A3K I;  3GTL I;  2VUM I;  1VQ5 Z;  4RVF A;  2QEX Z;  3CC2 Z;  1ZB8 A;  2JIO A;  4NBB A;  4MH4 A;  1Q81 1;  3CCV Z;  4RS4 A;  4HH4 A;  3S14 I;  1R9T I;  3CCS 1;  2JIR A;  2QRD B;  3KIF A;  2GU2 A;  3GTQ I;  5C3E I;  1Q7Y 1;  3GTK I;  3T4N B;  3JAM f;  3MZL B;  2F4M A;  3G71 1;  2NAP A;  3J80 b;  2QKD A;  3CCR 1;  3CCL 1;  3CCE 1;  1YJW 1;  2VPW A;  2DE7 A;  1VQ7 1;  1I3Q I;  5D1O B;  3CCM 1;  1K8A 1;  2G2K A;  4NBG A;  3I07 A;  1YJ9 1;  1RO0 A;  1Z03 A;  2QRC B;  4E2Z A;  1VQP 1;  1JJ2 Z;  2R6M A;  3S1R I;  3RZD I;  3MON A;  2JS4 A;  1YHQ 1;  3U50 C;  1Q82 2;  5FLM I;  2E2H I;  3S17 I;  2KI7 B;  4XX2 A;  2JIP A;  3CC4 1;  1VQ8 1;  1Y1V S;  1JJ2 Y;  3NH5 A;  1FDO A;  2PM9 A;  5C4J I;  1SFO I;  3RZO I;  3S2D I;  5T67 A;  1VQ4 1;  2K3R A;  1RNI A;  1WJ2 A;  5CM2 M;  4BY7 I;  3HOY I;  2GTH A;  4RVH A;  1KC8 2;  5D1O A;  1M90 2;  4A93 I;  3GTM S;  2R93 I;  5C4X I;  3CQZ I;  2P28 A;  1Q82 1;  1VQN 1;  2NVQ I;  1K73 2;  3G71 Z;  1KQS Z;  3CCR Z;  3CCL Z;  1YJW Z;  3S1Q I;  4MRI A;  1YJN Z;  1K9M 2;  1VQ7 Z;  2NVT I;  1Y1V I;  5T64 A;  3CCM Z;  3NH4 A;  3I55 1;  2V3V A;  4E31 A;  1TWF I;  1KRL A;  2ZAE B;  1VQP Z;  4BXX I;  1RO4 A;  2NVY I;  4E2Y A;  2JA6 I;  2OTL 1;  2R92 I;  2OTJ Z;  1P9N A;  3IF8 A;  5AN9 F;  2VPZ A;  1I50 I;  1KQS Y;  1KC8 1;  3HOZ I;  5A2Q f;  1QYP A;  1M90 1;  2V8J A;  4DGL A;  3GTM I;  2Y0S A;  3TE5 B;  3EER A;  1K73 1;  3P5J B;  4NBC A;  1RLY A;  1TWA I;  3CC4 Z;  4QTT A;  1VQ8 Z;  3LUS A;  1QVG Z;  3GKQ A;  2IZ4 A;  1K9M 1;  2OOY B;  3CXC Z;  3F3P C;  4A3F I;  1WZN A;  1VQ4 Z;  2WAQ A;  5LL6 f;  1RQF A;  1ML8 A;  2E7Z A;  1YJN 1;  3ESW A;  4MXU A;  3H3V J;  3IR7 A;  4A3G I;  3NH8 A;  3CCQ 1;  3IFU A;  4E30 A;  3J81 b;  2QR1 B;  1QVG Y;  4A3J I;  3VTN A;  4TNU A;  1KD1 2;  1VQN Z;  1S7M A;  4E32 A;  2RHB A;  1N8R 2;  3CXC Y;  2OTJ 1;  4A3B I;  4RVD A;  2HU9 A;  4A3L I;  3M4O I;  2JUB A;  2RPR A;  3HKZ A;  1WII A;  3QWU A;  2HF1 A;  3S2H I;  3I55 Z;  1VQL 1;  4RV9 A;  4NBE A;  5IT9 f;  2I3C A;  4E33 A;  3TDH B;  4QTU A;  3F3F C;  2V8K A;  1ZH1 A;  2OTL Z;  2M48 A;  1Y1W I;  1VQK 1;  2VF1 A;  1RO2 A;  5IP7 I;  3H0G I;  4Y52 I;  2J6A A;  4NBH A;  2Q4Z A;  4BBS I;  1Z01 A;  1NUI A;  1X0T A;  1L1O C;  1KD1 1;  4MON A;  1N8R 1;  1VQO 1;  3IX0 A;  1K83 I;  3PO3 S;  2PMZ A;  1YUK A;  2E2I I;  4CL1 A;  2JIM A;  2JIQ A;  2NVX I;  2F4O A;  2YAD A;  3G6E 1;  4NH1 C;  4NFR A;  1VQ9 1;  1YIJ 1;  3NFZ A;  1WW9 A;  1DL6 A;  5D1P A;  4NB8 A;  3GTO I;  2RT9 A;  2VPX A;  3I56 1;  4NBD A;  3CC7 Z;  4A3D I;  4DQY B;  1YUA A;  2P3Y A;  1ZB9 A;  1NP6 A;  2K5R A;  2OOX B;  3NDJ A;  3CCQ Z;  3HOX I;  3BG0 B;  4E2X A;  1Q16 A;  3GCF A;  4A3M I;  2DE5 A;  2JR6 A;  1VQ6 1;  1QF8 A;  4S1T A;  4BBR I;  2KPI A;  3CMA 1;  2VUG A;  4E2W A;  2EGT A;  2B63 I;  3JAM b;  3PO3 I;  5FLX f;  1USP A;  4A3C I;  2E9H A;  3CCU 1;  4MD9 A;  1VQL Z;  3EED A;  4NBF A;  2RIQ A;  1S72 Z;  2W04 A;  1Q86 2;  1W2B Z;  1Z02 A;  2YU9 I;  3J7A 4;  3PO2 I;  1VQK Z;  1QXF A;  1SIW A;  1PFT A;  4HGY A;  1TWC I;  5T6B A;  2JNY A;  1QVF Z;  2VPY A;  3CC7 1;  5IP9 I;  3CCJ 1;  1VQO Z;  4RVG A;  2V8I A;  3S1N I;  2AKL A;  2QA4 1;  2Q51 A;  5C44 I;  5IT9 b;  2WB1 A;  3HOW I;  4DK1 A;  1W2B Y;  3G6E Z;  1YIJ Z;  3I4N I;  1VQ9 Z;  3MZK B;  2H85 A;  1YI2 1;  3FQQ A;  1M1K 1;  2IV2 X;  2LFU A;  1VQM 1;  3VB9 A;  2RBL A;  4A3E I;  1Q86 1;  3I56 Z;  3CD6 1;  2JA8 I;  1JWH C;  2GTI A;  3GTG I;  1QVF Y;  1S72 1;  3J80 f;  3G4S 1;  2JA5 I;  1VQ6 Z;  1YIT 1;  1NJI 2;  4BY1 I;  3CMA Z;  2R7Z I;  1Y8C A;  2JA7 I;  1VQ5 1;  1USP B;  2QEX 1;  3CC2 1;  3FKI I;  3CME Z;  3VMH A;  3CCV 1;  3I4M I;  3CCU Z;  3J81 f;  4A3I I;  3D9X A;  2E2J I;  4Y7N I;  3S1M I;  2O53 A;  4HGZ A;  1VLA A;  1LQL A;  3NDI A;  1TFI A;  3S15 I;  3HOV I;  1N2F A;  2DE6 A;  2IZ3 A;  3VMG A;  2V45 A;  1FDI A;  3HOU I;  3FQM A;  4MD8 A;  3OW2 Z;  3CCS Z;  3CCJ Z;  1NJI 1;  5A2Q b;  5FLX b;  4NBA A;  3KIH A;  3M3Y I;  4AYB A;  4X6A I;  2AYD A;  2QA4 Z;  1Q81 2;  1X3Z A;  2W03 A;  3CPW Z;  2LIY A;  1AA6 A;  2PK7 A;  2QRE B;  2BJO A;  4NOZ A;  1YI2 Z;  2M6N A;  3CCE Z;  2LEX A;  3K7A I;  2O4H A;  4NB9 A;  2QLV B;  1VQM Z;  1Q7Y 2;  3CME 1;  3GTJ I;  3CD6 Z;  4EWC A;  2OZK A;  2JMO A;  1YJ9 Z;  3GTP I;  1TWH I;  3S16 I;  1M1K 2;  3OW2 Y;  3D2L A;  4MD7 A;  3Q87 A;  3G4S Z;  1WCM I;  3D6W A;  1TWG I;  1K8A 2;  1I6H I;  3BG1 B;  1YIT Z; 
#chains in the Genus database with same CATH homology
 1YHQ Z;  1X3W A;  3CPW Y;  3VMI A;  4A3K I;  3GTL I;  2VUM I;  1VQ5 Z;  4RVF A;  2QEX Z;  3CC2 Z;  1ZB8 A;  4NBB A;  4MH4 A;  1Q81 1;  3CCV Z;  4RS4 A;  4HH4 A;  3S14 I;  1R9T I;  3CCS 1;  2QRD B;  3KIF A;  2GU2 A;  3GTQ I;  5C3E I;  1Q7Y 1;  3GTK I;  3T4N B;  3JAM f;  3MZL B;  2F4M A;  3G71 1;  3J80 b;  2QKD A;  3CCR 1;  3CCL 1;  3CCE 1;  1YJW 1;  2DE7 A;  1VQ7 1;  1I3Q I;  5D1O B;  3CCM 1;  1K8A 1;  2G2K A;  4NBG A;  3I07 A;  1YJ9 1;  1RO0 A;  1Z03 A;  2QRC B;  4E2Z A;  1VQP 1;  1JJ2 Z;  2R6M A;  3S1R I;  3RZD I;  3MON A;  2JS4 A;  1YHQ 1;  3U50 C;  1Q82 2;  5FLM I;  2E2H I;  3S17 I;  2KI7 B;  4XX2 A;  3CC4 1;  1VQ8 1;  1Y1V S;  1JJ2 Y;  3NH5 A;  2PM9 A;  5C4J I;  1SFO I;  3RZO I;  3S2D I;  5T67 A;  1VQ4 1;  2K3R A;  1RNI A;  5CM2 M;  4BY7 I;  3HOY I;  2GTH A;  4RVH A;  1KC8 2;  5D1O A;  1M90 2;  4A93 I;  3GTM S;  2R93 I;  5C4X I;  3CQZ I;  2P28 A;  1Q82 1;  1VQN 1;  2NVQ I;  1K73 2;  3G71 Z;  1KQS Z;  3CCR Z;  3CCL Z;  1YJW Z;  3S1Q I;  4MRI A;  1YJN Z;  1K9M 2;  1VQ7 Z;  2NVT I;  1Y1V I;  5T64 A;  3CCM Z;  3NH4 A;  3I55 1;  4E31 A;  1TWF I;  1KRL A;  2ZAE B;  1VQP Z;  4BXX I;  1RO4 A;  2NVY I;  4E2Y A;  2JA6 I;  2OTL 1;  2R92 I;  2OTJ Z;  1P9N A;  3IF8 A;  5AN9 F;  1KQS Y;  1I50 I;  3HOZ I;  1KC8 1;  5A2Q f;  1QYP A;  1M90 1;  2V8J A;  4DGL A;  3GTM I;  2Y0S A;  3TE5 B;  3EER A;  1K73 1;  3P5J B;  4NBC A;  1RLY A;  1TWA I;  3CC4 Z;  4QTT A;  1VQ8 Z;  3LUS A;  1QVG Z;  3GKQ A;  2IZ4 A;  1K9M 1;  2OOY B;  3CXC Z;  3F3P C;  4A3F I;  1VQ4 Z;  2WAQ A;  5LL6 f;  1RQF A;  1ML8 A;  3H3V J;  1YJN 1;  3ESW A;  4MXU A;  4A3G I;  3NH8 A;  3CCQ 1;  3IFU A;  4E30 A;  3J81 b;  2QR1 B;  1QVG Y;  4A3J I;  3VTN A;  4TNU A;  1KD1 2;  1VQN Z;  1S7M A;  4E32 A;  2RHB A;  1N8R 2;  3CXC Y;  2OTJ 1;  4A3B I;  4RVD A;  2HU9 A;  4A3L I;  3M4O I;  2JUB A;  2RPR A;  3HKZ A;  1WII A;  3QWU A;  2HF1 A;  3S2H I;  3I55 Z;  1VQL 1;  4RV9 A;  4NBE A;  5IT9 f;  2I3C A;  4E33 A;  3TDH B;  4QTU A;  3F3F C;  2V8K A;  1ZH1 A;  2OTL Z;  2M48 A;  1Y1W I;  1VQK 1;  2VF1 A;  1RO2 A;  5IP7 I;  3H0G I;  4Y52 I;  2J6A A;  4NBH A;  2Q4Z A;  4BBS I;  1Z01 A;  1NUI A;  1X0T A;  1L1O C;  1KD1 1;  4MON A;  1N8R 1;  1VQO 1;  3IX0 A;  1K83 I;  3PO3 S;  2PMZ A;  1YUK A;  2E2I I;  4CL1 A;  2NVX I;  2F4O A;  2YAD A;  4NH1 C;  3G6E 1;  4NFR A;  1VQ9 1;  1YIJ 1;  3NFZ A;  1WW9 A;  1DL6 A;  5D1P A;  4NB8 A;  3GTO I;  2RT9 A;  3I56 1;  4NBD A;  3CC7 Z;  4A3D I;  4DQY B;  1YUA A;  2P3Y A;  1ZB9 A;  1NP6 A;  2K5R A;  2OOX B;  3NDJ A;  3CCQ Z;  3HOX I;  3BG0 B;  4E2X A;  3GCF A;  4A3M I;  2DE5 A;  2JR6 A;  1VQ6 1;  1QF8 A;  4S1T A;  4BBR I;  2KPI A;  3CMA 1;  2VUG A;  4E2W A;  2EGT A;  2B63 I;  3JAM b;  3PO3 I;  5FLX f;  1USP A;  4A3C I;  2E9H A;  3CCU 1;  4MD9 A;  1VQL Z;  3EED A;  4NBF A;  2RIQ A;  1S72 Z;  2W04 A;  1Q86 2;  1W2B Z;  1Z02 A;  2YU9 I;  3J7A 4;  3PO2 I;  1VQK Z;  1PFT A;  4HGY A;  1TWC I;  5T6B A;  2JNY A;  1QVF Z;  3CC7 1;  5IP9 I;  3CCJ 1;  1VQO Z;  4RVG A;  2V8I A;  3S1N I;  2AKL A;  2QA4 1;  2Q51 A;  5C44 I;  5IT9 b;  2WB1 A;  3HOW I;  4DK1 A;  1W2B Y;  3G6E Z;  1YIJ Z;  3I4N I;  1VQ9 Z;  3MZK B;  2H85 A;  1YI2 1;  3FQQ A;  1M1K 1;  2LFU A;  1VQM 1;  3VB9 A;  2RBL A;  4A3E I;  1Q86 1;  3I56 Z;  3CD6 1;  2JA8 I;  1JWH C;  2GTI A;  3GTG I;  1QVF Y;  1S72 1;  3J80 f;  3G4S 1;  2JA5 I;  1VQ6 Z;  1YIT 1;  1NJI 2;  4BY1 I;  3CMA Z;  2R7Z I;  2JA7 I;  1VQ5 1;  1USP B;  2QEX 1;  3CC2 1;  3FKI I;  3CME Z;  3VMH A;  3CCV 1;  3I4M I;  3CCU Z;  3J81 f;  4A3I I;  3D9X A;  2E2J I;  4Y7N I;  3S1M I;  2O53 A;  4HGZ A;  1VLA A;  1LQL A;  3NDI A;  1TFI A;  3S15 I;  3HOV I;  1N2F A;  2DE6 A;  2IZ3 A;  3VMG A;  3HOU I;  3FQM A;  4MD8 A;  3OW2 Z;  3CCS Z;  3CCJ Z;  1NJI 1;  5A2Q b;  5FLX b;  4NBA A;  3KIH A;  3M3Y I;  4AYB A;  4X6A I;  2QA4 Z;  1Q81 2;  1X3Z A;  2W03 A;  3CPW Z;  2LIY A;  2PK7 A;  2QRE B;  2BJO A;  4NOZ A;  1YI2 Z;  2M6N A;  3CCE Z;  3K7A I;  2O4H A;  4NB9 A;  2QLV B;  1VQM Z;  1Q7Y 2;  3CME 1;  3GTJ I;  3CD6 Z;  4EWC A;  2OZK A;  2JMO A;  1YJ9 Z;  3GTP I;  1TWH I;  3S16 I;  1M1K 2;  3OW2 Y;  4MD7 A;  3Q87 A;  3G4S Z;  1WCM I;  3D6W A;  1TWG I;  1K8A 2;  1I6H I;  3BG1 B;  1YIT Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...