3I4NI

8-oxoguanine containing rna polymerase ii elongation complex e
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
117
structure length
117
Chain Sequence
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 9
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3i4nI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3i4nI02
4QTUA 4A3BI 2E2JI 3GTLI 1LQLA 2VUMI 2B63I 3GKQA 3M3YI 4NBCA 4NBEA 5C44I 3HOVI 1I3QI 1TWHI 3GTPI 2R7ZI 4BY7I 1USPA 1RO4A 2HF1A 4A3II 1L1OC 4A3LI 2J6AA 1ZB9A 1X3WA 1QYPA 3M4OI 3S15I 2JA8I 5C3EI 3S14I 4Y7NI 4Y52I 2NVTI 4NBFA 2NVXI 5FLMI 4A3MI 3LUSA 3VB9A 5IP7I 4NB8A 2RBLA 4XX2A 4NBGA 1TWFI 3RZOI 3VMHA 2NVQI 3HOZI 2JA7I 3I4MI 4NB9A 1N2FA 4A3JI 4NBBA 3S17I 3S16I 4A3GI 1TFIA 1ZB8A 4A3CI 3I4NI 4BXXI 1USPB 3GTJI 5CM2M 3S1RI 1X3ZA 4BBSI 3HOXI 3S2HI 2JNYA 3EERA 1NUIA 1TWGI 3PO3S 3I07A 4NBDA 3S1NI 5IP9I 2AKLA 3GTKI 2P3YA 4X6AI 1ML8A 2E2II 3D6WA 4MH4A 4QTTA 2DE7A 1WCMI 3GTMS 3VMGA 3H0GI 3HOUI 1RLYA 3HOYI 3GTGI 3PO3I 2E2HI 2R92I 4NBAA 3GTOI 2JS4A 3PO2I 2K5RA 3ESWA 3CQZI 1SFOI 3RZDI 1TWCI 4BY1I 1YUAA 1I6HI 1I50I 3GTMI 3K7AI 2R93I 4A3EI 3FKII 4A3KI 4NBHA 4BBRI 1PFTA 1R9TI 2JA5I 1Y1VS 5C4XI 5C4JI 2BJOA 2F4OA 1VLAA 3GCFA 1WW9A 2PK7A 4NOZA 3Q87A 2YU9I 3GTQI 3S2DI 1K83I 2NVYI 2JR6A 1DL6A 3HOWI 2DE6A 1Y1WI 2DE5A 4A3FI 4A93I 3VMIA 4A3DI 1Y1VI 3H3VJ 3S1QI 2JA6I 2KPIA 2F4MA 3S1MI 3U50C 1TWAI
chains in the Genus database with same CATH superfamily
1VQ7Z 2V45A 2VUMI 4RV9A 3GKQA 3M3YI 3FQMA 1K732 3HOVI 1USPA 4A3II 2YADA 2QEX1 1QYPA 3CCMZ 1YJW1 3M4OI 1VQ91 1RO2A 2IV2X 3VTNA 3IX0A 4Y7NI 1VQK1 2NVTI 1YJNZ 1WJ2A 1WIIA 2VPYA 1NJI2 4E31A 2RBLA 4NBGA 1ZH1A 3CMAZ 3CC71 3NH8A 3VMHA 1RQFA 2NVQI 3I4MI 1M902 4NB9A 1N2FA 1NP6A 3CCU1 4RS4A 1VQOZ 3NDIA 1QF8A 1QXFA 1X3ZA 4BBSI 2PM9A 4E2YA 1YIJZ 2G2KA 2JIPA 2VF1A 4NBDA 3GTKI 1K8A2 4X6AI 2QA4Z 1KD11 2E2II 2HU9A 3D6WA 3NH5A 4MH4A 1YI21 3H0GI 1RLYA 3TE5B 2R92I 5T6BA 3GTOI 3PO2I 1VQ41 3CME1 1SFOI 3HKZA 1VQLZ 1YIJ1 3NFZA 1Q822 1VQ71 1I50I 4BY1I 4A3EI 1VQP1 1AA6A 4NBHA 4E33A 2QRCB 1R9TI 2JA5I 1Y1VS 5C4JI 3OW2Z 1VLAA 2VUGA 3CCM1 3CCVZ 5T64A 2PK7A 3Q87A 5A2Qb 1YJN1 2GTIA 1Y1WI 2DE5A 4A3FI 1YUKA 3VMIA 1Y1VI 1KC82 1VQ8Z 1LQLA 2LIYA 2VPZA 3MZKB 2M6NA 5C44I 3GTPI 1K731 2R7ZI 3CD6Z 1VQO1 2JIMA 1L1OC 2E7ZA 1ZB9A 3F3FC 4DGLA 2WB1A 3S14I 3JAMb 1Q7Y2 2W03A 3CCRZ 4A3MI 3LUSA 3VB9A 2IZ4A 1NJI1 5A2Qf 1QVFY 1Y8CA 3CCEZ 4HGYA 2QLVB 2KI7B 4CL1A 2OZKA 1Z02A 2QA41 1M901 1VQPZ 4NBBA 1Z03A 2V8IA 1S72Z 1TFIA 1ZB8A 3OW2Y 2I3CA 1QVGZ 2Q51A 4MD8A 4BXXI 1USPB 2GU2A 5CM2M 2R6MA 1VQL1 2V8KA 3G6EZ 3CCQ1 1YHQZ 3EERA 3TDHB 2OTLZ 1VQ6Z 3JAMf 2AKLA 1K8A1 1K9M2 3D9XA 1JJ2Z 3CPWY 3CCV1 4E2WA 4E32A 2OOYB 1KQSZ 3GTMS 3HOUI 3VMGA 3F3PC 4RVGA 3GTGI 2JIRA 4S1TA 2JS4A 4TNUA 3CXCZ 1VQ81 2K3RA 1Q821 3GTMI 2R93I 3IR7A 2M48A 3FKII 3G71Z 4A3KI 3CD61 2QREB 2BJOA 3NDJA 3CCLZ 5T67A 3S2DI 1K83I 2JR6A 1DL6A 3HOWI 3CCR1 1QVGY 3J7A4 2JA6I 1FDOA 1FDIA 2F4MA 3CCE1 3S1MI 1KC81 3U50C 3CCS1 1Q16A 3CCQZ 3J80b 2E2JI 3GTLI 2B63I 4DQYB 2H85A 4NBCA 4NBEA 1I3QI 1S721 4BY7I 2LEXA 1JJ2Y 3CC4Z 4A3LI 1Q862 2QRDB 4DK1A 4E30A 3I56Z 5C3EI 2LFUA 1KRLA 3G6E1 1Q7Y1 1X0TA 1YHQ1 5IP7I 2OTL1 1VQ61 4NB8A 4XX2A 1YITZ 3BG0B 2JUBA 3HOZI 2JA7I 3MONA 3J81b 3CC2Z 2ZAEB 2RHBA 4A3GI 3J80f 1VQNZ 4A3CI 2V8JA 3I4NI 2OTJZ 3GTJI 2AYDA 1Q812 3HOXI 2JNYA 3G711 1NUIA 1JWHC 2O53A 3PO3S 3I07A 1VQ51 2QKDA 3CCSZ 2E9HA 2P3YA 1K9M1 1M1K2 5D1PA 3BG1B 3CCL1 1ML8A 3KIFA 5IT9b 2NAPA 4QTTA 2DE7A 2GTHA 2Y0SA 3HOYI 3KIHA 2EGTA 3PO3I 3J81f 1N8R2 5D1OA 3NH4A 1VQMZ 2IZ3A 2Q4ZA 5LL6f 4AYBA 1YUAA 4E2XA 3K7AI 4HGZA 2JIQA 1Z01A 3IF8A 4BBRI 3FQQA 3CC41 5FLXb 5C4XI 3GCFA 1WW9A 3I561 4NOZA 3GTQI 1RO0A 1W2BZ 2NVYI 5IT9f 2RT9A 2VPWA 4A93I 3H3VJ 3G4SZ 1YIT1 2KPIA 2O4HA 4QTUA 2WAQA 4A3BI 3CC21 4E2ZA 3I55Z 1VQ5Z 1TWHI 1RO4A 2HF1A 4HH4A 1YJ91 1VQN1 2OOXB 2J6AA 1X3WA 1Q861 2OTJ1 3S15I 2JA8I 3CCJZ 5FLXf 4MD7A 4Y52I 4NBFA 4RVHA 2NVXI 3IFUA 3P5JB 5FLMI 4RVFA 1S7MA 4MD9A 1TWFI 3MZLB 2VPXA 4MONA 3RZOI 1WZNA 4MXUA 4A3JI 3S17I 3S16I 2PMZA 2QEXZ 1KQSY 1VQM1 1YJWZ 1VQ9Z 1P9NA 3S1RI 1Q811 1QVFZ 3EEDA 1W2BY 1VQKZ 3S2HI 2RIQA 4NH1C 2V3VA 1TWGI 2W04A 3S1NI 3CXCY 5IP9I 2P28A 3CC7Z 2RPRA 1KD12 1M1K1 2JMOA 1WCMI 3CCUZ 2E2HI 1RNIA 1YJ9Z 1N8R1 4NBAA 3D2LA 2K5RA 3G4S1 3ESWA 3CQZI 3RZDI 3CMA1 1TWCI 3QWUA 4RVDA 1I6HI 2QR1B 3I551 3CPWZ 1PFTA 2F4OA 4MRIA 4EWCA 4NFRA 3T4NB 3CCJ1 2YU9I 1YI2Z 5AN9F 2DE6A 1SIWA 2JIOA 1VQ4Z 4A3DI 3S1QI 3CMEZ 5D1OB 1TWAI
chains in the Genus database with same CATH topology
1VQ7Z 2VUMI 4RV9A 3GKQA 3M3YI 3FQMA 1K732 3HOVI 1USPA 4A3II 2YADA 2QEX1 1QYPA 3CCMZ 1YJW1 3M4OI 1VQ91 1RO2A 3VTNA 3IX0A 4Y7NI 1VQK1 2NVTI 1YJNZ 1WIIA 1NJI2 4E31A 2RBLA 4NBGA 1ZH1A 3CMAZ 3CC71 3NH8A 3VMHA 1RQFA 2NVQI 3I4MI 1M902 4NB9A 1N2FA 1NP6A 3CCU1 4RS4A 1VQOZ 3NDIA 1QF8A 1X3ZA 4BBSI 2PM9A 4E2YA 1YIJZ 2G2KA 2VF1A 4NBDA 3GTKI 1K8A2 4X6AI 2QA4Z 1KD11 2E2II 2HU9A 3D6WA 3NH5A 4MH4A 1YI21 3H0GI 1RLYA 3TE5B 2R92I 5T6BA 3GTOI 3PO2I 1VQ41 3CME1 1SFOI 3HKZA 1VQLZ 1YIJ1 3NFZA 1Q822 1VQ71 1I50I 4BY1I 4A3EI 1VQP1 4NBHA 4E33A 2QRCB 1R9TI 2JA5I 1Y1VS 5C4JI 3OW2Z 1VLAA 2VUGA 3CCM1 3CCVZ 5T64A 2PK7A 3Q87A 5A2Qb 1YJN1 2GTIA 1Y1WI 2DE5A 4A3FI 1YUKA 3VMIA 1Y1VI 1KC82 1VQ8Z 1LQLA 2LIYA 3MZKB 2M6NA 5C44I 3GTPI 1K731 2R7ZI 3CD6Z 1VQO1 1L1OC 1ZB9A 3F3FC 4DGLA 2WB1A 3S14I 3JAMb 1Q7Y2 2W03A 3CCRZ 4A3MI 3LUSA 3VB9A 2IZ4A 1NJI1 5A2Qf 1QVFY 3CCEZ 4HGYA 2QLVB 2KI7B 4CL1A 2OZKA 1Z02A 2QA41 1M901 1VQPZ 4NBBA 1Z03A 2V8IA 1S72Z 1TFIA 1ZB8A 3OW2Y 2I3CA 1QVGZ 2Q51A 4MD8A 4BXXI 1USPB 2GU2A 5CM2M 2R6MA 1VQL1 2V8KA 3G6EZ 3CCQ1 1YHQZ 3EERA 3TDHB 2OTLZ 1VQ6Z 3JAMf 2AKLA 1K8A1 1K9M2 3D9XA 1JJ2Z 3CPWY 3CCV1 4E2WA 4E32A 2OOYB 1KQSZ 3GTMS 3HOUI 3VMGA 3F3PC 4RVGA 3GTGI 4S1TA 2JS4A 4TNUA 3CXCZ 1VQ81 2K3RA 1Q821 3GTMI 2R93I 2M48A 3FKII 3G71Z 4A3KI 3CD61 2QREB 2BJOA 3NDJA 3CCLZ 5T67A 3S2DI 1K83I 2JR6A 1DL6A 3HOWI 3CCR1 1QVGY 3J7A4 2JA6I 2F4MA 3CCE1 3S1MI 1KC81 3U50C 3CCS1 3CCQZ 3J80b 2E2JI 3GTLI 2B63I 4DQYB 2H85A 4NBCA 4NBEA 1I3QI 1S721 4BY7I 1JJ2Y 3CC4Z 4A3LI 1Q862 2QRDB 4DK1A 4E30A 3I56Z 5C3EI 2LFUA 1KRLA 3G6E1 1Q7Y1 1X0TA 1YHQ1 5IP7I 2OTL1 1VQ61 4NB8A 4XX2A 1YITZ 3BG0B 2JUBA 3HOZI 2JA7I 3MONA 3J81b 3CC2Z 2ZAEB 2RHBA 4A3GI 3J80f 1VQNZ 4A3CI 2V8JA 3I4NI 2OTJZ 3GTJI 1Q812 3HOXI 2JNYA 1NUIA 1JWHC 2O53A 3G711 3PO3S 3I07A 1VQ51 2QKDA 3CCSZ 2E9HA 2P3YA 1K9M1 1M1K2 5D1PA 3BG1B 3CCL1 1ML8A 3KIFA 5IT9b 4QTTA 2DE7A 2GTHA 2Y0SA 3HOYI 3KIHA 2EGTA 3PO3I 3J81f 1N8R2 5D1OA 3NH4A 1VQMZ 2IZ3A 2Q4ZA 5LL6f 4AYBA 1YUAA 4E2XA 3K7AI 4HGZA 1Z01A 3IF8A 4BBRI 3FQQA 3CC41 5FLXb 5C4XI 3GCFA 1WW9A 3I561 4NOZA 3GTQI 1RO0A 1W2BZ 2NVYI 5IT9f 2RT9A 4A93I 3H3VJ 3G4SZ 1YIT1 2KPIA 2O4HA 4QTUA 2WAQA 4A3BI 3CC21 4E2ZA 3I55Z 1VQ5Z 1TWHI 1RO4A 2HF1A 4HH4A 1YJ91 1VQN1 2OOXB 2J6AA 1X3WA 1Q861 2OTJ1 3S15I 2JA8I 3CCJZ 5FLXf 4MD7A 4Y52I 4NBFA 4RVHA 2NVXI 3IFUA 3P5JB 5FLMI 4RVFA 1S7MA 4MD9A 1TWFI 3MZLB 4MONA 3RZOI 4MXUA 4A3JI 3S17I 3S16I 2PMZA 2QEXZ 1KQSY 1VQM1 1YJWZ 1VQ9Z 1P9NA 3S1RI 1Q811 1QVFZ 3EEDA 1W2BY 1VQKZ 3S2HI 2RIQA 4NH1C 1TWGI 2W04A 3S1NI 3CXCY 5IP9I 2P28A 3CC7Z 2RPRA 1KD12 1M1K1 2JMOA 1WCMI 3CCUZ 2E2HI 1RNIA 1YJ9Z 1N8R1 4NBAA 2K5RA 3G4S1 3ESWA 3CQZI 3RZDI 3CMA1 1TWCI 3QWUA 4RVDA 1I6HI 2QR1B 3I551 3CPWZ 1PFTA 2F4OA 4MRIA 4EWCA 4NFRA 3T4NB 3CCJ1 2YU9I 1YI2Z 5AN9F 2DE6A 1VQ4Z 4A3DI 3S1QI 3CMEZ 5D1OB 1TWAI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QTU A;  4A3B I;  2E2J I;  3GTL I;  1LQL A;  2VUM I;  2B63 I;  3GKQ A;  3M3Y I;  4NBC A;  4NBE A;  5C44 I;  3HOV I;  1I3Q I;  1TWH I;  3GTP I;  2R7Z I;  4BY7 I;  1USP A;  1RO4 A;  2HF1 A;  4A3I I;  1L1O C;  4A3L I;  2J6A A;  1ZB9 A;  1X3W A;  1QYP A;  3M4O I;  3S15 I;  2JA8 I;  5C3E I;  3S14 I;  4Y7N I;  4Y52 I;  2NVT I;  4NBF A;  2NVX I;  5FLM I;  4A3M I;  3LUS A;  3VB9 A;  5IP7 I;  4NB8 A;  2RBL A;  4XX2 A;  4NBG A;  1TWF I;  3RZO I;  3VMH A;  2NVQ I;  3HOZ I;  2JA7 I;  3I4M I;  4NB9 A;  1N2F A;  4A3J I;  4NBB A;  3S17 I;  3S16 I;  4A3G I;  1TFI A;  1ZB8 A;  4A3C I;  3I4N I;  4BXX I;  1USP B;  3GTJ I;  5CM2 M;  3S1R I;  1X3Z A;  4BBS I;  3HOX I;  3S2H I;  2JNY A;  3EER A;  1NUI A;  1TWG I;  3PO3 S;  3I07 A;  4NBD A;  3S1N I;  5IP9 I;  2AKL A;  3GTK I;  2P3Y A;  4X6A I;  1ML8 A;  2E2I I;  3D6W A;  4MH4 A;  4QTT A;  2DE7 A;  1WCM I;  3GTM S;  3VMG A;  3H0G I;  3HOU I;  1RLY A;  3HOY I;  3GTG I;  3PO3 I;  2E2H I;  2R92 I;  4NBA A;  3GTO I;  2JS4 A;  3PO2 I;  2K5R A;  3ESW A;  3CQZ I;  1SFO I;  3RZD I;  1TWC I;  4BY1 I;  1YUA A;  1I6H I;  1I50 I;  3GTM I;  3K7A I;  2R93 I;  4A3E I;  3FKI I;  4A3K I;  4NBH A;  4BBR I;  1PFT A;  1R9T I;  2JA5 I;  1Y1V S;  5C4X I;  5C4J I;  2BJO A;  2F4O A;  1VLA A;  3GCF A;  1WW9 A;  2PK7 A;  4NOZ A;  3Q87 A;  2YU9 I;  3GTQ I;  3S2D I;  1K83 I;  2NVY I;  2JR6 A;  1DL6 A;  3HOW I;  2DE6 A;  1Y1W I;  2DE5 A;  4A3F I;  4A93 I;  3VMI A;  4A3D I;  1Y1V I;  3H3V J;  3S1Q I;  2JA6 I;  2KPI A;  2F4M A;  3S1M I;  3U50 C;  1TWA I; 
#chains in the Genus database with same CATH topology
 1VQ7 Z;  2V45 A;  2VUM I;  4RV9 A;  3GKQ A;  3M3Y I;  3FQM A;  1K73 2;  3HOV I;  1USP A;  4A3I I;  2YAD A;  2QEX 1;  1QYP A;  3CCM Z;  1YJW 1;  3M4O I;  1VQ9 1;  1RO2 A;  2IV2 X;  3VTN A;  3IX0 A;  4Y7N I;  1VQK 1;  2NVT I;  1YJN Z;  1WJ2 A;  1WII A;  2VPY A;  1NJI 2;  4E31 A;  2RBL A;  4NBG A;  1ZH1 A;  3CMA Z;  3CC7 1;  3NH8 A;  3VMH A;  1RQF A;  2NVQ I;  3I4M I;  1M90 2;  4NB9 A;  1N2F A;  1NP6 A;  3CCU 1;  4RS4 A;  1VQO Z;  3NDI A;  1QF8 A;  1QXF A;  1X3Z A;  4BBS I;  2PM9 A;  4E2Y A;  1YIJ Z;  2G2K A;  2JIP A;  2VF1 A;  4NBD A;  3GTK I;  1K8A 2;  4X6A I;  2QA4 Z;  1KD1 1;  2E2I I;  2HU9 A;  3D6W A;  3NH5 A;  4MH4 A;  1YI2 1;  3H0G I;  1RLY A;  3TE5 B;  2R92 I;  5T6B A;  3GTO I;  3PO2 I;  1VQ4 1;  3CME 1;  1SFO I;  3HKZ A;  1VQL Z;  1YIJ 1;  3NFZ A;  1Q82 2;  1VQ7 1;  1I50 I;  4BY1 I;  4A3E I;  1VQP 1;  1AA6 A;  4NBH A;  4E33 A;  2QRC B;  1R9T I;  2JA5 I;  1Y1V S;  5C4J I;  3OW2 Z;  1VLA A;  2VUG A;  3CCM 1;  3CCV Z;  5T64 A;  2PK7 A;  3Q87 A;  5A2Q b;  1YJN 1;  2GTI A;  1Y1W I;  2DE5 A;  4A3F I;  1YUK A;  3VMI A;  1Y1V I;  1KC8 2;  1VQ8 Z;  1LQL A;  2LIY A;  2VPZ A;  3MZK B;  2M6N A;  5C44 I;  3GTP I;  1K73 1;  2R7Z I;  3CD6 Z;  1VQO 1;  2JIM A;  1L1O C;  2E7Z A;  1ZB9 A;  3F3F C;  4DGL A;  2WB1 A;  3S14 I;  3JAM b;  1Q7Y 2;  2W03 A;  3CCR Z;  4A3M I;  3LUS A;  3VB9 A;  2IZ4 A;  1NJI 1;  5A2Q f;  1QVF Y;  1Y8C A;  3CCE Z;  4HGY A;  2QLV B;  2KI7 B;  4CL1 A;  2OZK A;  1Z02 A;  2QA4 1;  1M90 1;  1VQP Z;  4NBB A;  1Z03 A;  2V8I A;  1S72 Z;  1TFI A;  1ZB8 A;  3OW2 Y;  2I3C A;  1QVG Z;  2Q51 A;  4MD8 A;  4BXX I;  1USP B;  2GU2 A;  5CM2 M;  2R6M A;  1VQL 1;  2V8K A;  3G6E Z;  3CCQ 1;  1YHQ Z;  3EER A;  3TDH B;  2OTL Z;  1VQ6 Z;  3JAM f;  2AKL A;  1K8A 1;  1K9M 2;  3D9X A;  1JJ2 Z;  3CPW Y;  3CCV 1;  4E2W A;  4E32 A;  2OOY B;  1KQS Z;  3GTM S;  3HOU I;  3VMG A;  3F3P C;  4RVG A;  3GTG I;  2JIR A;  4S1T A;  2JS4 A;  4TNU A;  3CXC Z;  1VQ8 1;  2K3R A;  1Q82 1;  3GTM I;  2R93 I;  3IR7 A;  2M48 A;  3FKI I;  3G71 Z;  4A3K I;  3CD6 1;  2QRE B;  2BJO A;  3NDJ A;  3CCL Z;  5T67 A;  3S2D I;  1K83 I;  2JR6 A;  1DL6 A;  3HOW I;  3CCR 1;  1QVG Y;  3J7A 4;  2JA6 I;  1FDO A;  1FDI A;  2F4M A;  3CCE 1;  3S1M I;  1KC8 1;  3U50 C;  3CCS 1;  1Q16 A;  3CCQ Z;  3J80 b;  2E2J I;  3GTL I;  2B63 I;  4DQY B;  2H85 A;  4NBC A;  4NBE A;  1I3Q I;  1S72 1;  4BY7 I;  2LEX A;  1JJ2 Y;  3CC4 Z;  4A3L I;  1Q86 2;  2QRD B;  4DK1 A;  4E30 A;  3I56 Z;  5C3E I;  2LFU A;  1KRL A;  3G6E 1;  1Q7Y 1;  1X0T A;  1YHQ 1;  5IP7 I;  2OTL 1;  1VQ6 1;  4NB8 A;  4XX2 A;  1YIT Z;  3BG0 B;  2JUB A;  3HOZ I;  2JA7 I;  3MON A;  3J81 b;  3CC2 Z;  2ZAE B;  2RHB A;  4A3G I;  3J80 f;  1VQN Z;  4A3C I;  2V8J A;  3I4N I;  2OTJ Z;  3GTJ I;  2AYD A;  1Q81 2;  3HOX I;  2JNY A;  3G71 1;  1NUI A;  1JWH C;  2O53 A;  3PO3 S;  3I07 A;  1VQ5 1;  2QKD A;  3CCS Z;  2E9H A;  2P3Y A;  1K9M 1;  1M1K 2;  5D1P A;  3BG1 B;  3CCL 1;  1ML8 A;  3KIF A;  5IT9 b;  2NAP A;  4QTT A;  2DE7 A;  2GTH A;  2Y0S A;  3HOY I;  3KIH A;  2EGT A;  3PO3 I;  3J81 f;  1N8R 2;  5D1O A;  3NH4 A;  1VQM Z;  2IZ3 A;  2Q4Z A;  5LL6 f;  4AYB A;  1YUA A;  4E2X A;  3K7A I;  4HGZ A;  2JIQ A;  1Z01 A;  3IF8 A;  4BBR I;  3FQQ A;  3CC4 1;  5FLX b;  5C4X I;  3GCF A;  1WW9 A;  3I56 1;  4NOZ A;  3GTQ I;  1RO0 A;  1W2B Z;  2NVY I;  5IT9 f;  2RT9 A;  2VPW A;  4A93 I;  3H3V J;  3G4S Z;  1YIT 1;  2KPI A;  2O4H A;  4QTU A;  2WAQ A;  4A3B I;  3CC2 1;  4E2Z A;  3I55 Z;  1VQ5 Z;  1TWH I;  1RO4 A;  2HF1 A;  4HH4 A;  1YJ9 1;  1VQN 1;  2OOX B;  2J6A A;  1X3W A;  1Q86 1;  2OTJ 1;  3S15 I;  2JA8 I;  3CCJ Z;  5FLX f;  4MD7 A;  4Y52 I;  4NBF A;  4RVH A;  2NVX I;  3IFU A;  3P5J B;  5FLM I;  4RVF A;  1S7M A;  4MD9 A;  1TWF I;  3MZL B;  2VPX A;  4MON A;  3RZO I;  1WZN A;  4MXU A;  4A3J I;  3S17 I;  3S16 I;  2PMZ A;  2QEX Z;  1KQS Y;  1VQM 1;  1YJW Z;  1VQ9 Z;  1P9N A;  3S1R I;  1Q81 1;  1QVF Z;  3EED A;  1W2B Y;  1VQK Z;  3S2H I;  2RIQ A;  4NH1 C;  2V3V A;  1TWG I;  2W04 A;  3S1N I;  3CXC Y;  5IP9 I;  2P28 A;  3CC7 Z;  2RPR A;  1KD1 2;  1M1K 1;  2JMO A;  1WCM I;  3CCU Z;  2E2H I;  1RNI A;  1YJ9 Z;  1N8R 1;  4NBA A;  3D2L A;  2K5R A;  3G4S 1;  3ESW A;  3CQZ I;  3RZD I;  3CMA 1;  1TWC I;  3QWU A;  4RVD A;  1I6H I;  2QR1 B;  3I55 1;  3CPW Z;  1PFT A;  2F4O A;  4MRI A;  4EWC A;  4NFR A;  3T4N B;  3CCJ 1;  2YU9 I;  1YI2 Z;  5AN9 F;  2DE6 A;  1SIW A;  2JIO A;  1VQ4 Z;  4A3D I;  3S1Q I;  3CME Z;  5D1O B;  1TWA I; 
#chains in the Genus database with same CATH homology
 1VQ7 Z;  2VUM I;  4RV9 A;  3GKQ A;  3M3Y I;  3FQM A;  1K73 2;  3HOV I;  1USP A;  4A3I I;  2YAD A;  2QEX 1;  1QYP A;  3CCM Z;  1YJW 1;  3M4O I;  1VQ9 1;  1RO2 A;  3VTN A;  3IX0 A;  4Y7N I;  1VQK 1;  2NVT I;  1YJN Z;  1WII A;  1NJI 2;  4E31 A;  2RBL A;  4NBG A;  1ZH1 A;  3CMA Z;  3CC7 1;  3NH8 A;  3VMH A;  1RQF A;  2NVQ I;  3I4M I;  1M90 2;  4NB9 A;  1N2F A;  1NP6 A;  3CCU 1;  4RS4 A;  1VQO Z;  3NDI A;  1QF8 A;  1X3Z A;  4BBS I;  2PM9 A;  4E2Y A;  1YIJ Z;  2G2K A;  2VF1 A;  4NBD A;  3GTK I;  1K8A 2;  4X6A I;  2QA4 Z;  1KD1 1;  2E2I I;  2HU9 A;  3D6W A;  3NH5 A;  4MH4 A;  1YI2 1;  3H0G I;  1RLY A;  3TE5 B;  2R92 I;  5T6B A;  3GTO I;  3PO2 I;  1VQ4 1;  3CME 1;  1SFO I;  3HKZ A;  1VQL Z;  1YIJ 1;  3NFZ A;  1Q82 2;  1VQ7 1;  1I50 I;  4BY1 I;  4A3E I;  1VQP 1;  4NBH A;  4E33 A;  2QRC B;  1R9T I;  2JA5 I;  1Y1V S;  5C4J I;  3OW2 Z;  1VLA A;  2VUG A;  3CCM 1;  3CCV Z;  5T64 A;  2PK7 A;  3Q87 A;  5A2Q b;  1YJN 1;  2GTI A;  1Y1W I;  2DE5 A;  4A3F I;  1YUK A;  3VMI A;  1Y1V I;  1KC8 2;  1VQ8 Z;  1LQL A;  2LIY A;  3MZK B;  2M6N A;  5C44 I;  3GTP I;  1K73 1;  2R7Z I;  3CD6 Z;  1VQO 1;  1L1O C;  1ZB9 A;  3F3F C;  4DGL A;  2WB1 A;  3S14 I;  3JAM b;  1Q7Y 2;  2W03 A;  3CCR Z;  4A3M I;  3LUS A;  3VB9 A;  2IZ4 A;  1NJI 1;  5A2Q f;  1QVF Y;  3CCE Z;  4HGY A;  2QLV B;  2KI7 B;  4CL1 A;  2OZK A;  1Z02 A;  2QA4 1;  1M90 1;  1VQP Z;  4NBB A;  1Z03 A;  2V8I A;  1S72 Z;  1TFI A;  1ZB8 A;  3OW2 Y;  2I3C A;  1QVG Z;  2Q51 A;  4MD8 A;  4BXX I;  1USP B;  2GU2 A;  5CM2 M;  2R6M A;  1VQL 1;  2V8K A;  3G6E Z;  3CCQ 1;  1YHQ Z;  3EER A;  3TDH B;  2OTL Z;  1VQ6 Z;  3JAM f;  2AKL A;  1K8A 1;  1K9M 2;  3D9X A;  1JJ2 Z;  3CPW Y;  3CCV 1;  4E2W A;  4E32 A;  2OOY B;  1KQS Z;  3GTM S;  3HOU I;  3VMG A;  3F3P C;  4RVG A;  3GTG I;  4S1T A;  2JS4 A;  4TNU A;  3CXC Z;  1VQ8 1;  2K3R A;  1Q82 1;  3GTM I;  2R93 I;  2M48 A;  3FKI I;  3G71 Z;  4A3K I;  3CD6 1;  2QRE B;  2BJO A;  3NDJ A;  3CCL Z;  5T67 A;  3S2D I;  1K83 I;  2JR6 A;  1DL6 A;  3HOW I;  3CCR 1;  1QVG Y;  3J7A 4;  2JA6 I;  2F4M A;  3CCE 1;  3S1M I;  1KC8 1;  3U50 C;  3CCS 1;  3CCQ Z;  3J80 b;  2E2J I;  3GTL I;  2B63 I;  4DQY B;  2H85 A;  4NBC A;  4NBE A;  1I3Q I;  1S72 1;  4BY7 I;  1JJ2 Y;  3CC4 Z;  4A3L I;  1Q86 2;  2QRD B;  4DK1 A;  4E30 A;  3I56 Z;  5C3E I;  2LFU A;  1KRL A;  3G6E 1;  1Q7Y 1;  1X0T A;  1YHQ 1;  5IP7 I;  2OTL 1;  1VQ6 1;  4NB8 A;  4XX2 A;  1YIT Z;  3BG0 B;  2JUB A;  3HOZ I;  2JA7 I;  3MON A;  3J81 b;  3CC2 Z;  2ZAE B;  2RHB A;  4A3G I;  3J80 f;  1VQN Z;  4A3C I;  2V8J A;  3I4N I;  2OTJ Z;  3GTJ I;  1Q81 2;  3HOX I;  2JNY A;  1NUI A;  1JWH C;  2O53 A;  3G71 1;  3PO3 S;  3I07 A;  1VQ5 1;  2QKD A;  3CCS Z;  2E9H A;  2P3Y A;  1K9M 1;  1M1K 2;  5D1P A;  3BG1 B;  3CCL 1;  1ML8 A;  3KIF A;  5IT9 b;  4QTT A;  2DE7 A;  2GTH A;  2Y0S A;  3HOY I;  3KIH A;  2EGT A;  3PO3 I;  3J81 f;  1N8R 2;  5D1O A;  3NH4 A;  1VQM Z;  2IZ3 A;  2Q4Z A;  5LL6 f;  4AYB A;  1YUA A;  4E2X A;  3K7A I;  4HGZ A;  1Z01 A;  3IF8 A;  4BBR I;  3FQQ A;  3CC4 1;  5FLX b;  5C4X I;  3GCF A;  1WW9 A;  3I56 1;  4NOZ A;  3GTQ I;  1RO0 A;  1W2B Z;  2NVY I;  5IT9 f;  2RT9 A;  4A93 I;  3H3V J;  3G4S Z;  1YIT 1;  2KPI A;  2O4H A;  4QTU A;  2WAQ A;  4A3B I;  3CC2 1;  4E2Z A;  3I55 Z;  1VQ5 Z;  1TWH I;  1RO4 A;  2HF1 A;  4HH4 A;  1YJ9 1;  1VQN 1;  2OOX B;  2J6A A;  1X3W A;  1Q86 1;  2OTJ 1;  3S15 I;  2JA8 I;  3CCJ Z;  5FLX f;  4MD7 A;  4Y52 I;  4NBF A;  4RVH A;  2NVX I;  3IFU A;  3P5J B;  5FLM I;  4RVF A;  1S7M A;  4MD9 A;  1TWF I;  3MZL B;  4MON A;  3RZO I;  4MXU A;  4A3J I;  3S17 I;  3S16 I;  2PMZ A;  2QEX Z;  1KQS Y;  1VQM 1;  1YJW Z;  1VQ9 Z;  1P9N A;  3S1R I;  1Q81 1;  1QVF Z;  3EED A;  1W2B Y;  1VQK Z;  3S2H I;  2RIQ A;  4NH1 C;  1TWG I;  2W04 A;  3S1N I;  3CXC Y;  5IP9 I;  2P28 A;  3CC7 Z;  2RPR A;  1KD1 2;  1M1K 1;  2JMO A;  1WCM I;  3CCU Z;  2E2H I;  1RNI A;  1YJ9 Z;  1N8R 1;  4NBA A;  2K5R A;  3G4S 1;  3ESW A;  3CQZ I;  3RZD I;  3CMA 1;  1TWC I;  3QWU A;  4RVD A;  1I6H I;  2QR1 B;  3I55 1;  3CPW Z;  1PFT A;  2F4O A;  4MRI A;  4EWC A;  4NFR A;  3T4N B;  3CCJ 1;  2YU9 I;  1YI2 Z;  5AN9 F;  2DE6 A;  1VQ4 Z;  4A3D I;  3S1Q I;  3CME Z;  5D1O B;  1TWA I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...