3CCM1

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
b'TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccm100
3CD6Z 3CCJZ 1VQN1 3G6EZ 3OW2Y 1JJ2Z 1VQ6Z 3I56Z 3CD61 3CCJ1 1N8R1 3G6E1 1N8R2 1YHQZ 1JJ2Y 1VQ61 3I561 1VQLZ 1Q861 1M901 1Q862 1M902 3CCM1 3CC41 1VQMZ 2QEXZ 1YHQ1 3CMAZ 1VQL1 3CCRZ 1KC81 1YJWZ 1KC82 1VQM1 2QEX1 1YJNZ 1VQ5Z 1VQ9Z 1VQKZ 3CCS1 3CMA1 3CCR1 3CMEZ 1VQOZ 1VQ8Z 1YJW1 1Q7Y1 3CCLZ 3I551 1Q7Y2 1YJN1 3CCMZ 1VQ51 3CC4Z 1VQ91 1VQK1 2OTJZ 3CME1 1VQO1 3CCUZ 1VQ81 3CCEZ 3CCQZ 3CCL1 3G71Z 1K8A1 1K8A2 2OTJ1 3CC7Z 3CCU1 1YITZ 3CCSZ 1QVFY 3CCE1 3CCQ1 1NJI1 3G711 1W2BY 1NJI2 1YI2Z 3I55Z 3CC71 3CPWY 1YIT1 3CC2Z 1YI21 1Q811 1S721 1Q812 1VQ7Z 3CC21 1QVFZ 1YIJ1 1W2BZ 2OTL1 3CCVZ 1YJ91 3CXCY 1VQ71 3G4SZ 3CPWZ 1VQPZ 1QVGZ 3CCV1 1M1K1 1M1K2 1VQ4Z 1S72Z 3G4S1 1K9M1 1VQP1 1K9M2 1K731 1KQSZ 1K732 1QVGY 2QA4Z 1YIJZ 1VQ41 2OTLZ 3CXCZ 1YJ9Z 1KQSY 1Q821 1VQNZ 1Q822 2QA41 1KD11 1KD12 3OW2Z
chains in the Genus database with same CATH superfamily
2JIMA 3J80f 1VQN1 2PM9A 1R9TI 4HGYA 1Z02A 3HOZI 1QF8A 2IZ3A 3CD61 2NVYI 1WCMI 3CCJ1 2I3CA 3J7A4 4RS4A 3VMIA 1N8R2 1YHQZ 1JJ2Y 2R92I 1Q862 4NFRA 2JMOA 3CCM1 4BY1I 1TWGI 2R6MA 4CL1A 3EERA 3CMAZ 1VQL1 3CCRZ 2AKLA 2E2JI 3HOWI 1VLAA 1VQM1 3ESWA 4HH4A 4MXUA 2QEX1 3GTJI 1YJNZ 2JA6I 3S1QI 2Q4ZA 2V45A 5IP7I 1VQ8Z 3D9XA 3I551 3GTOI 1VQ51 3HOVI 3S2DI 1VQ91 1LQLA 4NB8A 3RZDI 2OTJZ 3GTLI 3VMGA 3CCEZ 3M3YI 4NBEA 3TDHB 3NFZA 3G71Z 1WZNA 3D6WA 3EEDA 2LEXA 3I4MI 2EGTA 4NBAA 3VTNA 3CCQ1 1NJI1 2JIOA 5A2Qb 2GTIA 4DGLA 4DQYB 4E2WA 3RZOI 1TWHI 3IFUA 2P3YA 5IT9b 1S721 1RNIA 5CM2M 4E30A 2DE6A 3GKQA 1YIJ1 4X6AI 1YJ91 1VQ71 1P9NA 3HOUI 2E9HA 2H85A 3K7AI 1M1K1 4S1TA 3G4S1 1VQP1 1K9M2 1K732 2RIQA 3S16I 2OOYB 3S15I 2JIQA 5D1PA 3NH4A 5T64A 2QA41 1K83I 1KD11 4BY7I 4DK1A 4HGZA 2Y0SA 3NDJA 4NBHA 1I50I 3G6EZ 2AYDA 1S7MA 1VQ6Z 3I56Z 2JA8I 3MZKB 3GTGI 1M901 3P5JB 1QXFA 3KIHA 2NVXI 2K3RA 3S17I 1WJ2A 1KC81 3CQZI 4RV9A 1WIIA 4NBGA 4RVDA 4RVHA 3CMEZ 1VQOZ 2JR6A 3PO3S 1YJW1 1Q7Y1 1Y1VS 3CC4Z 1VQK1 2E2II 2LIYA 2JNYA 2KI7B 3MZLB 3J81b 3CCL1 1K8A2 2VPYA 3CCU1 5A2Qf 4A3CI 4NH1C 1YI2Z 1SIWA 2M6NA 3CC71 2VUMI 1RO2A 3CPWY 1YIT1 3CC2Z 4A3DI 5IT9f 2HU9A 1SFOI 1Q811 3JAMb 2R93I 3GTKI 1TWFI 3Q87A 1Z01A 4E2YA 2JIPA 4A3KI 5C44I 3CCVZ 3CXCY 1Y1VI 1Y8CA 3I07A 2JS4A 3CPWZ 3IF8A 3KIFA 5D1OA 1VQ4Z 4NBFA 1KQSZ 1X3WA 1ZH1A 3S1MI 4NOZA 4AYBA 2OTLZ 2V8IA 5C3EI 2F4OA 3CXCZ 1Q821 1VQNZ 4E31A 2DE5A 2V8JA 3OW2Z 1WW9A 5FLMI 1RO0A 3CD6Z 3CCJZ 3F3PC 2E2HI 1KRLA 3U50C 1FDOA 2HF1A 4RVFA 2Q51A 3NH8A 4XX2A 2JA5I 4E2ZA 2W04A 3FKII 1N8R1 4NBCA 1VQLZ 4MD7A 1Q861 2QR1B 4A3FI 4BBSI 3NH5A 3CC41 3IX0A 3S1NI 1VQMZ 2QEXZ 1YHQ1 1QYPA 2VF1A 2RT9A 1NP6A 4QTTA 1FDIA 4QTUA 2E7ZA 3FQMA 1VQ5Z 1VQ9Z 3CMA1 3CCR1 3GTMS 3IR7A 3F3FC 1YJN1 4A3II 1ZB8A 4MD9A 3S2HI 4A3JI 3J81f 2VUGA 2NAPA 1JWHC 1VQ81 5LL6f 3CCQZ 2J6AA 2VPZA 2OTJ1 3CCSZ 1QVFY 3CCE1 3G711 1W2BY 1NJI2 1I3QI 5FLXb 2RPRA 4NBDA 4MRIA 4MD8A 2GTHA 5T6BA 2KPIA 4NBBA 3JAMf 2O4HA 3QWUA 1VQ7Z 2W03A 2JA7I 4A3GI 4BBRI 1QVFZ 3MONA 1W2BZ 2OTL1 2F4MA 4A3MI 3G4SZ 2B63I 1VQPZ 2RHBA 3NDIA 4E33A 3PO2I 1QVGZ 3HOXI 1I6HI 1RLYA 1M1K2 1Y1WI 3I4NI 1Z03A 3HKZA 1K9M1 1Q16A 1K731 2QREB 5AN9F 2BJOA 2VPWA 2P28A 3GCFA 2QA4Z 2IV2X 4MH4A 2NVTI 2G2KA 2WB1A 1TWCI 1KQSY 1USPB 2RBLA 4Y52I 3VMHA 3PO3I 1KD12 5C4JI 3TE5B 1ML8A 3J80b 2PMZA 3OW2Y 2V8KA 1JJ2Z 1DL6A 3H0GI 5T67A 3G6E1 4A3EI 2PK7A 1AA6A 1VQ61 4RVGA 4NB9A 3I561 1M902 3T4NB 1YUAA 3VB9A 3M4OI 3GTPI 1YJWZ 1KC82 2QLVB 4A3LI 3GTQI 5C4XI 2JIRA 1VQKZ 2R7ZI 3CCS1 2K5RA 1L1OC 2YADA 3CCLZ 1Q7Y2 2VPXA 3CCMZ 1TFIA 2GU2A 3CME1 1VQO1 3CCUZ 1K8A1 3D2LA 1RO4A 1TWAI 3CC7Z 4MONA 1X3ZA 2WAQA 1YITZ 5FLXf 3FQQA 5D1OB 2M48A 4E2XA 3I55Z 2ZAEB 4E32A 1YI21 2YU9I 2V3VA 1Q812 1N2FA 3CC21 2QKDA 3S1RI 3BG1B 1PFTA 2IZ4A 1NUIA 3H3VJ 1X0TA 4A3BI 4TNUA 2QRCB 2OOXB 4A93I 1YUKA 3CCV1 1S72Z 2NVQI 3HOYI 3LUSA 1QVGY 4Y7NI 1YIJZ 2QRDB 1VQ41 4EWCA 1YJ9Z 2LFUA 2DE7A 5IP9I 2OZKA 1RQFA 1Q822 3GTMI 2JUBA 4BXXI 3S14I 1USPA 2O53A 3BG0B 1ZB9A
chains in the Genus database with same CATH topology
3J80f 1VQN1 2PM9A 1R9TI 4HGYA 1Z02A 3HOZI 1QF8A 2IZ3A 3CD61 2NVYI 1WCMI 3CCJ1 2I3CA 3J7A4 4RS4A 3VMIA 1N8R2 1YHQZ 1JJ2Y 2R92I 1Q862 4NFRA 2JMOA 3CCM1 4BY1I 1TWGI 2R6MA 4CL1A 3EERA 3CMAZ 1VQL1 3CCRZ 2AKLA 2E2JI 3HOWI 1VLAA 1VQM1 3ESWA 4HH4A 4MXUA 3GTJI 2QEX1 1YJNZ 2JA6I 3S1QI 2Q4ZA 5IP7I 1VQ8Z 3D9XA 3I551 3GTOI 1VQ51 3HOVI 3S2DI 1VQ91 1LQLA 4NB8A 3RZDI 2OTJZ 3GTLI 3VMGA 3CCEZ 3M3YI 4NBEA 3TDHB 3NFZA 3G71Z 3D6WA 3EEDA 3I4MI 2EGTA 4NBAA 3VTNA 3CCQ1 1NJI1 5A2Qb 2GTIA 4DGLA 4DQYB 4E2WA 3RZOI 1TWHI 3IFUA 2P3YA 5IT9b 1S721 1RNIA 5CM2M 4E30A 2DE6A 3GKQA 1YIJ1 4X6AI 1YJ91 1VQ71 1P9NA 3HOUI 2E9HA 2H85A 3K7AI 1M1K1 4S1TA 3G4S1 1VQP1 1K9M2 1K732 2RIQA 3S16I 2OOYB 3S15I 5D1PA 3NH4A 5T64A 2QA41 1K83I 1KD11 4BY7I 4DK1A 4HGZA 2Y0SA 3NDJA 4NBHA 1I50I 3G6EZ 1S7MA 1VQ6Z 3I56Z 2JA8I 3MZKB 3GTGI 1M901 3P5JB 3KIHA 2NVXI 2K3RA 3S17I 1KC81 3CQZI 4RV9A 1WIIA 4NBGA 4RVDA 4RVHA 3CMEZ 1VQOZ 2JR6A 3PO3S 1YJW1 1Q7Y1 1Y1VS 3CC4Z 1VQK1 2E2II 2LIYA 2JNYA 2KI7B 3MZLB 3J81b 3CCL1 1K8A2 3CCU1 5A2Qf 4A3CI 4NH1C 1YI2Z 2M6NA 3CC71 2VUMI 1RO2A 3CPWY 1YIT1 3CC2Z 4A3DI 5IT9f 2HU9A 1SFOI 1Q811 3JAMb 2R93I 3GTKI 1TWFI 3Q87A 1Z01A 4E2YA 4A3KI 5C44I 3CCVZ 3CXCY 1Y1VI 3I07A 2JS4A 3CPWZ 3IF8A 3KIFA 5D1OA 1VQ4Z 4NBFA 1KQSZ 1X3WA 1ZH1A 3S1MI 4NOZA 4AYBA 2OTLZ 2V8IA 5C3EI 2F4OA 3CXCZ 1Q821 1VQNZ 4E31A 2DE5A 2V8JA 3OW2Z 1WW9A 5FLMI 1RO0A 3CD6Z 3CCJZ 3F3PC 2E2HI 1KRLA 3U50C 2HF1A 4RVFA 2Q51A 3NH8A 4XX2A 2JA5I 4E2ZA 2W04A 3FKII 1N8R1 4NBCA 1VQLZ 4MD7A 1Q861 2QR1B 4A3FI 4BBSI 3NH5A 3CC41 3IX0A 3S1NI 1VQMZ 2QEXZ 1YHQ1 1QYPA 2VF1A 2RT9A 1NP6A 4QTTA 4QTUA 3FQMA 1VQ5Z 1VQ9Z 3CMA1 3CCR1 3GTMS 3F3FC 1YJN1 4A3II 1ZB8A 4MD9A 3S2HI 4A3JI 3J81f 2VUGA 1JWHC 1VQ81 5LL6f 3CCQZ 2J6AA 2OTJ1 3CCSZ 1QVFY 3CCE1 3G711 1W2BY 1NJI2 1I3QI 5FLXb 2RPRA 4NBDA 4MRIA 4MD8A 2GTHA 5T6BA 2KPIA 4NBBA 3JAMf 2O4HA 3QWUA 1VQ7Z 2W03A 2JA7I 4A3GI 4BBRI 1QVFZ 3MONA 1W2BZ 2OTL1 2F4MA 4A3MI 3G4SZ 2B63I 1VQPZ 2RHBA 3NDIA 4E33A 3PO2I 1QVGZ 3HOXI 1I6HI 1RLYA 1M1K2 1Y1WI 3I4NI 1Z03A 3HKZA 1K9M1 1K731 2QREB 5AN9F 2BJOA 2P28A 3GCFA 2QA4Z 4MH4A 2NVTI 2G2KA 2WB1A 1TWCI 1KQSY 1USPB 2RBLA 4Y52I 3VMHA 3PO3I 1KD12 5C4JI 3TE5B 1ML8A 3J80b 2PMZA 3OW2Y 2V8KA 1JJ2Z 1DL6A 3H0GI 5T67A 3G6E1 4A3EI 2PK7A 1VQ61 4RVGA 4NB9A 3I561 1M902 3T4NB 1YUAA 3VB9A 3M4OI 3GTPI 1YJWZ 1KC82 2QLVB 4A3LI 3GTQI 5C4XI 1VQKZ 2R7ZI 3CCS1 2K5RA 1L1OC 2YADA 3CCLZ 1Q7Y2 3CCMZ 1TFIA 2GU2A 3CME1 1VQO1 3CCUZ 1K8A1 1RO4A 1TWAI 3CC7Z 4MONA 1X3ZA 2WAQA 1YITZ 5FLXf 3FQQA 5D1OB 2M48A 4E2XA 3I55Z 2ZAEB 4E32A 1YI21 2YU9I 1Q812 1N2FA 3CC21 2QKDA 3S1RI 3BG1B 1PFTA 2IZ4A 1NUIA 3H3VJ 1X0TA 4A3BI 4TNUA 2QRCB 2OOXB 4A93I 1YUKA 3CCV1 1S72Z 2NVQI 3HOYI 3LUSA 1QVGY 4Y7NI 1YIJZ 2QRDB 1VQ41 4EWCA 1YJ9Z 2LFUA 2DE7A 5IP9I 2OZKA 1RQFA 1Q822 3GTMI 2JUBA 4BXXI 3S14I 1USPA 2O53A 3BG0B 1ZB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CD6 Z;  3CCJ Z;  1VQN 1;  3G6E Z;  3OW2 Y;  1JJ2 Z;  1VQ6 Z;  3I56 Z;  3CD6 1;  3CCJ 1;  1N8R 1;  3G6E 1;  1N8R 2;  1YHQ Z;  1JJ2 Y;  1VQ6 1;  3I56 1;  1VQL Z;  1Q86 1;  1M90 1;  1Q86 2;  1M90 2;  3CCM 1;  3CC4 1;  1VQM Z;  2QEX Z;  1YHQ 1;  3CMA Z;  1VQL 1;  3CCR Z;  1KC8 1;  1YJW Z;  1KC8 2;  1VQM 1;  2QEX 1;  1YJN Z;  1VQ5 Z;  1VQ9 Z;  1VQK Z;  3CCS 1;  3CMA 1;  3CCR 1;  3CME Z;  1VQO Z;  1VQ8 Z;  1YJW 1;  1Q7Y 1;  3CCL Z;  3I55 1;  1Q7Y 2;  1YJN 1;  3CCM Z;  1VQ5 1;  3CC4 Z;  1VQ9 1;  1VQK 1;  2OTJ Z;  3CME 1;  1VQO 1;  3CCU Z;  1VQ8 1;  3CCE Z;  3CCQ Z;  3CCL 1;  3G71 Z;  1K8A 1;  1K8A 2;  2OTJ 1;  3CC7 Z;  3CCU 1;  1YIT Z;  3CCS Z;  1QVF Y;  3CCE 1;  3CCQ 1;  1NJI 1;  3G71 1;  1W2B Y;  1NJI 2;  1YI2 Z;  3I55 Z;  3CC7 1;  3CPW Y;  1YIT 1;  3CC2 Z;  1YI2 1;  1Q81 1;  1S72 1;  1Q81 2;  1VQ7 Z;  3CC2 1;  1QVF Z;  1YIJ 1;  1W2B Z;  2OTL 1;  3CCV Z;  1YJ9 1;  3CXC Y;  1VQ7 1;  3G4S Z;  3CPW Z;  1VQP Z;  1QVG Z;  3CCV 1;  1M1K 1;  1M1K 2;  1VQ4 Z;  1S72 Z;  3G4S 1;  1K9M 1;  1VQP 1;  1K9M 2;  1K73 1;  1KQS Z;  1K73 2;  1QVG Y;  2QA4 Z;  1YIJ Z;  1VQ4 1;  2OTL Z;  3CXC Z;  1YJ9 Z;  1KQS Y;  1Q82 1;  1VQN Z;  1Q82 2;  2QA4 1;  1KD1 1;  1KD1 2;  3OW2 Z; 
#chains in the Genus database with same CATH topology
 2JIM A;  3J80 f;  1VQN 1;  2PM9 A;  1R9T I;  4HGY A;  1Z02 A;  3HOZ I;  1QF8 A;  2IZ3 A;  3CD6 1;  2NVY I;  1WCM I;  3CCJ 1;  2I3C A;  3J7A 4;  4RS4 A;  3VMI A;  1N8R 2;  1YHQ Z;  1JJ2 Y;  2R92 I;  1Q86 2;  4NFR A;  2JMO A;  3CCM 1;  4BY1 I;  1TWG I;  2R6M A;  4CL1 A;  3EER A;  3CMA Z;  1VQL 1;  3CCR Z;  2AKL A;  2E2J I;  3HOW I;  1VLA A;  1VQM 1;  3ESW A;  4HH4 A;  4MXU A;  2QEX 1;  3GTJ I;  1YJN Z;  2JA6 I;  3S1Q I;  2Q4Z A;  2V45 A;  5IP7 I;  1VQ8 Z;  3D9X A;  3I55 1;  3GTO I;  1VQ5 1;  3HOV I;  3S2D I;  1VQ9 1;  1LQL A;  4NB8 A;  3RZD I;  2OTJ Z;  3GTL I;  3VMG A;  3CCE Z;  3M3Y I;  4NBE A;  3TDH B;  3NFZ A;  3G71 Z;  1WZN A;  3D6W A;  3EED A;  2LEX A;  3I4M I;  2EGT A;  4NBA A;  3VTN A;  3CCQ 1;  1NJI 1;  2JIO A;  5A2Q b;  2GTI A;  4DGL A;  4DQY B;  4E2W A;  3RZO I;  1TWH I;  3IFU A;  2P3Y A;  5IT9 b;  1S72 1;  1RNI A;  5CM2 M;  4E30 A;  2DE6 A;  3GKQ A;  1YIJ 1;  4X6A I;  1YJ9 1;  1VQ7 1;  1P9N A;  3HOU I;  2E9H A;  2H85 A;  3K7A I;  1M1K 1;  4S1T A;  3G4S 1;  1VQP 1;  1K9M 2;  1K73 2;  2RIQ A;  3S16 I;  2OOY B;  3S15 I;  2JIQ A;  5D1P A;  3NH4 A;  5T64 A;  2QA4 1;  1K83 I;  1KD1 1;  4BY7 I;  4DK1 A;  4HGZ A;  2Y0S A;  3NDJ A;  4NBH A;  1I50 I;  3G6E Z;  2AYD A;  1S7M A;  1VQ6 Z;  3I56 Z;  2JA8 I;  3MZK B;  3GTG I;  1M90 1;  3P5J B;  1QXF A;  3KIH A;  2NVX I;  2K3R A;  3S17 I;  1WJ2 A;  1KC8 1;  3CQZ I;  4RV9 A;  1WII A;  4NBG A;  4RVD A;  4RVH A;  3CME Z;  1VQO Z;  2JR6 A;  3PO3 S;  1YJW 1;  1Q7Y 1;  1Y1V S;  3CC4 Z;  1VQK 1;  2E2I I;  2LIY A;  2JNY A;  2KI7 B;  3MZL B;  3J81 b;  3CCL 1;  1K8A 2;  2VPY A;  3CCU 1;  5A2Q f;  4A3C I;  4NH1 C;  1YI2 Z;  1SIW A;  2M6N A;  3CC7 1;  2VUM I;  1RO2 A;  3CPW Y;  1YIT 1;  3CC2 Z;  4A3D I;  5IT9 f;  2HU9 A;  1SFO I;  1Q81 1;  3JAM b;  2R93 I;  3GTK I;  1TWF I;  3Q87 A;  1Z01 A;  4E2Y A;  2JIP A;  4A3K I;  5C44 I;  3CCV Z;  3CXC Y;  1Y1V I;  1Y8C A;  3I07 A;  2JS4 A;  3CPW Z;  3IF8 A;  3KIF A;  5D1O A;  1VQ4 Z;  4NBF A;  1KQS Z;  1X3W A;  1ZH1 A;  3S1M I;  4NOZ A;  4AYB A;  2OTL Z;  2V8I A;  5C3E I;  2F4O A;  3CXC Z;  1Q82 1;  1VQN Z;  4E31 A;  2DE5 A;  2V8J A;  3OW2 Z;  1WW9 A;  5FLM I;  1RO0 A;  3CD6 Z;  3CCJ Z;  3F3P C;  2E2H I;  1KRL A;  3U50 C;  1FDO A;  2HF1 A;  4RVF A;  2Q51 A;  3NH8 A;  4XX2 A;  2JA5 I;  4E2Z A;  2W04 A;  3FKI I;  1N8R 1;  4NBC A;  1VQL Z;  4MD7 A;  1Q86 1;  2QR1 B;  4A3F I;  4BBS I;  3NH5 A;  3CC4 1;  3IX0 A;  3S1N I;  1VQM Z;  2QEX Z;  1YHQ 1;  1QYP A;  2VF1 A;  2RT9 A;  1NP6 A;  4QTT A;  1FDI A;  4QTU A;  2E7Z A;  3FQM A;  1VQ5 Z;  1VQ9 Z;  3CMA 1;  3CCR 1;  3GTM S;  3IR7 A;  3F3F C;  1YJN 1;  4A3I I;  1ZB8 A;  4MD9 A;  3S2H I;  4A3J I;  3J81 f;  2VUG A;  2NAP A;  1JWH C;  1VQ8 1;  5LL6 f;  3CCQ Z;  2J6A A;  2VPZ A;  2OTJ 1;  3CCS Z;  1QVF Y;  3CCE 1;  3G71 1;  1W2B Y;  1NJI 2;  1I3Q I;  5FLX b;  2RPR A;  4NBD A;  4MRI A;  4MD8 A;  2GTH A;  5T6B A;  2KPI A;  4NBB A;  3JAM f;  2O4H A;  3QWU A;  1VQ7 Z;  2W03 A;  2JA7 I;  4A3G I;  4BBR I;  1QVF Z;  3MON A;  1W2B Z;  2OTL 1;  2F4M A;  4A3M I;  3G4S Z;  2B63 I;  1VQP Z;  2RHB A;  3NDI A;  4E33 A;  3PO2 I;  1QVG Z;  3HOX I;  1I6H I;  1RLY A;  1M1K 2;  1Y1W I;  3I4N I;  1Z03 A;  3HKZ A;  1K9M 1;  1Q16 A;  1K73 1;  2QRE B;  5AN9 F;  2BJO A;  2VPW A;  2P28 A;  3GCF A;  2QA4 Z;  2IV2 X;  4MH4 A;  2NVT I;  2G2K A;  2WB1 A;  1TWC I;  1KQS Y;  1USP B;  2RBL A;  4Y52 I;  3VMH A;  3PO3 I;  1KD1 2;  5C4J I;  3TE5 B;  1ML8 A;  3J80 b;  2PMZ A;  3OW2 Y;  2V8K A;  1JJ2 Z;  1DL6 A;  3H0G I;  5T67 A;  3G6E 1;  4A3E I;  2PK7 A;  1AA6 A;  1VQ6 1;  4RVG A;  4NB9 A;  3I56 1;  1M90 2;  3T4N B;  1YUA A;  3VB9 A;  3M4O I;  3GTP I;  1YJW Z;  1KC8 2;  2QLV B;  4A3L I;  3GTQ I;  5C4X I;  2JIR A;  1VQK Z;  2R7Z I;  3CCS 1;  2K5R A;  1L1O C;  2YAD A;  3CCL Z;  1Q7Y 2;  2VPX A;  3CCM Z;  1TFI A;  2GU2 A;  3CME 1;  1VQO 1;  3CCU Z;  1K8A 1;  3D2L A;  1RO4 A;  1TWA I;  3CC7 Z;  4MON A;  1X3Z A;  2WAQ A;  1YIT Z;  5FLX f;  3FQQ A;  5D1O B;  2M48 A;  4E2X A;  3I55 Z;  2ZAE B;  4E32 A;  1YI2 1;  2YU9 I;  2V3V A;  1Q81 2;  1N2F A;  3CC2 1;  2QKD A;  3S1R I;  3BG1 B;  1PFT A;  2IZ4 A;  1NUI A;  3H3V J;  1X0T A;  4A3B I;  4TNU A;  2QRC B;  2OOX B;  4A93 I;  1YUK A;  3CCV 1;  1S72 Z;  2NVQ I;  3HOY I;  3LUS A;  1QVG Y;  4Y7N I;  1YIJ Z;  2QRD B;  1VQ4 1;  4EWC A;  1YJ9 Z;  2LFU A;  2DE7 A;  5IP9 I;  2OZK A;  1RQF A;  1Q82 2;  3GTM I;  2JUB A;  4BXX I;  3S14 I;  1USP A;  2O53 A;  3BG0 B;  1ZB9 A; 
#chains in the Genus database with same CATH homology
 3J80 f;  1VQN 1;  2PM9 A;  1R9T I;  4HGY A;  1Z02 A;  3HOZ I;  1QF8 A;  2IZ3 A;  3CD6 1;  2NVY I;  1WCM I;  3CCJ 1;  2I3C A;  3J7A 4;  4RS4 A;  3VMI A;  1N8R 2;  1YHQ Z;  1JJ2 Y;  2R92 I;  1Q86 2;  4NFR A;  2JMO A;  3CCM 1;  4BY1 I;  1TWG I;  2R6M A;  4CL1 A;  3EER A;  3CMA Z;  1VQL 1;  3CCR Z;  2AKL A;  2E2J I;  3HOW I;  1VLA A;  1VQM 1;  3ESW A;  4HH4 A;  4MXU A;  3GTJ I;  2QEX 1;  1YJN Z;  2JA6 I;  3S1Q I;  2Q4Z A;  5IP7 I;  1VQ8 Z;  3D9X A;  3I55 1;  3GTO I;  1VQ5 1;  3HOV I;  3S2D I;  1VQ9 1;  1LQL A;  4NB8 A;  3RZD I;  2OTJ Z;  3GTL I;  3VMG A;  3CCE Z;  3M3Y I;  4NBE A;  3TDH B;  3NFZ A;  3G71 Z;  3D6W A;  3EED A;  3I4M I;  2EGT A;  4NBA A;  3VTN A;  3CCQ 1;  1NJI 1;  5A2Q b;  2GTI A;  4DGL A;  4DQY B;  4E2W A;  3RZO I;  1TWH I;  3IFU A;  2P3Y A;  5IT9 b;  1S72 1;  1RNI A;  5CM2 M;  4E30 A;  2DE6 A;  3GKQ A;  1YIJ 1;  4X6A I;  1YJ9 1;  1VQ7 1;  1P9N A;  3HOU I;  2E9H A;  2H85 A;  3K7A I;  1M1K 1;  4S1T A;  3G4S 1;  1VQP 1;  1K9M 2;  1K73 2;  2RIQ A;  3S16 I;  2OOY B;  3S15 I;  5D1P A;  3NH4 A;  5T64 A;  2QA4 1;  1K83 I;  1KD1 1;  4BY7 I;  4DK1 A;  4HGZ A;  2Y0S A;  3NDJ A;  4NBH A;  1I50 I;  3G6E Z;  1S7M A;  1VQ6 Z;  3I56 Z;  2JA8 I;  3MZK B;  3GTG I;  1M90 1;  3P5J B;  3KIH A;  2NVX I;  2K3R A;  3S17 I;  1KC8 1;  3CQZ I;  4RV9 A;  1WII A;  4NBG A;  4RVD A;  4RVH A;  3CME Z;  1VQO Z;  2JR6 A;  3PO3 S;  1YJW 1;  1Q7Y 1;  1Y1V S;  3CC4 Z;  1VQK 1;  2E2I I;  2LIY A;  2JNY A;  2KI7 B;  3MZL B;  3J81 b;  3CCL 1;  1K8A 2;  3CCU 1;  5A2Q f;  4A3C I;  4NH1 C;  1YI2 Z;  2M6N A;  3CC7 1;  2VUM I;  1RO2 A;  3CPW Y;  1YIT 1;  3CC2 Z;  4A3D I;  5IT9 f;  2HU9 A;  1SFO I;  1Q81 1;  3JAM b;  2R93 I;  3GTK I;  1TWF I;  3Q87 A;  1Z01 A;  4E2Y A;  4A3K I;  5C44 I;  3CCV Z;  3CXC Y;  1Y1V I;  3I07 A;  2JS4 A;  3CPW Z;  3IF8 A;  3KIF A;  5D1O A;  1VQ4 Z;  4NBF A;  1KQS Z;  1X3W A;  1ZH1 A;  3S1M I;  4NOZ A;  4AYB A;  2OTL Z;  2V8I A;  5C3E I;  2F4O A;  3CXC Z;  1Q82 1;  1VQN Z;  4E31 A;  2DE5 A;  2V8J A;  3OW2 Z;  1WW9 A;  5FLM I;  1RO0 A;  3CD6 Z;  3CCJ Z;  3F3P C;  2E2H I;  1KRL A;  3U50 C;  2HF1 A;  4RVF A;  2Q51 A;  3NH8 A;  4XX2 A;  2JA5 I;  4E2Z A;  2W04 A;  3FKI I;  1N8R 1;  4NBC A;  1VQL Z;  4MD7 A;  1Q86 1;  2QR1 B;  4A3F I;  4BBS I;  3NH5 A;  3CC4 1;  3IX0 A;  3S1N I;  1VQM Z;  2QEX Z;  1YHQ 1;  1QYP A;  2VF1 A;  2RT9 A;  1NP6 A;  4QTT A;  4QTU A;  3FQM A;  1VQ5 Z;  1VQ9 Z;  3CMA 1;  3CCR 1;  3GTM S;  3F3F C;  1YJN 1;  4A3I I;  1ZB8 A;  4MD9 A;  3S2H I;  4A3J I;  3J81 f;  2VUG A;  1JWH C;  1VQ8 1;  5LL6 f;  3CCQ Z;  2J6A A;  2OTJ 1;  3CCS Z;  1QVF Y;  3CCE 1;  3G71 1;  1W2B Y;  1NJI 2;  1I3Q I;  5FLX b;  2RPR A;  4NBD A;  4MRI A;  4MD8 A;  2GTH A;  5T6B A;  2KPI A;  4NBB A;  3JAM f;  2O4H A;  3QWU A;  1VQ7 Z;  2W03 A;  2JA7 I;  4A3G I;  4BBR I;  1QVF Z;  3MON A;  1W2B Z;  2OTL 1;  2F4M A;  4A3M I;  3G4S Z;  2B63 I;  1VQP Z;  2RHB A;  3NDI A;  4E33 A;  3PO2 I;  1QVG Z;  3HOX I;  1I6H I;  1RLY A;  1M1K 2;  1Y1W I;  3I4N I;  1Z03 A;  3HKZ A;  1K9M 1;  1K73 1;  2QRE B;  5AN9 F;  2BJO A;  2P28 A;  3GCF A;  2QA4 Z;  4MH4 A;  2NVT I;  2G2K A;  2WB1 A;  1TWC I;  1KQS Y;  1USP B;  2RBL A;  4Y52 I;  3VMH A;  3PO3 I;  1KD1 2;  5C4J I;  3TE5 B;  1ML8 A;  3J80 b;  2PMZ A;  3OW2 Y;  2V8K A;  1JJ2 Z;  1DL6 A;  3H0G I;  5T67 A;  3G6E 1;  4A3E I;  2PK7 A;  1VQ6 1;  4RVG A;  4NB9 A;  3I56 1;  1M90 2;  3T4N B;  1YUA A;  3VB9 A;  3M4O I;  3GTP I;  1YJW Z;  1KC8 2;  2QLV B;  4A3L I;  3GTQ I;  5C4X I;  1VQK Z;  2R7Z I;  3CCS 1;  2K5R A;  1L1O C;  2YAD A;  3CCL Z;  1Q7Y 2;  3CCM Z;  1TFI A;  2GU2 A;  3CME 1;  1VQO 1;  3CCU Z;  1K8A 1;  1RO4 A;  1TWA I;  3CC7 Z;  4MON A;  1X3Z A;  2WAQ A;  1YIT Z;  5FLX f;  3FQQ A;  5D1O B;  2M48 A;  4E2X A;  3I55 Z;  2ZAE B;  4E32 A;  1YI2 1;  2YU9 I;  1Q81 2;  1N2F A;  3CC2 1;  2QKD A;  3S1R I;  3BG1 B;  1PFT A;  2IZ4 A;  1NUI A;  3H3V J;  1X0T A;  4A3B I;  4TNU A;  2QRC B;  2OOX B;  4A93 I;  1YUK A;  3CCV 1;  1S72 Z;  2NVQ I;  3HOY I;  3LUS A;  1QVG Y;  4Y7N I;  1YIJ Z;  2QRD B;  1VQ4 1;  4EWC A;  1YJ9 Z;  2LFU A;  2DE7 A;  5IP9 I;  2OZK A;  1RQF A;  1Q82 2;  3GTM I;  2JUB A;  4BXX I;  3S14 I;  1USP A;  2O53 A;  3BG0 B;  1ZB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...