3CCM1

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccm100
1KQSY 3CC21 1VQM1 3CCE1 1M1K2 2QA4Z 1VQL1 3CCQZ 1JJ2Z 1VQ8Z 1Q862 1YI21 1Q821 3G6E1 1K9M1 1VQNZ 3I55Z 2QEXZ 3CME1 1W2BY 1Q812 1VQPZ 1K731 1K8A2 1YHQZ 1JJ2Y 3CMEZ 1VQ9Z 3G71Z 3CMAZ 1Q7Y1 3CD6Z 1VQK1 3G4S1 1YJNZ 1YJ9Z 1VQ4Z 3CCEZ 1NJI1 3CCMZ 1YIJZ 1KQSZ 1YJN1 1M901 2OTLZ 3CCUZ 1KD11 1YIT1 2QA41 1VQLZ 1VQKZ 1VQN1 1N8R1 2OTL1 1VQ81 1VQ6Z 3I56Z 1YI2Z 1KC81 1YHQ1 1VQ7Z 3CCS1 3CCRZ 3CC41 3G711 1VQ91 3CPWZ 1QVFZ 3I561 3CC7Z 3CCJ1 1VQ71 1M1K1 3CCVZ 1YJWZ 1QVGY 1VQ5Z 1Q861 3CCM1 1Q811 3CC2Z 1VQ61 2OTJZ 1VQMZ 1S72Z 1Q822 1K8A1 1VQO1 3CCSZ 1K9M2 3CC4Z 3OW2Y 1YITZ 2OTJ1 3CPWY 1QVFY 1S721 1Q7Y2 3CCLZ 1K732 3CXCY 3CCU1 1NJI2 1VQP1 3CCL1 1M902 3CCR1 1W2BZ 3OW2Z 3CC71 2QEX1 3CCV1 1YJW1 3CD61 3CCQ1 3CXCZ 1VQ51 1YJ91 1VQ41 1QVGZ 1KD12 1YIJ1 1KC82 3CMA1 3CCJZ 3G6EZ 1VQOZ 3G4SZ 1N8R2 3I551
chains in the Genus database with same CATH superfamily
3S1NI 3CC21 5A2Qf 2RIQA 1WJ2A 1M1K2 1S7MA 4QTUA 1VQ8Z 2HF1A 1Q862 2NAPA 1USPA 1NP6A 2W04A 2R92I 3EEDA 1TWGI 1W2BY 3H3VJ 1VQPZ 2OOYB 3TE5B 2RHBA 4DQYB 3IR7A 3G71Z 5C4XI 4MD7A 1WCMI 3D6WA 1WIIA 4RV9A 1YJNZ 1YJ9Z 1RO0A 4NBCA 4MXUA 3ESWA 1NJI1 2JA6I 3BG0B 3CCMZ 2OZKA 1YJN1 3VTNA 1LQLA 2IV2X 1KD11 2AKLA 3KIHA 1QYPA 1YIT1 3HOYI 3GCFA 2E7ZA 4A3FI 2QA41 1VQKZ 5FLXf 1I50I 1WW9A 3NFZA 4Y52I 2KPIA 1QXFA 4A3GI 2YADA 3F3FC 1YHQ1 2NVXI 1DL6A 1QF8A 3CC41 1QVFZ 3CC7Z 3NDJA 4MD8A 3HOWI 3CCVZ 4E2XA 3VB9A 4NFRA 1NUIA 2OTJZ 5A2Qb 4XX2A 3M3YI 2E2JI 4BXXI 1I6HI 2NVQI 2OTJ1 1QVFY 1X3WA 4EWCA 5C44I 4NBEA 2VUMI 1RLYA 2W03A 2DE5A 3CCL1 3MZKB 1M902 3CCR1 4NBFA 1VLAA 2PMZA 5IT9b 2B63I 3GTMS 4DGLA 2O53A 2JA7I 4RVDA 1VQ41 1FDOA 3HOZI 3T4NB 2GTIA 4NB9A 1WZNA 1X0TA 4NBDA 1VQOZ 4E33A 1USPB 1N8R2 1KQSY 3S14I 2JA5I 2PK7A 5FLMI 5IT9f 2Q4ZA 4A3LI 2OOXB 2R6MA 1JJ2Z 4X6AI 4MD9A 4NB8A 1K9M1 1RNIA 3I55Z 3S1QI 3CME1 2IZ4A 5C4JI 2F4OA 1JJ2Y 3CMEZ 2R7ZI 2GU2A 2VPZA 5C3EI 2WB1A 1VQK1 2NVYI 3GTQI 2H85A 3CCEZ 3I4NI 2JS4A 1TFIA 1M901 4TNUA 3FQQA 4A3DI 3CCUZ 3BG1B 2Q51A 1VQN1 3HOVI 4NBAA 3I56Z 1YI2Z 2LEXA 3PO3I 2JMOA 2V8IA 1AA6A 1JWHC 2JIOA 3D9XA 3CCS1 4E31A 3G711 3IFUA 5T64A 4A3EI 1TWHI 3PO2I 3FKII 1Z03A 1FDIA 4CL1A 1VQ61 3CC2Z 1VQMZ 2JIQA 4QTTA 5IP7I 3RZDI 1S72Z 1Q822 1K8A1 3S2DI 3F3PC 3CC4Z 4BY1I 1S721 2LIYA 1Q7Y2 2VUGA 4A3BI 2QRCB 2JA8I 3LUSA 2J6AA 5FLXb 4MRIA 1W2BZ 4S1TA 3HOUI 1Z01A 3I07A 3CCV1 4NH1C 3VMIA 2K3RA 1SIWA 2EGTA 1QVGZ 1KC82 3GKQA 3MONA 4NBGA 3U50C 3G4SZ 2IZ3A 1VQM1 3CCE1 1ZH1A 2QA4Z 2QREB 3CCQZ 1Y1VS 2Y0SA 4BBRI 2V8JA 4BBSI 3CQZI 1VQNZ 3P5JB 2QEXZ 1Q812 1Q16A 3S1RI 1K8A2 4RVHA 3J80b 1N2FA 1KRLA 3NH5A 1ML8A 2HU9A 2YU9I 1Z02A 1RO2A 1Q7Y1 3CD6Z 3TDHB 5IP9I 3GTOI 1YIJZ 4NBHA 2P3YA 2DE6A 2V45A 1YUAA 2RPRA 2E2HI 1N8R1 1VQ81 1VQ6Z 1KC81 2BJOA 1VQ91 3PO3S 3K7AI 4HGZA 2ZAEB 2V8KA 3CCJ1 3S16I 1M1K1 1YJWZ 5D1OB 2K5RA 3VMHA 4A93I 1VQ5Z 1Q861 2F4MA 3J81b 3MZLB 1RQFA 2KI7B 4MONA 3CCSZ 3J7A4 4E2YA 2NVTI 5LL6f 3S2HI 3M4OI 4E32A 3CCLZ 4A3II 1TWFI 2AYDA 3VMGA 1Y1VI 1X3ZA 2JR6A 4NBBA 3GTGI 4RVFA 2GTHA 2QEX1 2PM9A 1YUKA 4A3JI 3CCQ1 3GTJI 2DE7A 1KD12 2VPYA 3CCJZ 1P9NA 2I3CA 1R9TI 3KIFA 4DK1A 5D1PA 3EERA 4E2WA 1VQL1 2E2II 3I4MI 3QWUA 1YI21 1Q821 4NOZA 1I3QI 3G6E1 5AN9F 2VPXA 2VF1A 3FQMA 3IX0A 1SFOI 1RO4A 1K731 2JIRA 3HKZA 3S17I 1YHQZ 4E2ZA 4E30A 2V3VA 2G2KA 3D2LA 1VQ9Z 3CMAZ 2RBLA 2LFUA 3H0GI 1L1OC 4A3KI 3G4S1 3JAMf 2E9HA 1VQ4Z 2M48A 4HGYA 1KQSZ 3IF8A 2JUBA 2OTLZ 3GTMI 4A3MI 1VQLZ 3GTKI 3HOXI 2OTL1 1K83I 3NH4A 5CM2M 2WAQA 1VQ7Z 3NDIA 3CCRZ 3CPWZ 3I561 2RT9A 2QKDA 1TWAI 1VQ71 1QVGY 1ZB9A 4RS4A 3GTPI 2P28A 5T67A 3J81f 3CCM1 1Q811 1Y1WI 3RZOI 2M6NA 4RVGA 4MH4A 1PFTA 3J80f 1VQO1 1K9M2 3OW2Y 1YITZ 4HH4A 3CPWY 2JIMA 5D1OA 1K732 4AYBA 2QRDB 2QR1B 3CXCY 2VPWA 3S15I 2JNYA 3CCU1 1NJI2 1VQP1 2JIPA 4BY7I 5T6BA 3JAMb 2QLVB 3CC71 3NH8A 3OW2Z 2R93I 3GTLI 3S1MI 1ZB8A 1YJW1 3CD61 4Y7NI 1Y8CA 3CXCZ 1VQ51 1YJ91 3Q87A 4A3CI 2O4HA 1YIJ1 1TWCI 3CMA1 3G6EZ 3I551
chains in the Genus database with same CATH topology
3S1NI 3CC21 5A2Qf 2RIQA 1M1K2 1S7MA 4QTUA 1VQ8Z 2HF1A 1Q862 1USPA 1NP6A 2W04A 2R92I 3EEDA 1TWGI 1W2BY 3H3VJ 1VQPZ 2OOYB 3TE5B 2RHBA 4DQYB 3G71Z 5C4XI 4MD7A 1WCMI 3D6WA 1WIIA 4RV9A 1YJNZ 1YJ9Z 1RO0A 4NBCA 4MXUA 3ESWA 1NJI1 2JA6I 3BG0B 3CCMZ 2OZKA 1YJN1 3VTNA 1LQLA 1KD11 2AKLA 3KIHA 1QYPA 1YIT1 3HOYI 3GCFA 4A3FI 2QA41 1VQKZ 5FLXf 1I50I 1WW9A 3NFZA 4Y52I 2KPIA 4A3GI 2YADA 3F3FC 1YHQ1 2NVXI 1DL6A 1QF8A 3CC41 1QVFZ 3CC7Z 3NDJA 4MD8A 3HOWI 3CCVZ 4E2XA 3VB9A 4NFRA 1NUIA 2OTJZ 5A2Qb 4XX2A 3M3YI 2E2JI 4BXXI 1I6HI 2NVQI 2OTJ1 1QVFY 1X3WA 4EWCA 5C44I 4NBEA 2VUMI 1RLYA 2W03A 2DE5A 3CCL1 3MZKB 1M902 3CCR1 4NBFA 1VLAA 2PMZA 5IT9b 2B63I 3GTMS 4DGLA 2O53A 2JA7I 4RVDA 1VQ41 3HOZI 3T4NB 2GTIA 4NB9A 1X0TA 4NBDA 1VQOZ 4E33A 1USPB 1N8R2 1KQSY 3S14I 2JA5I 2PK7A 5FLMI 5IT9f 2Q4ZA 4A3LI 2OOXB 2R6MA 1JJ2Z 4X6AI 4MD9A 4NB8A 1K9M1 1RNIA 3I55Z 3S1QI 3CME1 2IZ4A 5C4JI 2F4OA 1JJ2Y 3CMEZ 2R7ZI 2GU2A 5C3EI 2WB1A 1VQK1 2NVYI 3GTQI 2H85A 3CCEZ 3I4NI 2JS4A 1TFIA 1M901 4TNUA 3FQQA 4A3DI 3CCUZ 3BG1B 2Q51A 1VQN1 3HOVI 4NBAA 3I56Z 1YI2Z 3PO3I 2JMOA 2V8IA 1JWHC 3D9XA 3CCS1 4E31A 3G711 3IFUA 5T64A 4A3EI 1TWHI 3PO2I 3FKII 1Z03A 4CL1A 1VQ61 3CC2Z 1VQMZ 3RZDI 4QTTA 5IP7I 1S72Z 1Q822 1K8A1 3S2DI 3F3PC 3CC4Z 4BY1I 1S721 2LIYA 1Q7Y2 2VUGA 4A3BI 2QRCB 2JA8I 3LUSA 2J6AA 5FLXb 4MRIA 1W2BZ 4S1TA 3HOUI 1Z01A 3I07A 3CCV1 4NH1C 3VMIA 2K3RA 2EGTA 1QVGZ 1KC82 3GKQA 3MONA 4NBGA 3U50C 3G4SZ 2IZ3A 1VQM1 3CCE1 1ZH1A 2QA4Z 2QREB 3CCQZ 1Y1VS 2Y0SA 4BBRI 2V8JA 4BBSI 3CQZI 1VQNZ 3P5JB 2QEXZ 1Q812 3S1RI 1K8A2 4RVHA 3J80b 1N2FA 1KRLA 3NH5A 1ML8A 2HU9A 2YU9I 1Z02A 1RO2A 1Q7Y1 3CD6Z 3TDHB 5IP9I 3GTOI 1YIJZ 4NBHA 2P3YA 2DE6A 1YUAA 2RPRA 2E2HI 1N8R1 1VQ81 1VQ6Z 1KC81 2BJOA 1VQ91 3PO3S 3K7AI 4HGZA 2ZAEB 2V8KA 3CCJ1 3S16I 1M1K1 1YJWZ 5D1OB 2K5RA 3VMHA 4A93I 1VQ5Z 1Q861 2F4MA 3J81b 3MZLB 1RQFA 2KI7B 4MONA 3CCSZ 3J7A4 4E2YA 2NVTI 5LL6f 3S2HI 3M4OI 4E32A 3CCLZ 4A3II 1TWFI 3VMGA 1Y1VI 1X3ZA 2JR6A 4NBBA 3GTGI 4RVFA 2GTHA 2QEX1 2PM9A 1YUKA 4A3JI 3CCQ1 3GTJI 2DE7A 1KD12 3CCJZ 1P9NA 2I3CA 1R9TI 3KIFA 4DK1A 5D1PA 3EERA 4E2WA 1VQL1 2E2II 3I4MI 3QWUA 1YI21 1Q821 4NOZA 1I3QI 3G6E1 5AN9F 2VF1A 3FQMA 3IX0A 1SFOI 1RO4A 1K731 3HKZA 3S17I 1YHQZ 4E2ZA 4E30A 2G2KA 1VQ9Z 3CMAZ 2RBLA 2LFUA 3H0GI 1L1OC 4A3KI 3G4S1 3JAMf 2E9HA 1VQ4Z 2M48A 4HGYA 1KQSZ 3IF8A 2JUBA 2OTLZ 3GTMI 4A3MI 1VQLZ 3GTKI 3HOXI 2OTL1 1K83I 3NH4A 5CM2M 2WAQA 1VQ7Z 3NDIA 3CCRZ 3CPWZ 3I561 2RT9A 2QKDA 1TWAI 1VQ71 1QVGY 1ZB9A 4RS4A 3GTPI 2P28A 5T67A 3J81f 3CCM1 1Q811 1Y1WI 3RZOI 2M6NA 4RVGA 4MH4A 1PFTA 3J80f 1VQO1 1K9M2 3OW2Y 1YITZ 4HH4A 3CPWY 5D1OA 1K732 4AYBA 2QRDB 2QR1B 3CXCY 3S15I 2JNYA 3CCU1 1NJI2 1VQP1 4BY7I 5T6BA 3JAMb 2QLVB 3CC71 3NH8A 3OW2Z 2R93I 3GTLI 3S1MI 1ZB8A 1YJW1 3CD61 4Y7NI 3CXCZ 1VQ51 1YJ91 3Q87A 4A3CI 2O4HA 1YIJ1 1TWCI 3CMA1 3G6EZ 3I551
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQS Y;  3CC2 1;  1VQM 1;  3CCE 1;  1M1K 2;  2QA4 Z;  1VQL 1;  3CCQ Z;  1JJ2 Z;  1VQ8 Z;  1Q86 2;  1YI2 1;  1Q82 1;  3G6E 1;  1K9M 1;  1VQN Z;  3I55 Z;  2QEX Z;  3CME 1;  1W2B Y;  1Q81 2;  1VQP Z;  1K73 1;  1K8A 2;  1YHQ Z;  1JJ2 Y;  3CME Z;  1VQ9 Z;  3G71 Z;  3CMA Z;  1Q7Y 1;  3CD6 Z;  1VQK 1;  3G4S 1;  1YJN Z;  1YJ9 Z;  1VQ4 Z;  3CCE Z;  1NJI 1;  3CCM Z;  1YIJ Z;  1KQS Z;  1YJN 1;  1M90 1;  2OTL Z;  3CCU Z;  1KD1 1;  1YIT 1;  2QA4 1;  1VQL Z;  1VQK Z;  1VQN 1;  1N8R 1;  2OTL 1;  1VQ8 1;  1VQ6 Z;  3I56 Z;  1YI2 Z;  1KC8 1;  1YHQ 1;  1VQ7 Z;  3CCS 1;  3CCR Z;  3CC4 1;  3G71 1;  1VQ9 1;  3CPW Z;  1QVF Z;  3I56 1;  3CC7 Z;  3CCJ 1;  1VQ7 1;  1M1K 1;  3CCV Z;  1YJW Z;  1QVG Y;  1VQ5 Z;  1Q86 1;  3CCM 1;  1Q81 1;  3CC2 Z;  1VQ6 1;  2OTJ Z;  1VQM Z;  1S72 Z;  1Q82 2;  1K8A 1;  1VQO 1;  3CCS Z;  1K9M 2;  3CC4 Z;  3OW2 Y;  1YIT Z;  2OTJ 1;  3CPW Y;  1QVF Y;  1S72 1;  1Q7Y 2;  3CCL Z;  1K73 2;  3CXC Y;  3CCU 1;  1NJI 2;  1VQP 1;  3CCL 1;  1M90 2;  3CCR 1;  1W2B Z;  3OW2 Z;  3CC7 1;  2QEX 1;  3CCV 1;  1YJW 1;  3CD6 1;  3CCQ 1;  3CXC Z;  1VQ5 1;  1YJ9 1;  1VQ4 1;  1QVG Z;  1KD1 2;  1YIJ 1;  1KC8 2;  3CMA 1;  3CCJ Z;  3G6E Z;  1VQO Z;  3G4S Z;  1N8R 2;  3I55 1; 
#chains in the Genus database with same CATH topology
 3S1N I;  3CC2 1;  5A2Q f;  2RIQ A;  1WJ2 A;  1M1K 2;  1S7M A;  4QTU A;  1VQ8 Z;  2HF1 A;  1Q86 2;  2NAP A;  1USP A;  1NP6 A;  2W04 A;  2R92 I;  3EED A;  1TWG I;  1W2B Y;  3H3V J;  1VQP Z;  2OOY B;  3TE5 B;  2RHB A;  4DQY B;  3IR7 A;  3G71 Z;  5C4X I;  4MD7 A;  1WCM I;  3D6W A;  1WII A;  4RV9 A;  1YJN Z;  1YJ9 Z;  1RO0 A;  4NBC A;  4MXU A;  3ESW A;  1NJI 1;  2JA6 I;  3BG0 B;  3CCM Z;  2OZK A;  1YJN 1;  3VTN A;  1LQL A;  2IV2 X;  1KD1 1;  2AKL A;  3KIH A;  1QYP A;  1YIT 1;  3HOY I;  3GCF A;  2E7Z A;  4A3F I;  2QA4 1;  1VQK Z;  5FLX f;  1I50 I;  1WW9 A;  3NFZ A;  4Y52 I;  2KPI A;  1QXF A;  4A3G I;  2YAD A;  3F3F C;  1YHQ 1;  2NVX I;  1DL6 A;  1QF8 A;  3CC4 1;  1QVF Z;  3CC7 Z;  3NDJ A;  4MD8 A;  3HOW I;  3CCV Z;  4E2X A;  3VB9 A;  4NFR A;  1NUI A;  2OTJ Z;  5A2Q b;  4XX2 A;  3M3Y I;  2E2J I;  4BXX I;  1I6H I;  2NVQ I;  2OTJ 1;  1QVF Y;  1X3W A;  4EWC A;  5C44 I;  4NBE A;  2VUM I;  1RLY A;  2W03 A;  2DE5 A;  3CCL 1;  3MZK B;  1M90 2;  3CCR 1;  4NBF A;  1VLA A;  2PMZ A;  5IT9 b;  2B63 I;  3GTM S;  4DGL A;  2O53 A;  2JA7 I;  4RVD A;  1VQ4 1;  1FDO A;  3HOZ I;  3T4N B;  2GTI A;  4NB9 A;  1WZN A;  1X0T A;  4NBD A;  1VQO Z;  4E33 A;  1USP B;  1N8R 2;  1KQS Y;  3S14 I;  2JA5 I;  2PK7 A;  5FLM I;  5IT9 f;  2Q4Z A;  4A3L I;  2OOX B;  2R6M A;  1JJ2 Z;  4X6A I;  4MD9 A;  4NB8 A;  1K9M 1;  1RNI A;  3I55 Z;  3S1Q I;  3CME 1;  2IZ4 A;  5C4J I;  2F4O A;  1JJ2 Y;  3CME Z;  2R7Z I;  2GU2 A;  2VPZ A;  5C3E I;  2WB1 A;  1VQK 1;  2NVY I;  3GTQ I;  2H85 A;  3CCE Z;  3I4N I;  2JS4 A;  1TFI A;  1M90 1;  4TNU A;  3FQQ A;  4A3D I;  3CCU Z;  3BG1 B;  2Q51 A;  1VQN 1;  3HOV I;  4NBA A;  3I56 Z;  1YI2 Z;  2LEX A;  3PO3 I;  2JMO A;  2V8I A;  1AA6 A;  1JWH C;  2JIO A;  3D9X A;  3CCS 1;  4E31 A;  3G71 1;  3IFU A;  5T64 A;  4A3E I;  1TWH I;  3PO2 I;  3FKI I;  1Z03 A;  1FDI A;  4CL1 A;  1VQ6 1;  3CC2 Z;  1VQM Z;  2JIQ A;  4QTT A;  5IP7 I;  3RZD I;  1S72 Z;  1Q82 2;  1K8A 1;  3S2D I;  3F3P C;  3CC4 Z;  4BY1 I;  1S72 1;  2LIY A;  1Q7Y 2;  2VUG A;  4A3B I;  2QRC B;  2JA8 I;  3LUS A;  2J6A A;  5FLX b;  4MRI A;  1W2B Z;  4S1T A;  3HOU I;  1Z01 A;  3I07 A;  3CCV 1;  4NH1 C;  3VMI A;  2K3R A;  1SIW A;  2EGT A;  1QVG Z;  1KC8 2;  3GKQ A;  3MON A;  4NBG A;  3U50 C;  3G4S Z;  2IZ3 A;  1VQM 1;  3CCE 1;  1ZH1 A;  2QA4 Z;  2QRE B;  3CCQ Z;  1Y1V S;  2Y0S A;  4BBR I;  2V8J A;  4BBS I;  3CQZ I;  1VQN Z;  3P5J B;  2QEX Z;  1Q81 2;  1Q16 A;  3S1R I;  1K8A 2;  4RVH A;  3J80 b;  1N2F A;  1KRL A;  3NH5 A;  1ML8 A;  2HU9 A;  2YU9 I;  1Z02 A;  1RO2 A;  1Q7Y 1;  3CD6 Z;  3TDH B;  5IP9 I;  3GTO I;  1YIJ Z;  4NBH A;  2P3Y A;  2DE6 A;  2V45 A;  1YUA A;  2RPR A;  2E2H I;  1N8R 1;  1VQ8 1;  1VQ6 Z;  1KC8 1;  2BJO A;  1VQ9 1;  3PO3 S;  3K7A I;  4HGZ A;  2ZAE B;  2V8K A;  3CCJ 1;  3S16 I;  1M1K 1;  1YJW Z;  5D1O B;  2K5R A;  3VMH A;  4A93 I;  1VQ5 Z;  1Q86 1;  2F4M A;  3J81 b;  3MZL B;  1RQF A;  2KI7 B;  4MON A;  3CCS Z;  3J7A 4;  4E2Y A;  2NVT I;  5LL6 f;  3S2H I;  3M4O I;  4E32 A;  3CCL Z;  4A3I I;  1TWF I;  2AYD A;  3VMG A;  1Y1V I;  1X3Z A;  2JR6 A;  4NBB A;  3GTG I;  4RVF A;  2GTH A;  2QEX 1;  2PM9 A;  1YUK A;  4A3J I;  3CCQ 1;  3GTJ I;  2DE7 A;  1KD1 2;  2VPY A;  3CCJ Z;  1P9N A;  2I3C A;  1R9T I;  3KIF A;  4DK1 A;  5D1P A;  3EER A;  4E2W A;  1VQL 1;  2E2I I;  3I4M I;  3QWU A;  1YI2 1;  1Q82 1;  4NOZ A;  1I3Q I;  3G6E 1;  5AN9 F;  2VPX A;  2VF1 A;  3FQM A;  3IX0 A;  1SFO I;  1RO4 A;  1K73 1;  2JIR A;  3HKZ A;  3S17 I;  1YHQ Z;  4E2Z A;  4E30 A;  2V3V A;  2G2K A;  3D2L A;  1VQ9 Z;  3CMA Z;  2RBL A;  2LFU A;  3H0G I;  1L1O C;  4A3K I;  3G4S 1;  3JAM f;  2E9H A;  1VQ4 Z;  2M48 A;  4HGY A;  1KQS Z;  3IF8 A;  2JUB A;  2OTL Z;  3GTM I;  4A3M I;  1VQL Z;  3GTK I;  3HOX I;  2OTL 1;  1K83 I;  3NH4 A;  5CM2 M;  2WAQ A;  1VQ7 Z;  3NDI A;  3CCR Z;  3CPW Z;  3I56 1;  2RT9 A;  2QKD A;  1TWA I;  1VQ7 1;  1QVG Y;  1ZB9 A;  4RS4 A;  3GTP I;  2P28 A;  5T67 A;  3J81 f;  3CCM 1;  1Q81 1;  1Y1W I;  3RZO I;  2M6N A;  4RVG A;  4MH4 A;  1PFT A;  3J80 f;  1VQO 1;  1K9M 2;  3OW2 Y;  1YIT Z;  4HH4 A;  3CPW Y;  2JIM A;  5D1O A;  1K73 2;  4AYB A;  2QRD B;  2QR1 B;  3CXC Y;  2VPW A;  3S15 I;  2JNY A;  3CCU 1;  1NJI 2;  1VQP 1;  2JIP A;  4BY7 I;  5T6B A;  3JAM b;  2QLV B;  3CC7 1;  3NH8 A;  3OW2 Z;  2R93 I;  3GTL I;  3S1M I;  1ZB8 A;  1YJW 1;  3CD6 1;  4Y7N I;  1Y8C A;  3CXC Z;  1VQ5 1;  1YJ9 1;  3Q87 A;  4A3C I;  2O4H A;  1YIJ 1;  1TWC I;  3CMA 1;  3G6E Z;  3I55 1; 
#chains in the Genus database with same CATH homology
 3S1N I;  3CC2 1;  5A2Q f;  2RIQ A;  1M1K 2;  1S7M A;  4QTU A;  1VQ8 Z;  2HF1 A;  1Q86 2;  1USP A;  1NP6 A;  2W04 A;  2R92 I;  3EED A;  1TWG I;  1W2B Y;  3H3V J;  1VQP Z;  2OOY B;  3TE5 B;  2RHB A;  4DQY B;  3G71 Z;  5C4X I;  4MD7 A;  1WCM I;  3D6W A;  1WII A;  4RV9 A;  1YJN Z;  1YJ9 Z;  1RO0 A;  4NBC A;  4MXU A;  3ESW A;  1NJI 1;  2JA6 I;  3BG0 B;  3CCM Z;  2OZK A;  1YJN 1;  3VTN A;  1LQL A;  1KD1 1;  2AKL A;  3KIH A;  1QYP A;  1YIT 1;  3HOY I;  3GCF A;  4A3F I;  2QA4 1;  1VQK Z;  5FLX f;  1I50 I;  1WW9 A;  3NFZ A;  4Y52 I;  2KPI A;  4A3G I;  2YAD A;  3F3F C;  1YHQ 1;  2NVX I;  1DL6 A;  1QF8 A;  3CC4 1;  1QVF Z;  3CC7 Z;  3NDJ A;  4MD8 A;  3HOW I;  3CCV Z;  4E2X A;  3VB9 A;  4NFR A;  1NUI A;  2OTJ Z;  5A2Q b;  4XX2 A;  3M3Y I;  2E2J I;  4BXX I;  1I6H I;  2NVQ I;  2OTJ 1;  1QVF Y;  1X3W A;  4EWC A;  5C44 I;  4NBE A;  2VUM I;  1RLY A;  2W03 A;  2DE5 A;  3CCL 1;  3MZK B;  1M90 2;  3CCR 1;  4NBF A;  1VLA A;  2PMZ A;  5IT9 b;  2B63 I;  3GTM S;  4DGL A;  2O53 A;  2JA7 I;  4RVD A;  1VQ4 1;  3HOZ I;  3T4N B;  2GTI A;  4NB9 A;  1X0T A;  4NBD A;  1VQO Z;  4E33 A;  1USP B;  1N8R 2;  1KQS Y;  3S14 I;  2JA5 I;  2PK7 A;  5FLM I;  5IT9 f;  2Q4Z A;  4A3L I;  2OOX B;  2R6M A;  1JJ2 Z;  4X6A I;  4MD9 A;  4NB8 A;  1K9M 1;  1RNI A;  3I55 Z;  3S1Q I;  3CME 1;  2IZ4 A;  5C4J I;  2F4O A;  1JJ2 Y;  3CME Z;  2R7Z I;  2GU2 A;  5C3E I;  2WB1 A;  1VQK 1;  2NVY I;  3GTQ I;  2H85 A;  3CCE Z;  3I4N I;  2JS4 A;  1TFI A;  1M90 1;  4TNU A;  3FQQ A;  4A3D I;  3CCU Z;  3BG1 B;  2Q51 A;  1VQN 1;  3HOV I;  4NBA A;  3I56 Z;  1YI2 Z;  3PO3 I;  2JMO A;  2V8I A;  1JWH C;  3D9X A;  3CCS 1;  4E31 A;  3G71 1;  3IFU A;  5T64 A;  4A3E I;  1TWH I;  3PO2 I;  3FKI I;  1Z03 A;  4CL1 A;  1VQ6 1;  3CC2 Z;  1VQM Z;  3RZD I;  4QTT A;  5IP7 I;  1S72 Z;  1Q82 2;  1K8A 1;  3S2D I;  3F3P C;  3CC4 Z;  4BY1 I;  1S72 1;  2LIY A;  1Q7Y 2;  2VUG A;  4A3B I;  2QRC B;  2JA8 I;  3LUS A;  2J6A A;  5FLX b;  4MRI A;  1W2B Z;  4S1T A;  3HOU I;  1Z01 A;  3I07 A;  3CCV 1;  4NH1 C;  3VMI A;  2K3R A;  2EGT A;  1QVG Z;  1KC8 2;  3GKQ A;  3MON A;  4NBG A;  3U50 C;  3G4S Z;  2IZ3 A;  1VQM 1;  3CCE 1;  1ZH1 A;  2QA4 Z;  2QRE B;  3CCQ Z;  1Y1V S;  2Y0S A;  4BBR I;  2V8J A;  4BBS I;  3CQZ I;  1VQN Z;  3P5J B;  2QEX Z;  1Q81 2;  3S1R I;  1K8A 2;  4RVH A;  3J80 b;  1N2F A;  1KRL A;  3NH5 A;  1ML8 A;  2HU9 A;  2YU9 I;  1Z02 A;  1RO2 A;  1Q7Y 1;  3CD6 Z;  3TDH B;  5IP9 I;  3GTO I;  1YIJ Z;  4NBH A;  2P3Y A;  2DE6 A;  1YUA A;  2RPR A;  2E2H I;  1N8R 1;  1VQ8 1;  1VQ6 Z;  1KC8 1;  2BJO A;  1VQ9 1;  3PO3 S;  3K7A I;  4HGZ A;  2ZAE B;  2V8K A;  3CCJ 1;  3S16 I;  1M1K 1;  1YJW Z;  5D1O B;  2K5R A;  3VMH A;  4A93 I;  1VQ5 Z;  1Q86 1;  2F4M A;  3J81 b;  3MZL B;  1RQF A;  2KI7 B;  4MON A;  3CCS Z;  3J7A 4;  4E2Y A;  2NVT I;  5LL6 f;  3S2H I;  3M4O I;  4E32 A;  3CCL Z;  4A3I I;  1TWF I;  3VMG A;  1Y1V I;  1X3Z A;  2JR6 A;  4NBB A;  3GTG I;  4RVF A;  2GTH A;  2QEX 1;  2PM9 A;  1YUK A;  4A3J I;  3CCQ 1;  3GTJ I;  2DE7 A;  1KD1 2;  3CCJ Z;  1P9N A;  2I3C A;  1R9T I;  3KIF A;  4DK1 A;  5D1P A;  3EER A;  4E2W A;  1VQL 1;  2E2I I;  3I4M I;  3QWU A;  1YI2 1;  1Q82 1;  4NOZ A;  1I3Q I;  3G6E 1;  5AN9 F;  2VF1 A;  3FQM A;  3IX0 A;  1SFO I;  1RO4 A;  1K73 1;  3HKZ A;  3S17 I;  1YHQ Z;  4E2Z A;  4E30 A;  2G2K A;  1VQ9 Z;  3CMA Z;  2RBL A;  2LFU A;  3H0G I;  1L1O C;  4A3K I;  3G4S 1;  3JAM f;  2E9H A;  1VQ4 Z;  2M48 A;  4HGY A;  1KQS Z;  3IF8 A;  2JUB A;  2OTL Z;  3GTM I;  4A3M I;  1VQL Z;  3GTK I;  3HOX I;  2OTL 1;  1K83 I;  3NH4 A;  5CM2 M;  2WAQ A;  1VQ7 Z;  3NDI A;  3CCR Z;  3CPW Z;  3I56 1;  2RT9 A;  2QKD A;  1TWA I;  1VQ7 1;  1QVG Y;  1ZB9 A;  4RS4 A;  3GTP I;  2P28 A;  5T67 A;  3J81 f;  3CCM 1;  1Q81 1;  1Y1W I;  3RZO I;  2M6N A;  4RVG A;  4MH4 A;  1PFT A;  3J80 f;  1VQO 1;  1K9M 2;  3OW2 Y;  1YIT Z;  4HH4 A;  3CPW Y;  5D1O A;  1K73 2;  4AYB A;  2QRD B;  2QR1 B;  3CXC Y;  3S15 I;  2JNY A;  3CCU 1;  1NJI 2;  1VQP 1;  4BY7 I;  5T6B A;  3JAM b;  2QLV B;  3CC7 1;  3NH8 A;  3OW2 Z;  2R93 I;  3GTL I;  3S1M I;  1ZB8 A;  1YJW 1;  3CD6 1;  4Y7N I;  3CXC Z;  1VQ5 1;  1YJ9 1;  3Q87 A;  4A3C I;  2O4H A;  1YIJ 1;  1TWC I;  3CMA 1;  3G6E Z;  3I55 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...