3CCM1

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccm100
3CCS1 1VQK1 1YITZ 1N8R1 1QVFZ 1VQLZ 2QA4Z 1KC81 3CCJ1 1VQ5Z 3CPWY 3CD6Z 3G71Z 3CCE1 1VQOZ 3CCL1 2OTJ1 3CC21 1YJ9Z 1JJ2Z 1YHQZ 1Q7Y2 3CCQ1 3CC4Z 3I561 1YI21 3CC71 1M1K2 1VQ41 1M901 3CCVZ 1KD11 1YJW1 1JJ2Y 2QEX1 1VQ71 1Q811 3CCU1 3CCRZ 2OTLZ 1YJNZ 3OW2Z 1K8A1 1VQP1 1YIJZ 1VQ81 1Q822 1YIT1 1VQL1 1VQNZ 1K9M2 2QA41 1S72Z 3CCMZ 1VQ51 3CD61 3G4SZ 3G711 3I551 1VQO1 3G6E1 3CCSZ 1VQ6Z 1YJ91 3OW2Y 1KC82 3CC41 1VQ91 1NJI2 3CMAZ 1K732 1KQSZ 2OTJZ 1VQMZ 1YI2Z 3CXCZ 1W2BZ 1Q861 3CMEZ 2OTL1 3CCR1 1VQ4Z 1YJN1 1M902 1KD12 1KQSY 1QVGY 1S721 1VQKZ 3CCM1 1Q812 3CCUZ 1N8R2 1YHQ1 3CXCY 1Q7Y1 1W2BY 1VQ8Z 3CCJZ 1VQ61 1M1K1 3CCEZ 3CCLZ 3CC2Z 1QVGZ 1NJI1 3CMA1 3I55Z 3CCQZ 3CCV1 1K731 3I56Z 3G6EZ 3CC7Z 1VQM1 1VQ9Z 1YIJ1 1QVFY 3CME1 1YJWZ 1Q821 3CPWZ 1VQN1 2QEXZ 1VQ7Z 1K9M1 1K8A2 3G4S1 1VQPZ 1Q862
chains in the Genus database with same CATH superfamily
2ZAEB 1YITZ 3S17I 1ML8A 1VQLZ 2E2II 2K3RA 2J6AA 2RHBA 1KC81 4BBSI 1LQLA 2NVTI 4RV9A 2EGTA 3RZOI 2V45A 4BY7I 2OTJ1 1JJ2Z 1SIWA 3H0GI 4RVHA 1Q7Y2 3PO3S 4TNUA 3VMHA 2P28A 3GTJI 2LFUA 3NH8A 2QLVB 3J80f 4RVGA 1WIIA 1X0TA 2JR6A 2B63I 3D2LA 3VMGA 1ZH1A 3S1QI 3ESWA 4NOZA 1K8A1 2JNYA 2LEXA 3JAMf 1VQ81 4HH4A 2QRCB 2NVXI 2VPZA 1RO4A 2VPWA 1TWHI 3CCMZ 3QWUA 2F4OA 3S1MI 1VQ51 3CD61 4E2WA 3G711 4E2XA 1VLAA 3G6E1 3OW2Y 2GTIA 1USPB 3K7AI 3CC41 3S1NI 1K732 4A3MI 3FQMA 3GTQI 2QRDB 3PO3I 4EWCA 5D1OA 1TWFI 4NBHA 2WAQA 3I07A 1VQ4Z 2AKLA 4HGYA 2JA7I 5LL6f 1KQSY 3HOVI 2R93I 3CCUZ 2WB1A 3S2DI 2M6NA 4RVDA 3I55Z 1K731 3JAMb 3P5JB 4XX2A 2G2KA 2F4MA 2GU2A 4QTUA 1VQ9Z 1TWAI 1QVFY 5C3EI 3CME1 1Q821 3EEDA 4A3CI 2JMOA 4DGLA 3LUSA 3S2HI 1NUIA 1QVFZ 4E32A 3CCJ1 1VQ5Z 3CPWY 2E7ZA 3G71Z 3CD6Z 3T4NB 3GTKI 3KIHA 3CCL1 1TWCI 3CCQ1 3CC4Z 2R6MA 1QF8A 1FDIA 1M1K2 4BY1I 3S1RI 1VQ41 3S14I 1YUKA 3TDHB 4Y52I 2Y0SA 2JIOA 1JJ2Y 1Q811 3CCU1 1Y8CA 2PM9A 1FDOA 2JIQA 3GCFA 2JIPA 4A3JI 1L1OC 1VQNZ 1K9M2 2H85A 2QA41 3NH4A 4NBAA 3I551 4E2YA 3GTGI 2IV2X 4NBEA 1QXFA 2QREB 2K5RA 3VTNA 1VQ91 1P9NA 2O4HA 4A3EI 4A3GI 4BXXI 2V3VA 2W04A 3CXCZ 2JA8I 1W2BZ 1Q861 5A2Qf 2R92I 3CMEZ 2OTL1 2LIYA 1YJN1 1M902 1KD12 2VUMI 1S721 3BG0B 2M48A 4A3LI 3GTPI 1Q7Y1 3D6WA 1NP6A 3CCJZ 3CCLZ 3MZKB 3HOZI 5IT9f 3CCQZ 4CL1A 1RO2A 1Y1VS 2IZ4A 3IR7A 2QR1B 3GTMS 1N2FA 2JIRA 2VUGA 2GTHA 2JUBA 1VQN1 5T67A 4E2ZA 1Y1WI 1JWHC 1VQK1 4A3KI 3BG1B 5CM2M 5C44I 2NVYI 2QA4Z 2BJOA 4A93I 3HOXI 3CCE1 5A2Qb 3H3VJ 1YHQZ 3I561 1WZNA 2QKDA 3CC71 2RT9A 4NB9A 4E30A 3NFZA 1Y1VI 3RZDI 1USPA 3NDJA 1RQFA 3GTMI 2E2JI 2HU9A 3HOUI 3I4NI 3CCVZ 1VQ71 4NB8A 2P3YA 2OTLZ 1KRLA 1YJNZ 2V8IA 1WCMI 1VQP1 1YIJZ 1RLYA 5IT9b 1S72Z 2Q4ZA 2E9HA 3GTOI 3KIFA 3FQQA 1VQO1 3CCSZ 1YJ91 4MD8A 1PFTA 1AA6A 1I3QI 1KC82 2Q51A 3VB9A 4RVFA 1NJI2 4AYBA 1SFOI 2VPXA 4E31A 4NFRA 3NDIA 2JA6I 5C4XI 4HGZA 1YI2Z 3M3YI 2DE6A 4MD7A 2JA5I 3MONA 3CCR1 2DE7A 5T64A 1TFIA 1WJ2A 1QVGY 2W03A 3M4OI 1VQKZ 1N8R2 4X6AI 1YHQ1 2O53A 3CXCY 1W2BY 1VQ61 3PO2I 5D1OB 1M1K1 3CCEZ 2KPIA 4A3II 1QVGZ 2I3CA 1NJI1 3CMA1 2NVQI 3S16I 3CCV1 4A3FI 4Y7NI 3I56Z 2OZKA 3CC7Z 1VQM1 4S1TA 4MD9A 4RS4A 2VF1A 2HF1A 1Z02A 1YIJ1 2E2HI 1VQ7Z 1K9M1 4A3BI 3Q87A 1VQPZ 2PK7A 1Z01A 4MH4A 5FLXb 3CCS1 3HOWI 3F3PC 1N8R1 3S15I 5T6BA 1I50I 1YUAA 2PMZA 2AYDA 2RPRA 1VQOZ 3NH5A 3CC21 1YJ9Z 2DE5A 2IZ3A 4NBBA 4A3DI 1YI21 4MRIA 3FKII 4NBCA 3J81b 3IFUA 1X3WA 1M901 3GTLI 2RIQA 1TWGI 1Z03A 1KD11 1YJW1 2YU9I 2V8JA 2QEX1 4QTTA 3CCRZ 3OW2Z 3EERA 5AN9F 3J7A4 1Q822 1YIT1 1VQL1 1ZB8A 2YADA 1X3ZA 3HOYI 3G4SZ 5IP9I 3F3FC 2NAPA 2R7ZI 1VQ6Z 1Q16A 3J80b 2JS4A 1I6HI 4E33A 3CQZI 2RBLA 2KI7B 5FLMI 3CMAZ 4MONA 3IX0A 3TE5B 1KQSZ 1VQMZ 2OTJZ 2OOYB 4MXUA 3MZLB 1RO0A 4NBDA 1ZB9A 1K83I 1S7MA 3D9XA 3HKZA 4DQYB 3U50C 4BBRI 1QYPA 3CCM1 1Q812 2JIMA 1VQ8Z 5FLXf 3IF8A 3CC2Z 2VPYA 4NBGA 3G6EZ 3I4MI 1RNIA 1R9TI 2OOXB 3VMIA 2V8KA 4NH1C 1YJWZ 3CPWZ 4DK1A 1WW9A 5C4JI 2QEXZ 3J81f 3GKQA 4NBFA 1K8A2 3G4S1 5IP7I 1DL6A 5D1PA 1Q862
chains in the Genus database with same CATH topology
2ZAEB 1YITZ 3S17I 1ML8A 1VQLZ 2E2II 2K3RA 2J6AA 2RHBA 1KC81 4BBSI 1LQLA 2NVTI 4RV9A 2EGTA 3RZOI 4BY7I 2OTJ1 1JJ2Z 3H0GI 4RVHA 1Q7Y2 3PO3S 4TNUA 3VMHA 2P28A 3GTJI 2LFUA 3NH8A 2QLVB 3J80f 4RVGA 1WIIA 1X0TA 2JR6A 2B63I 3VMGA 1ZH1A 3S1QI 3ESWA 4NOZA 1K8A1 2JNYA 3JAMf 1VQ81 4HH4A 2QRCB 2NVXI 1RO4A 1TWHI 3CCMZ 3QWUA 2F4OA 3S1MI 1VQ51 3CD61 4E2WA 3G711 4E2XA 1VLAA 3G6E1 3OW2Y 2GTIA 1USPB 3K7AI 3CC41 3S1NI 1K732 4A3MI 3FQMA 3GTQI 2QRDB 3PO3I 4EWCA 5D1OA 1TWFI 4NBHA 2WAQA 3I07A 1VQ4Z 2AKLA 4HGYA 2JA7I 5LL6f 1KQSY 3HOVI 2R93I 3CCUZ 2WB1A 3S2DI 2M6NA 4RVDA 3I55Z 1K731 3JAMb 3P5JB 4XX2A 2G2KA 2F4MA 2GU2A 4QTUA 1VQ9Z 1TWAI 1QVFY 5C3EI 3CME1 1Q821 3EEDA 4A3CI 2JMOA 4DGLA 3LUSA 3S2HI 1NUIA 1QVFZ 4E32A 3CCJ1 1VQ5Z 3CPWY 3CD6Z 3G71Z 3GTKI 3T4NB 3KIHA 3CCL1 1TWCI 3CCQ1 3CC4Z 2R6MA 1QF8A 1M1K2 4BY1I 3S1RI 1VQ41 3S14I 1YUKA 3TDHB 4Y52I 2Y0SA 1JJ2Y 1Q811 3CCU1 2PM9A 3GCFA 4A3JI 1L1OC 1VQNZ 1K9M2 2H85A 2QA41 3NH4A 4NBAA 3I551 4E2YA 3GTGI 4NBEA 2QREB 2K5RA 3VTNA 1VQ91 1P9NA 2O4HA 4A3EI 4A3GI 4BXXI 2W04A 3CXCZ 2JA8I 1W2BZ 1Q861 5A2Qf 2R92I 3CMEZ 2OTL1 2LIYA 1YJN1 1M902 1KD12 2VUMI 1S721 3BG0B 2M48A 4A3LI 3GTPI 1Q7Y1 3D6WA 1NP6A 3CCJZ 3CCLZ 3MZKB 3HOZI 5IT9f 3CCQZ 4CL1A 1RO2A 1Y1VS 2IZ4A 2QR1B 3GTMS 1N2FA 2VUGA 2GTHA 2JUBA 1VQN1 5T67A 4E2ZA 1Y1WI 1JWHC 1VQK1 4A3KI 3BG1B 5CM2M 5C44I 2NVYI 2QA4Z 2BJOA 4A93I 3HOXI 3CCE1 5A2Qb 3H3VJ 1YHQZ 3I561 2QKDA 3CC71 2RT9A 4NB9A 4E30A 3NFZA 1Y1VI 3RZDI 1USPA 3NDJA 1RQFA 3GTMI 2E2JI 2HU9A 3HOUI 3I4NI 3CCVZ 1VQ71 4NB8A 2P3YA 2OTLZ 1KRLA 1YJNZ 2V8IA 1WCMI 1VQP1 1YIJZ 1RLYA 5IT9b 1S72Z 2Q4ZA 2E9HA 3GTOI 3KIFA 3FQQA 1VQO1 3CCSZ 1YJ91 4MD8A 1PFTA 1I3QI 1KC82 2Q51A 3VB9A 4RVFA 1NJI2 4AYBA 1SFOI 4E31A 4NFRA 3NDIA 2JA6I 5C4XI 4HGZA 1YI2Z 3M3YI 2DE6A 4MD7A 2JA5I 3MONA 3CCR1 2DE7A 5T64A 1TFIA 1QVGY 2W03A 3M4OI 1VQKZ 1N8R2 4X6AI 1YHQ1 2O53A 3CXCY 1W2BY 1VQ61 3PO2I 5D1OB 1M1K1 3CCEZ 2KPIA 4A3II 1QVGZ 2I3CA 1NJI1 3CMA1 2NVQI 3S16I 3CCV1 4A3FI 4Y7NI 3I56Z 2OZKA 3CC7Z 1VQM1 4S1TA 4MD9A 4RS4A 2VF1A 2HF1A 1Z02A 1YIJ1 2E2HI 1VQ7Z 1K9M1 4A3BI 3Q87A 1VQPZ 2PK7A 1Z01A 4MH4A 5FLXb 3CCS1 3HOWI 3F3PC 1N8R1 3S15I 5T6BA 1I50I 1YUAA 2PMZA 2RPRA 1VQOZ 3NH5A 3CC21 1YJ9Z 2DE5A 2IZ3A 4NBBA 4A3DI 1YI21 4MRIA 3FKII 4NBCA 3J81b 3IFUA 1X3WA 1M901 3GTLI 2RIQA 1TWGI 1Z03A 1KD11 1YJW1 2YU9I 2V8JA 2QEX1 4QTTA 3CCRZ 3OW2Z 3EERA 5AN9F 3J7A4 1Q822 1YIT1 1VQL1 1ZB8A 2YADA 1X3ZA 3HOYI 3G4SZ 5IP9I 3F3FC 2R7ZI 1VQ6Z 3J80b 2JS4A 1I6HI 4E33A 3CQZI 2RBLA 2KI7B 5FLMI 3CMAZ 4MONA 3IX0A 3TE5B 1KQSZ 1VQMZ 2OTJZ 2OOYB 4MXUA 3MZLB 1RO0A 4NBDA 1ZB9A 1K83I 1S7MA 3D9XA 3HKZA 4DQYB 3U50C 4BBRI 1QYPA 3CCM1 1Q812 1VQ8Z 5FLXf 3IF8A 3CC2Z 4NBGA 3G6EZ 3I4MI 1RNIA 1R9TI 2OOXB 3VMIA 2V8KA 4NH1C 1YJWZ 3CPWZ 4DK1A 1WW9A 5C4JI 2QEXZ 3J81f 3GKQA 4NBFA 1K8A2 3G4S1 5IP7I 1DL6A 5D1PA 1Q862
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCS 1;  1VQK 1;  1YIT Z;  1N8R 1;  1QVF Z;  1VQL Z;  2QA4 Z;  1KC8 1;  3CCJ 1;  1VQ5 Z;  3CPW Y;  3CD6 Z;  3G71 Z;  3CCE 1;  1VQO Z;  3CCL 1;  2OTJ 1;  3CC2 1;  1YJ9 Z;  1JJ2 Z;  1YHQ Z;  1Q7Y 2;  3CCQ 1;  3CC4 Z;  3I56 1;  1YI2 1;  3CC7 1;  1M1K 2;  1VQ4 1;  1M90 1;  3CCV Z;  1KD1 1;  1YJW 1;  1JJ2 Y;  2QEX 1;  1VQ7 1;  1Q81 1;  3CCU 1;  3CCR Z;  2OTL Z;  1YJN Z;  3OW2 Z;  1K8A 1;  1VQP 1;  1YIJ Z;  1VQ8 1;  1Q82 2;  1YIT 1;  1VQL 1;  1VQN Z;  1K9M 2;  2QA4 1;  1S72 Z;  3CCM Z;  1VQ5 1;  3CD6 1;  3G4S Z;  3G71 1;  3I55 1;  1VQO 1;  3G6E 1;  3CCS Z;  1VQ6 Z;  1YJ9 1;  3OW2 Y;  1KC8 2;  3CC4 1;  1VQ9 1;  1NJI 2;  3CMA Z;  1K73 2;  1KQS Z;  2OTJ Z;  1VQM Z;  1YI2 Z;  3CXC Z;  1W2B Z;  1Q86 1;  3CME Z;  2OTL 1;  3CCR 1;  1VQ4 Z;  1YJN 1;  1M90 2;  1KD1 2;  1KQS Y;  1QVG Y;  1S72 1;  1VQK Z;  3CCM 1;  1Q81 2;  3CCU Z;  1N8R 2;  1YHQ 1;  3CXC Y;  1Q7Y 1;  1W2B Y;  1VQ8 Z;  3CCJ Z;  1VQ6 1;  1M1K 1;  3CCE Z;  3CCL Z;  3CC2 Z;  1QVG Z;  1NJI 1;  3CMA 1;  3I55 Z;  3CCQ Z;  3CCV 1;  1K73 1;  3I56 Z;  3G6E Z;  3CC7 Z;  1VQM 1;  1VQ9 Z;  1YIJ 1;  1QVF Y;  3CME 1;  1YJW Z;  1Q82 1;  3CPW Z;  1VQN 1;  2QEX Z;  1VQ7 Z;  1K9M 1;  1K8A 2;  3G4S 1;  1VQP Z;  1Q86 2; 
#chains in the Genus database with same CATH topology
 2ZAE B;  1YIT Z;  3S17 I;  1ML8 A;  1VQL Z;  2E2I I;  2K3R A;  2J6A A;  2RHB A;  1KC8 1;  4BBS I;  1LQL A;  2NVT I;  4RV9 A;  2EGT A;  3RZO I;  2V45 A;  4BY7 I;  2OTJ 1;  1JJ2 Z;  1SIW A;  3H0G I;  4RVH A;  1Q7Y 2;  3PO3 S;  4TNU A;  3VMH A;  2P28 A;  3GTJ I;  2LFU A;  3NH8 A;  2QLV B;  3J80 f;  4RVG A;  1WII A;  1X0T A;  2JR6 A;  2B63 I;  3D2L A;  3VMG A;  1ZH1 A;  3S1Q I;  3ESW A;  4NOZ A;  1K8A 1;  2JNY A;  2LEX A;  3JAM f;  1VQ8 1;  4HH4 A;  2QRC B;  2NVX I;  2VPZ A;  1RO4 A;  2VPW A;  1TWH I;  3CCM Z;  3QWU A;  2F4O A;  3S1M I;  1VQ5 1;  3CD6 1;  4E2W A;  3G71 1;  4E2X A;  1VLA A;  3G6E 1;  3OW2 Y;  2GTI A;  1USP B;  3K7A I;  3CC4 1;  3S1N I;  1K73 2;  4A3M I;  3FQM A;  3GTQ I;  2QRD B;  3PO3 I;  4EWC A;  5D1O A;  1TWF I;  4NBH A;  2WAQ A;  3I07 A;  1VQ4 Z;  2AKL A;  4HGY A;  2JA7 I;  5LL6 f;  1KQS Y;  3HOV I;  2R93 I;  3CCU Z;  2WB1 A;  3S2D I;  2M6N A;  4RVD A;  3I55 Z;  1K73 1;  3JAM b;  3P5J B;  4XX2 A;  2G2K A;  2F4M A;  2GU2 A;  4QTU A;  1VQ9 Z;  1TWA I;  1QVF Y;  5C3E I;  3CME 1;  1Q82 1;  3EED A;  4A3C I;  2JMO A;  4DGL A;  3LUS A;  3S2H I;  1NUI A;  1QVF Z;  4E32 A;  3CCJ 1;  1VQ5 Z;  3CPW Y;  2E7Z A;  3G71 Z;  3CD6 Z;  3T4N B;  3GTK I;  3KIH A;  3CCL 1;  1TWC I;  3CCQ 1;  3CC4 Z;  2R6M A;  1QF8 A;  1FDI A;  1M1K 2;  4BY1 I;  3S1R I;  1VQ4 1;  3S14 I;  1YUK A;  3TDH B;  4Y52 I;  2Y0S A;  2JIO A;  1JJ2 Y;  1Q81 1;  3CCU 1;  1Y8C A;  2PM9 A;  1FDO A;  2JIQ A;  3GCF A;  2JIP A;  4A3J I;  1L1O C;  1VQN Z;  1K9M 2;  2H85 A;  2QA4 1;  3NH4 A;  4NBA A;  3I55 1;  4E2Y A;  3GTG I;  2IV2 X;  4NBE A;  1QXF A;  2QRE B;  2K5R A;  3VTN A;  1VQ9 1;  1P9N A;  2O4H A;  4A3E I;  4A3G I;  4BXX I;  2V3V A;  2W04 A;  3CXC Z;  2JA8 I;  1W2B Z;  1Q86 1;  5A2Q f;  2R92 I;  3CME Z;  2OTL 1;  2LIY A;  1YJN 1;  1M90 2;  1KD1 2;  2VUM I;  1S72 1;  3BG0 B;  2M48 A;  4A3L I;  3GTP I;  1Q7Y 1;  3D6W A;  1NP6 A;  3CCJ Z;  3CCL Z;  3MZK B;  3HOZ I;  5IT9 f;  3CCQ Z;  4CL1 A;  1RO2 A;  1Y1V S;  2IZ4 A;  3IR7 A;  2QR1 B;  3GTM S;  1N2F A;  2JIR A;  2VUG A;  2GTH A;  2JUB A;  1VQN 1;  5T67 A;  4E2Z A;  1Y1W I;  1JWH C;  1VQK 1;  4A3K I;  3BG1 B;  5CM2 M;  5C44 I;  2NVY I;  2QA4 Z;  2BJO A;  4A93 I;  3HOX I;  3CCE 1;  5A2Q b;  3H3V J;  1YHQ Z;  3I56 1;  1WZN A;  2QKD A;  3CC7 1;  2RT9 A;  4NB9 A;  4E30 A;  3NFZ A;  1Y1V I;  3RZD I;  1USP A;  3NDJ A;  1RQF A;  3GTM I;  2E2J I;  2HU9 A;  3HOU I;  3I4N I;  3CCV Z;  1VQ7 1;  4NB8 A;  2P3Y A;  2OTL Z;  1KRL A;  1YJN Z;  2V8I A;  1WCM I;  1VQP 1;  1YIJ Z;  1RLY A;  5IT9 b;  1S72 Z;  2Q4Z A;  2E9H A;  3GTO I;  3KIF A;  3FQQ A;  1VQO 1;  3CCS Z;  1YJ9 1;  4MD8 A;  1PFT A;  1AA6 A;  1I3Q I;  1KC8 2;  2Q51 A;  3VB9 A;  4RVF A;  1NJI 2;  4AYB A;  1SFO I;  2VPX A;  4E31 A;  4NFR A;  3NDI A;  2JA6 I;  5C4X I;  4HGZ A;  1YI2 Z;  3M3Y I;  2DE6 A;  4MD7 A;  2JA5 I;  3MON A;  3CCR 1;  2DE7 A;  5T64 A;  1TFI A;  1WJ2 A;  1QVG Y;  2W03 A;  3M4O I;  1VQK Z;  1N8R 2;  4X6A I;  1YHQ 1;  2O53 A;  3CXC Y;  1W2B Y;  1VQ6 1;  3PO2 I;  5D1O B;  1M1K 1;  3CCE Z;  2KPI A;  4A3I I;  1QVG Z;  2I3C A;  1NJI 1;  3CMA 1;  2NVQ I;  3S16 I;  3CCV 1;  4A3F I;  4Y7N I;  3I56 Z;  2OZK A;  3CC7 Z;  1VQM 1;  4S1T A;  4MD9 A;  4RS4 A;  2VF1 A;  2HF1 A;  1Z02 A;  1YIJ 1;  2E2H I;  1VQ7 Z;  1K9M 1;  4A3B I;  3Q87 A;  1VQP Z;  2PK7 A;  1Z01 A;  4MH4 A;  5FLX b;  3CCS 1;  3HOW I;  3F3P C;  1N8R 1;  3S15 I;  5T6B A;  1I50 I;  1YUA A;  2PMZ A;  2AYD A;  2RPR A;  1VQO Z;  3NH5 A;  3CC2 1;  1YJ9 Z;  2DE5 A;  2IZ3 A;  4NBB A;  4A3D I;  1YI2 1;  4MRI A;  3FKI I;  4NBC A;  3J81 b;  3IFU A;  1X3W A;  1M90 1;  3GTL I;  2RIQ A;  1TWG I;  1Z03 A;  1KD1 1;  1YJW 1;  2YU9 I;  2V8J A;  2QEX 1;  4QTT A;  3CCR Z;  3OW2 Z;  3EER A;  5AN9 F;  3J7A 4;  1Q82 2;  1YIT 1;  1VQL 1;  1ZB8 A;  2YAD A;  1X3Z A;  3HOY I;  3G4S Z;  5IP9 I;  3F3F C;  2NAP A;  2R7Z I;  1VQ6 Z;  1Q16 A;  3J80 b;  2JS4 A;  1I6H I;  4E33 A;  3CQZ I;  2RBL A;  2KI7 B;  5FLM I;  3CMA Z;  4MON A;  3IX0 A;  3TE5 B;  1KQS Z;  1VQM Z;  2OTJ Z;  2OOY B;  4MXU A;  3MZL B;  1RO0 A;  4NBD A;  1ZB9 A;  1K83 I;  1S7M A;  3D9X A;  3HKZ A;  4DQY B;  3U50 C;  4BBR I;  1QYP A;  3CCM 1;  1Q81 2;  2JIM A;  1VQ8 Z;  5FLX f;  3IF8 A;  3CC2 Z;  2VPY A;  4NBG A;  3G6E Z;  3I4M I;  1RNI A;  1R9T I;  2OOX B;  3VMI A;  2V8K A;  4NH1 C;  1YJW Z;  3CPW Z;  4DK1 A;  1WW9 A;  5C4J I;  2QEX Z;  3J81 f;  3GKQ A;  4NBF A;  1K8A 2;  3G4S 1;  5IP7 I;  1DL6 A;  5D1P A;  1Q86 2; 
#chains in the Genus database with same CATH homology
 2ZAE B;  1YIT Z;  3S17 I;  1ML8 A;  1VQL Z;  2E2I I;  2K3R A;  2J6A A;  2RHB A;  1KC8 1;  4BBS I;  1LQL A;  2NVT I;  4RV9 A;  2EGT A;  3RZO I;  4BY7 I;  2OTJ 1;  1JJ2 Z;  3H0G I;  4RVH A;  1Q7Y 2;  3PO3 S;  4TNU A;  3VMH A;  2P28 A;  3GTJ I;  2LFU A;  3NH8 A;  2QLV B;  3J80 f;  4RVG A;  1WII A;  1X0T A;  2JR6 A;  2B63 I;  3VMG A;  1ZH1 A;  3S1Q I;  3ESW A;  4NOZ A;  1K8A 1;  2JNY A;  3JAM f;  1VQ8 1;  4HH4 A;  2QRC B;  2NVX I;  1RO4 A;  1TWH I;  3CCM Z;  3QWU A;  2F4O A;  3S1M I;  1VQ5 1;  3CD6 1;  4E2W A;  3G71 1;  4E2X A;  1VLA A;  3G6E 1;  3OW2 Y;  2GTI A;  1USP B;  3K7A I;  3CC4 1;  3S1N I;  1K73 2;  4A3M I;  3FQM A;  3GTQ I;  2QRD B;  3PO3 I;  4EWC A;  5D1O A;  1TWF I;  4NBH A;  2WAQ A;  3I07 A;  1VQ4 Z;  2AKL A;  4HGY A;  2JA7 I;  5LL6 f;  1KQS Y;  3HOV I;  2R93 I;  3CCU Z;  2WB1 A;  3S2D I;  2M6N A;  4RVD A;  3I55 Z;  1K73 1;  3JAM b;  3P5J B;  4XX2 A;  2G2K A;  2F4M A;  2GU2 A;  4QTU A;  1VQ9 Z;  1TWA I;  1QVF Y;  5C3E I;  3CME 1;  1Q82 1;  3EED A;  4A3C I;  2JMO A;  4DGL A;  3LUS A;  3S2H I;  1NUI A;  1QVF Z;  4E32 A;  3CCJ 1;  1VQ5 Z;  3CPW Y;  3CD6 Z;  3G71 Z;  3GTK I;  3T4N B;  3KIH A;  3CCL 1;  1TWC I;  3CCQ 1;  3CC4 Z;  2R6M A;  1QF8 A;  1M1K 2;  4BY1 I;  3S1R I;  1VQ4 1;  3S14 I;  1YUK A;  3TDH B;  4Y52 I;  2Y0S A;  1JJ2 Y;  1Q81 1;  3CCU 1;  2PM9 A;  3GCF A;  4A3J I;  1L1O C;  1VQN Z;  1K9M 2;  2H85 A;  2QA4 1;  3NH4 A;  4NBA A;  3I55 1;  4E2Y A;  3GTG I;  4NBE A;  2QRE B;  2K5R A;  3VTN A;  1VQ9 1;  1P9N A;  2O4H A;  4A3E I;  4A3G I;  4BXX I;  2W04 A;  3CXC Z;  2JA8 I;  1W2B Z;  1Q86 1;  5A2Q f;  2R92 I;  3CME Z;  2OTL 1;  2LIY A;  1YJN 1;  1M90 2;  1KD1 2;  2VUM I;  1S72 1;  3BG0 B;  2M48 A;  4A3L I;  3GTP I;  1Q7Y 1;  3D6W A;  1NP6 A;  3CCJ Z;  3CCL Z;  3MZK B;  3HOZ I;  5IT9 f;  3CCQ Z;  4CL1 A;  1RO2 A;  1Y1V S;  2IZ4 A;  2QR1 B;  3GTM S;  1N2F A;  2VUG A;  2GTH A;  2JUB A;  1VQN 1;  5T67 A;  4E2Z A;  1Y1W I;  1JWH C;  1VQK 1;  4A3K I;  3BG1 B;  5CM2 M;  5C44 I;  2NVY I;  2QA4 Z;  2BJO A;  4A93 I;  3HOX I;  3CCE 1;  5A2Q b;  3H3V J;  1YHQ Z;  3I56 1;  2QKD A;  3CC7 1;  2RT9 A;  4NB9 A;  4E30 A;  3NFZ A;  1Y1V I;  3RZD I;  1USP A;  3NDJ A;  1RQF A;  3GTM I;  2E2J I;  2HU9 A;  3HOU I;  3I4N I;  3CCV Z;  1VQ7 1;  4NB8 A;  2P3Y A;  2OTL Z;  1KRL A;  1YJN Z;  2V8I A;  1WCM I;  1VQP 1;  1YIJ Z;  1RLY A;  5IT9 b;  1S72 Z;  2Q4Z A;  2E9H A;  3GTO I;  3KIF A;  3FQQ A;  1VQO 1;  3CCS Z;  1YJ9 1;  4MD8 A;  1PFT A;  1I3Q I;  1KC8 2;  2Q51 A;  3VB9 A;  4RVF A;  1NJI 2;  4AYB A;  1SFO I;  4E31 A;  4NFR A;  3NDI A;  2JA6 I;  5C4X I;  4HGZ A;  1YI2 Z;  3M3Y I;  2DE6 A;  4MD7 A;  2JA5 I;  3MON A;  3CCR 1;  2DE7 A;  5T64 A;  1TFI A;  1QVG Y;  2W03 A;  3M4O I;  1VQK Z;  1N8R 2;  4X6A I;  1YHQ 1;  2O53 A;  3CXC Y;  1W2B Y;  1VQ6 1;  3PO2 I;  5D1O B;  1M1K 1;  3CCE Z;  2KPI A;  4A3I I;  1QVG Z;  2I3C A;  1NJI 1;  3CMA 1;  2NVQ I;  3S16 I;  3CCV 1;  4A3F I;  4Y7N I;  3I56 Z;  2OZK A;  3CC7 Z;  1VQM 1;  4S1T A;  4MD9 A;  4RS4 A;  2VF1 A;  2HF1 A;  1Z02 A;  1YIJ 1;  2E2H I;  1VQ7 Z;  1K9M 1;  4A3B I;  3Q87 A;  1VQP Z;  2PK7 A;  1Z01 A;  4MH4 A;  5FLX b;  3CCS 1;  3HOW I;  3F3P C;  1N8R 1;  3S15 I;  5T6B A;  1I50 I;  1YUA A;  2PMZ A;  2RPR A;  1VQO Z;  3NH5 A;  3CC2 1;  1YJ9 Z;  2DE5 A;  2IZ3 A;  4NBB A;  4A3D I;  1YI2 1;  4MRI A;  3FKI I;  4NBC A;  3J81 b;  3IFU A;  1X3W A;  1M90 1;  3GTL I;  2RIQ A;  1TWG I;  1Z03 A;  1KD1 1;  1YJW 1;  2YU9 I;  2V8J A;  2QEX 1;  4QTT A;  3CCR Z;  3OW2 Z;  3EER A;  5AN9 F;  3J7A 4;  1Q82 2;  1YIT 1;  1VQL 1;  1ZB8 A;  2YAD A;  1X3Z A;  3HOY I;  3G4S Z;  5IP9 I;  3F3F C;  2R7Z I;  1VQ6 Z;  3J80 b;  2JS4 A;  1I6H I;  4E33 A;  3CQZ I;  2RBL A;  2KI7 B;  5FLM I;  3CMA Z;  4MON A;  3IX0 A;  3TE5 B;  1KQS Z;  1VQM Z;  2OTJ Z;  2OOY B;  4MXU A;  3MZL B;  1RO0 A;  4NBD A;  1ZB9 A;  1K83 I;  1S7M A;  3D9X A;  3HKZ A;  4DQY B;  3U50 C;  4BBR I;  1QYP A;  3CCM 1;  1Q81 2;  1VQ8 Z;  5FLX f;  3IF8 A;  3CC2 Z;  4NBG A;  3G6E Z;  3I4M I;  1RNI A;  1R9T I;  2OOX B;  3VMI A;  2V8K A;  4NH1 C;  1YJW Z;  3CPW Z;  4DK1 A;  1WW9 A;  5C4J I;  2QEX Z;  3J81 f;  3GKQ A;  4NBF A;  1K8A 2;  3G4S 1;  5IP7 I;  1DL6 A;  5D1P A;  1Q86 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...