3I4NI

8-oxoguanine containing rna polymerase ii elongation complex e
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
117
structure length
117
Chain Sequence
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 9
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3i4nI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3i4nI02
1NUIA 3S2HI 2YU9I 3D6WA 3HOZI 2NVYI 4Y52I 5IP9I 3S1NI 3RZDI 3K7AI 1TWAI 4A3KI 4Y7NI 1SFOI 2R93I 1RO4A 2BJOA 1TWFI 5IP7I 3VMIA 2F4OA 3ESWA 1I50I 1Y1VI 3I07A 2JA7I 4BY7I 3GTQI 4MH4A 2R92I 3S15I 1R9TI 1I6HI 3FKII 3S14I 2R7ZI 3VMGA 1K83I 4NBAA 3GTJI 2DE7A 3LUSA 1WCMI 2JR6A 4BY1I 1X3ZA 3HOYI 4NBBA 3S1RI 2E2JI 2B63I 3M3YI 3VB9A 1WW9A 3VMHA 1L1OC 4NBCA 3HOUI 3Q87A 3GTKI 4NBFA 1YUAA 3GCFA 4NB8A 3EERA 2E2HI 1ML8A 1PFTA 5C4JI 5FLMI 1USPA 3S2DI 3GTLI 2E2II 5C44I 3S17I 4NBDA 4BBSI 4NBEA 1Y1WI 5CM2M 2DE6A 4A3GI 2DE5A 3GTGI 3H0GI 4NBGA 1ZB9A 1X3WA 3HOWI 3PO3S 2JS4A 4A3BI 4NOZA 2F4MA 4A3FI 3RZOI 4X6AI 4A3II 2KPIA 3CQZI 2NVQI 4A3JI 5C3EI 2PK7A 3GTPI 4A3CI 2JA8I 4A3EI 1N2FA 3S16I 1DL6A 5C4XI 3S1MI 1TFIA 2AKLA 2K5RA 3H3VJ 2P3YA 1VLAA 3I4NI 4QTUA 4A3DI 2HF1A 3HOXI 4XX2A 3M4OI 1TWGI 2JA6I 2NVXI 1QYPA 4A3LI 3U50C 2VUMI 2RBLA 2JNYA 3GTOI 2JA5I 3GTMS 3PO3I 1TWHI 3GTMI 1TWCI 1Y1VS 1USPB 4A93I 4NBHA 4BXXI 3PO2I 4A3MI 3I4MI 1RLYA 1I3QI 4QTTA 4NB9A 2J6AA 3GKQA 4BBRI 3S1QI 1LQLA 3HOVI 1ZB8A 2NVTI
chains in the Genus database with same CATH superfamily
5D1PA 2V45A 3S1NI 2OTL1 3RZDI 1VQ81 2R93I 2BJOA 2W03A 1YITZ 2Y0SA 4MONA 3VMIA 4RVFA 3CCS1 1I50I 2VUGA 1KC82 2M6NA 2P28A 1I6HI 1Q862 1M1K2 2JUBA 2Q4ZA 4NBAA 5FLXf 4HGYA 2DE7A 1YI2Z 1W2BY 1VQKZ 3P5JB 3IF8A 2I3CA 2PMZA 3I561 3G6E1 2OZKA 2W04A 4NBCA 3GTKI 1YJ9Z 1Z02A 3EERA 3D9XA 1QXFA 1YHQ1 2E2II 5C44I 4BBSI 1RNIA 2GTHA 3PO3S 2JS4A 2QLVB 2WB1A 4NOZA 4TNUA 1Q7Y1 4X6AI 2KPIA 3CD61 3CQZI 1KRLA 2PK7A 3CCL1 3GTPI 2IV2X 3CC71 1ZH1A 1N2FA 5A2Qb 4A3EI 1RO2A 1KD11 2K5RA 3G711 2QEXZ 4QTUA 3CCR1 1NP6A 1TWGI 2JA6I 2NVXI 3U50C 3GTOI 2JA5I 3CPWY 2E7ZA 2LIYA 2NAPA 4DK1A 3GTMI 3PO3I 1K8A1 2V3VA 3I4MI 1RLYA 1AA6A 2ZAEB 2OTLZ 3CC4Z 2JIOA 3KIFA 1VQ8Z 3MZLB 1ZB8A 2V8KA 2NVTI 3NH4A 1W2BZ 1Q7Y2 3CC2Z 2V8IA 4E30A 3HOZI 3J81f 3NDJA 4A3KI 3IX0A 4Y7NI 3CCMZ 3CCUZ 1TWFI 5IP7I 3I07A 3GTQI 3J7A4 1KD12 5FLXb 3VTNA 2G2KA 4NH1C 1X0TA 2R92I 2R7ZI 1VQMZ 3TDHB 3G6EZ 3GTJI 2GTIA 1YIJZ 2M48A 3LUSA 2JR6A 4BY1I 4NBBA 3S1RI 1K8A2 1QVGY 2R6MA 3CC41 3JAMf 1L1OC 1YHQZ 3Q87A 3MONA 1YUAA 4NB8A 3CC21 3T4NB 1K9M1 3J80f 4DQYB 2E2HI 1FDIA 1VQP1 1USPA 3CCM1 3CCV1 3CCU1 3CXCY 4HH4A 3CD6Z 3IFUA 3GTGI 4NBGA 3CCLZ 1X3WA 2V8JA 3CPWZ 5T6BA 3CC7Z 4A3FI 1VQ41 1VQM1 3RZOI 4MD8A 4A3II 1YIJ1 2NVQI 3G71Z 3FQMA 5C3EI 2O4HA 3CCRZ 3BG0B 2IZ3A 3CCEZ 5C4XI 5T64A 2AKLA 4E31A 3TE5B 2P3YA 1Z01A 2GU2A 2YADA 1VLAA 1NJI1 1K731 4A3DI 2OTJ1 3IR7A 3NFZA 1Q811 5D1OA 4A3LI 4NFRA 2QREB 2RBLA 3GTMS 1K9M2 1TWCI 1Y1VS 1M901 1USPB 1VQ51 4A93I 4NBHA 1JJ2Y 1QF8A 4BXXI 4A3MI 2VF1A 1Z03A 1I3QI 2J6AA 4E33A 1WZNA 3F3PC 3BG1B 1NUIA 3D2LA 2QA41 3D6WA 2EGTA 3CCE1 1QVGZ 2JMOA 4Y52I 1TWAI 4E2WA 5IT9f 1RO4A 1Q822 2OOXB 2IZ4A 4BY7I 1Y1VI 4RV9A 1SIWA 2RPRA 1R9TI 3FKII 1NJI2 1FDOA 1K732 3VMGA 3CXCZ 1K83I 1Q812 3HKZA 1WIIA 2QRCB 1WCMI 4HGZA 1M902 3J80b 1VQPZ 2E2JI 3M3YI 3F3FC 1Y8CA 3VMHA 3HOUI 3CCVZ 4NBFA 4RVHA 3GCFA 1S721 1KQSY 2VPXA 2H85A 1PFTA 4E32A 5FLMI 3GTLI 3I551 2JIMA 3S17I 4NBDA 1VQO1 1VQ4Z 2DE6A 3MZKB 2DE5A 5A2Qf 4RVDA 2OOYB 4E2XA 3QWUA 3H0GI 4A3BI 3HOWI 1JJ2Z 3NH5A 3G4SZ 1JWHC 1VQNZ 2WAQA 1YUKA 3OW2Y 5AN9F 2OTJZ 1WJ2A 3CME1 3H3VJ 5LL6f 1VQ5Z 2HF1A 2JIQA 4EWCA 3HOXI 4XX2A 3M4OI 1QYPA 2VUMI 2JNYA 5T67A 1TWHI 3CCJZ 2AYDA 3PO2I 2E9HA 2QA4Z 1Q821 4BBRI 4RVGA 3S1QI 1LQLA 1S7MA 3NDIA 3G4S1 1QVFY 2JIPA 5IT9b 1VQN1 3CCQ1 1VQ91 2YU9I 3S2HI 4MD9A 1YJNZ 2NVYI 5IP9I 2LEXA 3K7AI 1SFOI 1VQ6Z 1KQSZ 2F4OA 3ESWA 2JA7I 3EEDA 4MH4A 1Q16A 3S15I 1VQ7Z 1YIT1 3S14I 3CCJ1 3J81b 4DGLA 2RIQA 1S72Z 1X3ZA 3HOYI 1VQLZ 2B63I 3VB9A 1WW9A 2LFUA 2QR1B 1YI21 3I55Z 1VQOZ 1VQK1 1YJN1 1N8R1 2JIRA 4RS4A 3OW2Z 1ML8A 5C4JI 4E2YA 3S2DI 1VQ61 3CMAZ 1YJ91 4NBEA 1Y1WI 1YJWZ 5CM2M 4A3GI 5D1OB 3JAMb 2O53A 1VQ71 4E2ZA 1ZB9A 2PM9A 3FQQA 2F4MA 2VPZA 2K3RA 2VPYA 3CMEZ 4A3JI 2Q51A 4MRIA 2QRDB 1VQL1 4A3CI 2JA8I 2RT9A 3S16I 1DL6A 3S1MI 1TFIA 1KC81 3NH8A 4MXUA 1QVFZ 1RQFA 1Q861 3I4NI 3CCSZ 1M1K1 2HU9A 3KIHA 4CL1A 3CMA1 2RHBA 1YJW1 1N8R2 1RO0A 2QEX1 4MD7A 2KI7B 4S1TA 1P9NA 3CCQZ 1VQ9Z 2QKDA 4QTTA 4NB9A 3GKQA 3I56Z 4AYBA 3HOVI 2VPWA
chains in the Genus database with same CATH topology
5D1PA 3S1NI 2OTL1 3RZDI 1VQ81 2R93I 2BJOA 2W03A 1YITZ 2Y0SA 4MONA 3VMIA 4RVFA 3CCS1 1I50I 2VUGA 1KC82 2M6NA 2P28A 1I6HI 1Q862 1M1K2 2JUBA 2Q4ZA 4NBAA 5FLXf 4HGYA 2DE7A 1YI2Z 1W2BY 1VQKZ 3P5JB 3IF8A 2I3CA 2PMZA 3I561 3G6E1 2OZKA 2W04A 4NBCA 3GTKI 1YJ9Z 1Z02A 3EERA 3D9XA 1YHQ1 2E2II 5C44I 4BBSI 1RNIA 2GTHA 3PO3S 2JS4A 2QLVB 2WB1A 4NOZA 4TNUA 1Q7Y1 4X6AI 2KPIA 3CD61 3CQZI 1KRLA 2PK7A 3CCL1 3GTPI 3CC71 4A3EI 1ZH1A 1N2FA 5A2Qb 1RO2A 1KD11 2K5RA 3G711 2QEXZ 4QTUA 3CCR1 1NP6A 1TWGI 2JA6I 2NVXI 3U50C 3GTOI 2JA5I 3CPWY 2LIYA 3PO3I 4DK1A 3GTMI 1K8A1 3I4MI 1RLYA 2ZAEB 2OTLZ 3CC4Z 3KIFA 1VQ8Z 3MZLB 1ZB8A 2V8KA 2NVTI 3NH4A 1W2BZ 1Q7Y2 3CC2Z 2V8IA 4E30A 3HOZI 3J81f 3NDJA 4A3KI 3IX0A 4Y7NI 3CCMZ 3CCUZ 1TWFI 5IP7I 3I07A 3GTQI 3J7A4 1KD12 5FLXb 3VTNA 2G2KA 4NH1C 1X0TA 2R92I 2R7ZI 1VQMZ 3TDHB 3G6EZ 3GTJI 2GTIA 1YIJZ 2M48A 3LUSA 2JR6A 4BY1I 4NBBA 3S1RI 1K8A2 1QVGY 2R6MA 3CC41 3JAMf 1L1OC 1YHQZ 3Q87A 3MONA 1YUAA 4NB8A 3CC21 3T4NB 1K9M1 3J80f 4DQYB 2E2HI 1VQP1 1USPA 3CCM1 3CCV1 3CCU1 3CXCY 4HH4A 3CD6Z 3IFUA 3GTGI 4NBGA 3CCLZ 1X3WA 2V8JA 3CPWZ 5T6BA 3CC7Z 4A3FI 1VQ41 1VQM1 3RZOI 4MD8A 4A3II 1YIJ1 2NVQI 3G71Z 3FQMA 5C3EI 2O4HA 3CCRZ 3BG0B 2IZ3A 3CCEZ 5C4XI 5T64A 2AKLA 4E31A 3TE5B 2P3YA 1Z01A 2GU2A 2YADA 1VLAA 1NJI1 1K731 4A3DI 2OTJ1 3NFZA 1Q811 5D1OA 4A3LI 4NFRA 2QREB 2RBLA 3GTMS 1K9M2 1TWCI 1Y1VS 1M901 1USPB 1VQ51 4A93I 4NBHA 1JJ2Y 1QF8A 4BXXI 4A3MI 2VF1A 1Z03A 1I3QI 2J6AA 4E33A 3F3PC 3BG1B 1NUIA 2QA41 3D6WA 2EGTA 3CCE1 1QVGZ 2JMOA 4Y52I 1TWAI 4E2WA 5IT9f 1RO4A 1Q822 2OOXB 2IZ4A 4BY7I 1Y1VI 4RV9A 2RPRA 1R9TI 3FKII 1NJI2 1K732 3VMGA 3CXCZ 1K83I 1Q812 3HKZA 1WIIA 2QRCB 1WCMI 4HGZA 1M902 3J80b 1VQPZ 2E2JI 3M3YI 3F3FC 3VMHA 3HOUI 3CCVZ 4NBFA 4RVHA 3GCFA 1S721 1KQSY 2H85A 1PFTA 4E32A 5FLMI 3GTLI 3I551 3S17I 4NBDA 1VQO1 1VQ4Z 2DE6A 3MZKB 2DE5A 5A2Qf 4RVDA 2OOYB 4E2XA 3QWUA 3H0GI 4A3BI 3HOWI 1JJ2Z 3NH5A 3G4SZ 1JWHC 1VQNZ 2WAQA 1YUKA 3OW2Y 5AN9F 2OTJZ 3CME1 3H3VJ 5LL6f 1VQ5Z 2HF1A 4EWCA 3HOXI 4XX2A 3M4OI 1QYPA 2VUMI 2JNYA 5T67A 1TWHI 3CCJZ 3PO2I 2E9HA 2QA4Z 1Q821 4BBRI 4RVGA 3S1QI 1LQLA 1S7MA 3NDIA 3G4S1 1QVFY 5IT9b 1VQN1 3CCQ1 1VQ91 2YU9I 3S2HI 4MD9A 1YJNZ 2NVYI 5IP9I 3K7AI 1SFOI 1VQ6Z 1KQSZ 2F4OA 3ESWA 2JA7I 3EEDA 4MH4A 3S15I 1VQ7Z 1YIT1 3S14I 3CCJ1 3J81b 4DGLA 2RIQA 1S72Z 1X3ZA 3HOYI 1VQLZ 2B63I 3VB9A 1WW9A 2LFUA 2QR1B 1YI21 3I55Z 1VQOZ 1VQK1 1YJN1 1N8R1 4RS4A 3OW2Z 1ML8A 5C4JI 4E2YA 3S2DI 1VQ61 3CMAZ 1YJ91 4NBEA 1Y1WI 1YJWZ 5CM2M 4A3GI 5D1OB 3JAMb 2O53A 1VQ71 4E2ZA 1ZB9A 2PM9A 3FQQA 2F4MA 2K3RA 3CMEZ 4A3JI 2Q51A 4MRIA 2QRDB 1VQL1 4A3CI 2JA8I 2RT9A 3S16I 1DL6A 3S1MI 1TFIA 1KC81 3NH8A 4MXUA 1QVFZ 1RQFA 1Q861 3I4NI 3CCSZ 1M1K1 2HU9A 3KIHA 4CL1A 3CMA1 2RHBA 1YJW1 1N8R2 1RO0A 2QEX1 4MD7A 2KI7B 4S1TA 1P9NA 3CCQZ 1VQ9Z 2QKDA 4QTTA 4NB9A 3GKQA 3I56Z 4AYBA 3HOVI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NUI A;  3S2H I;  2YU9 I;  3D6W A;  3HOZ I;  2NVY I;  4Y52 I;  5IP9 I;  3S1N I;  3RZD I;  3K7A I;  1TWA I;  4A3K I;  4Y7N I;  1SFO I;  2R93 I;  1RO4 A;  2BJO A;  1TWF I;  5IP7 I;  3VMI A;  2F4O A;  3ESW A;  1I50 I;  1Y1V I;  3I07 A;  2JA7 I;  4BY7 I;  3GTQ I;  4MH4 A;  2R92 I;  3S15 I;  1R9T I;  1I6H I;  3FKI I;  3S14 I;  2R7Z I;  3VMG A;  1K83 I;  4NBA A;  3GTJ I;  2DE7 A;  3LUS A;  1WCM I;  2JR6 A;  4BY1 I;  1X3Z A;  3HOY I;  4NBB A;  3S1R I;  2E2J I;  2B63 I;  3M3Y I;  3VB9 A;  1WW9 A;  3VMH A;  1L1O C;  4NBC A;  3HOU I;  3Q87 A;  3GTK I;  4NBF A;  1YUA A;  3GCF A;  4NB8 A;  3EER A;  2E2H I;  1ML8 A;  1PFT A;  5C4J I;  5FLM I;  1USP A;  3S2D I;  3GTL I;  2E2I I;  5C44 I;  3S17 I;  4NBD A;  4BBS I;  4NBE A;  1Y1W I;  5CM2 M;  2DE6 A;  4A3G I;  2DE5 A;  3GTG I;  3H0G I;  4NBG A;  1ZB9 A;  1X3W A;  3HOW I;  3PO3 S;  2JS4 A;  4A3B I;  4NOZ A;  2F4M A;  4A3F I;  3RZO I;  4X6A I;  4A3I I;  2KPI A;  3CQZ I;  2NVQ I;  4A3J I;  5C3E I;  2PK7 A;  3GTP I;  4A3C I;  2JA8 I;  4A3E I;  1N2F A;  3S16 I;  1DL6 A;  5C4X I;  3S1M I;  1TFI A;  2AKL A;  2K5R A;  3H3V J;  2P3Y A;  1VLA A;  3I4N I;  4QTU A;  4A3D I;  2HF1 A;  3HOX I;  4XX2 A;  3M4O I;  1TWG I;  2JA6 I;  2NVX I;  1QYP A;  4A3L I;  3U50 C;  2VUM I;  2RBL A;  2JNY A;  3GTO I;  2JA5 I;  3GTM S;  3PO3 I;  1TWH I;  3GTM I;  1TWC I;  1Y1V S;  1USP B;  4A93 I;  4NBH A;  4BXX I;  3PO2 I;  4A3M I;  3I4M I;  1RLY A;  1I3Q I;  4QTT A;  4NB9 A;  2J6A A;  3GKQ A;  4BBR I;  3S1Q I;  1LQL A;  3HOV I;  1ZB8 A;  2NVT I; 
#chains in the Genus database with same CATH topology
 5D1P A;  2V45 A;  3S1N I;  2OTL 1;  3RZD I;  1VQ8 1;  2R93 I;  2BJO A;  2W03 A;  1YIT Z;  2Y0S A;  4MON A;  3VMI A;  4RVF A;  3CCS 1;  1I50 I;  2VUG A;  1KC8 2;  2M6N A;  2P28 A;  1I6H I;  1Q86 2;  1M1K 2;  2JUB A;  2Q4Z A;  4NBA A;  5FLX f;  4HGY A;  2DE7 A;  1YI2 Z;  1W2B Y;  1VQK Z;  3P5J B;  3IF8 A;  2I3C A;  2PMZ A;  3I56 1;  3G6E 1;  2OZK A;  2W04 A;  4NBC A;  3GTK I;  1YJ9 Z;  1Z02 A;  3EER A;  3D9X A;  1QXF A;  1YHQ 1;  2E2I I;  5C44 I;  4BBS I;  1RNI A;  2GTH A;  3PO3 S;  2JS4 A;  2QLV B;  2WB1 A;  4NOZ A;  4TNU A;  1Q7Y 1;  4X6A I;  2KPI A;  3CD6 1;  3CQZ I;  1KRL A;  2PK7 A;  3CCL 1;  3GTP I;  2IV2 X;  3CC7 1;  1ZH1 A;  1N2F A;  5A2Q b;  4A3E I;  1RO2 A;  1KD1 1;  2K5R A;  3G71 1;  2QEX Z;  4QTU A;  3CCR 1;  1NP6 A;  1TWG I;  2JA6 I;  2NVX I;  3U50 C;  3GTO I;  2JA5 I;  3CPW Y;  2E7Z A;  2LIY A;  2NAP A;  4DK1 A;  3GTM I;  3PO3 I;  1K8A 1;  2V3V A;  3I4M I;  1RLY A;  1AA6 A;  2ZAE B;  2OTL Z;  3CC4 Z;  2JIO A;  3KIF A;  1VQ8 Z;  3MZL B;  1ZB8 A;  2V8K A;  2NVT I;  3NH4 A;  1W2B Z;  1Q7Y 2;  3CC2 Z;  2V8I A;  4E30 A;  3HOZ I;  3J81 f;  3NDJ A;  4A3K I;  3IX0 A;  4Y7N I;  3CCM Z;  3CCU Z;  1TWF I;  5IP7 I;  3I07 A;  3GTQ I;  3J7A 4;  1KD1 2;  5FLX b;  3VTN A;  2G2K A;  4NH1 C;  1X0T A;  2R92 I;  2R7Z I;  1VQM Z;  3TDH B;  3G6E Z;  3GTJ I;  2GTI A;  1YIJ Z;  2M48 A;  3LUS A;  2JR6 A;  4BY1 I;  4NBB A;  3S1R I;  1K8A 2;  1QVG Y;  2R6M A;  3CC4 1;  3JAM f;  1L1O C;  1YHQ Z;  3Q87 A;  3MON A;  1YUA A;  4NB8 A;  3CC2 1;  3T4N B;  1K9M 1;  3J80 f;  4DQY B;  2E2H I;  1FDI A;  1VQP 1;  1USP A;  3CCM 1;  3CCV 1;  3CCU 1;  3CXC Y;  4HH4 A;  3CD6 Z;  3IFU A;  3GTG I;  4NBG A;  3CCL Z;  1X3W A;  2V8J A;  3CPW Z;  5T6B A;  3CC7 Z;  4A3F I;  1VQ4 1;  1VQM 1;  3RZO I;  4MD8 A;  4A3I I;  1YIJ 1;  2NVQ I;  3G71 Z;  3FQM A;  5C3E I;  2O4H A;  3CCR Z;  3BG0 B;  2IZ3 A;  3CCE Z;  5C4X I;  5T64 A;  2AKL A;  4E31 A;  3TE5 B;  2P3Y A;  1Z01 A;  2GU2 A;  2YAD A;  1VLA A;  1NJI 1;  1K73 1;  4A3D I;  2OTJ 1;  3IR7 A;  3NFZ A;  1Q81 1;  5D1O A;  4A3L I;  4NFR A;  2QRE B;  2RBL A;  3GTM S;  1K9M 2;  1TWC I;  1Y1V S;  1M90 1;  1USP B;  1VQ5 1;  4A93 I;  4NBH A;  1JJ2 Y;  1QF8 A;  4BXX I;  4A3M I;  2VF1 A;  1Z03 A;  1I3Q I;  2J6A A;  4E33 A;  1WZN A;  3F3P C;  3BG1 B;  1NUI A;  3D2L A;  2QA4 1;  3D6W A;  2EGT A;  3CCE 1;  1QVG Z;  2JMO A;  4Y52 I;  1TWA I;  4E2W A;  5IT9 f;  1RO4 A;  1Q82 2;  2OOX B;  2IZ4 A;  4BY7 I;  1Y1V I;  4RV9 A;  1SIW A;  2RPR A;  1R9T I;  3FKI I;  1NJI 2;  1FDO A;  1K73 2;  3VMG A;  3CXC Z;  1K83 I;  1Q81 2;  3HKZ A;  1WII A;  2QRC B;  1WCM I;  4HGZ A;  1M90 2;  3J80 b;  1VQP Z;  2E2J I;  3M3Y I;  3F3F C;  1Y8C A;  3VMH A;  3HOU I;  3CCV Z;  4NBF A;  4RVH A;  3GCF A;  1S72 1;  1KQS Y;  2VPX A;  2H85 A;  1PFT A;  4E32 A;  5FLM I;  3GTL I;  3I55 1;  2JIM A;  3S17 I;  4NBD A;  1VQO 1;  1VQ4 Z;  2DE6 A;  3MZK B;  2DE5 A;  5A2Q f;  4RVD A;  2OOY B;  4E2X A;  3QWU A;  3H0G I;  4A3B I;  3HOW I;  1JJ2 Z;  3NH5 A;  3G4S Z;  1JWH C;  1VQN Z;  2WAQ A;  1YUK A;  3OW2 Y;  5AN9 F;  2OTJ Z;  1WJ2 A;  3CME 1;  3H3V J;  5LL6 f;  1VQ5 Z;  2HF1 A;  2JIQ A;  4EWC A;  3HOX I;  4XX2 A;  3M4O I;  1QYP A;  2VUM I;  2JNY A;  5T67 A;  1TWH I;  3CCJ Z;  2AYD A;  3PO2 I;  2E9H A;  2QA4 Z;  1Q82 1;  4BBR I;  4RVG A;  3S1Q I;  1LQL A;  1S7M A;  3NDI A;  3G4S 1;  1QVF Y;  2JIP A;  5IT9 b;  1VQN 1;  3CCQ 1;  1VQ9 1;  2YU9 I;  3S2H I;  4MD9 A;  1YJN Z;  2NVY I;  5IP9 I;  2LEX A;  3K7A I;  1SFO I;  1VQ6 Z;  1KQS Z;  2F4O A;  3ESW A;  2JA7 I;  3EED A;  4MH4 A;  1Q16 A;  3S15 I;  1VQ7 Z;  1YIT 1;  3S14 I;  3CCJ 1;  3J81 b;  4DGL A;  2RIQ A;  1S72 Z;  1X3Z A;  3HOY I;  1VQL Z;  2B63 I;  3VB9 A;  1WW9 A;  2LFU A;  2QR1 B;  1YI2 1;  3I55 Z;  1VQO Z;  1VQK 1;  1YJN 1;  1N8R 1;  2JIR A;  4RS4 A;  3OW2 Z;  1ML8 A;  5C4J I;  4E2Y A;  3S2D I;  1VQ6 1;  3CMA Z;  1YJ9 1;  4NBE A;  1Y1W I;  1YJW Z;  5CM2 M;  4A3G I;  5D1O B;  3JAM b;  2O53 A;  1VQ7 1;  4E2Z A;  1ZB9 A;  2PM9 A;  3FQQ A;  2F4M A;  2VPZ A;  2K3R A;  2VPY A;  3CME Z;  4A3J I;  2Q51 A;  4MRI A;  2QRD B;  1VQL 1;  4A3C I;  2JA8 I;  2RT9 A;  3S16 I;  1DL6 A;  3S1M I;  1TFI A;  1KC8 1;  3NH8 A;  4MXU A;  1QVF Z;  1RQF A;  1Q86 1;  3I4N I;  3CCS Z;  1M1K 1;  2HU9 A;  3KIH A;  4CL1 A;  3CMA 1;  2RHB A;  1YJW 1;  1N8R 2;  1RO0 A;  2QEX 1;  4MD7 A;  2KI7 B;  4S1T A;  1P9N A;  3CCQ Z;  1VQ9 Z;  2QKD A;  4QTT A;  4NB9 A;  3GKQ A;  3I56 Z;  4AYB A;  3HOV I;  2VPW A; 
#chains in the Genus database with same CATH homology
 5D1P A;  3S1N I;  2OTL 1;  3RZD I;  1VQ8 1;  2R93 I;  2BJO A;  2W03 A;  1YIT Z;  2Y0S A;  4MON A;  3VMI A;  4RVF A;  3CCS 1;  1I50 I;  2VUG A;  1KC8 2;  2M6N A;  2P28 A;  1I6H I;  1Q86 2;  1M1K 2;  2JUB A;  2Q4Z A;  4NBA A;  5FLX f;  4HGY A;  2DE7 A;  1YI2 Z;  1W2B Y;  1VQK Z;  3P5J B;  3IF8 A;  2I3C A;  2PMZ A;  3I56 1;  3G6E 1;  2OZK A;  2W04 A;  4NBC A;  3GTK I;  1YJ9 Z;  1Z02 A;  3EER A;  3D9X A;  1YHQ 1;  2E2I I;  5C44 I;  4BBS I;  1RNI A;  2GTH A;  3PO3 S;  2JS4 A;  2QLV B;  2WB1 A;  4NOZ A;  4TNU A;  1Q7Y 1;  4X6A I;  2KPI A;  3CD6 1;  3CQZ I;  1KRL A;  2PK7 A;  3CCL 1;  3GTP I;  3CC7 1;  4A3E I;  1ZH1 A;  1N2F A;  5A2Q b;  1RO2 A;  1KD1 1;  2K5R A;  3G71 1;  2QEX Z;  4QTU A;  3CCR 1;  1NP6 A;  1TWG I;  2JA6 I;  2NVX I;  3U50 C;  3GTO I;  2JA5 I;  3CPW Y;  2LIY A;  3PO3 I;  4DK1 A;  3GTM I;  1K8A 1;  3I4M I;  1RLY A;  2ZAE B;  2OTL Z;  3CC4 Z;  3KIF A;  1VQ8 Z;  3MZL B;  1ZB8 A;  2V8K A;  2NVT I;  3NH4 A;  1W2B Z;  1Q7Y 2;  3CC2 Z;  2V8I A;  4E30 A;  3HOZ I;  3J81 f;  3NDJ A;  4A3K I;  3IX0 A;  4Y7N I;  3CCM Z;  3CCU Z;  1TWF I;  5IP7 I;  3I07 A;  3GTQ I;  3J7A 4;  1KD1 2;  5FLX b;  3VTN A;  2G2K A;  4NH1 C;  1X0T A;  2R92 I;  2R7Z I;  1VQM Z;  3TDH B;  3G6E Z;  3GTJ I;  2GTI A;  1YIJ Z;  2M48 A;  3LUS A;  2JR6 A;  4BY1 I;  4NBB A;  3S1R I;  1K8A 2;  1QVG Y;  2R6M A;  3CC4 1;  3JAM f;  1L1O C;  1YHQ Z;  3Q87 A;  3MON A;  1YUA A;  4NB8 A;  3CC2 1;  3T4N B;  1K9M 1;  3J80 f;  4DQY B;  2E2H I;  1VQP 1;  1USP A;  3CCM 1;  3CCV 1;  3CCU 1;  3CXC Y;  4HH4 A;  3CD6 Z;  3IFU A;  3GTG I;  4NBG A;  3CCL Z;  1X3W A;  2V8J A;  3CPW Z;  5T6B A;  3CC7 Z;  4A3F I;  1VQ4 1;  1VQM 1;  3RZO I;  4MD8 A;  4A3I I;  1YIJ 1;  2NVQ I;  3G71 Z;  3FQM A;  5C3E I;  2O4H A;  3CCR Z;  3BG0 B;  2IZ3 A;  3CCE Z;  5C4X I;  5T64 A;  2AKL A;  4E31 A;  3TE5 B;  2P3Y A;  1Z01 A;  2GU2 A;  2YAD A;  1VLA A;  1NJI 1;  1K73 1;  4A3D I;  2OTJ 1;  3NFZ A;  1Q81 1;  5D1O A;  4A3L I;  4NFR A;  2QRE B;  2RBL A;  3GTM S;  1K9M 2;  1TWC I;  1Y1V S;  1M90 1;  1USP B;  1VQ5 1;  4A93 I;  4NBH A;  1JJ2 Y;  1QF8 A;  4BXX I;  4A3M I;  2VF1 A;  1Z03 A;  1I3Q I;  2J6A A;  4E33 A;  3F3P C;  3BG1 B;  1NUI A;  2QA4 1;  3D6W A;  2EGT A;  3CCE 1;  1QVG Z;  2JMO A;  4Y52 I;  1TWA I;  4E2W A;  5IT9 f;  1RO4 A;  1Q82 2;  2OOX B;  2IZ4 A;  4BY7 I;  1Y1V I;  4RV9 A;  2RPR A;  1R9T I;  3FKI I;  1NJI 2;  1K73 2;  3VMG A;  3CXC Z;  1K83 I;  1Q81 2;  3HKZ A;  1WII A;  2QRC B;  1WCM I;  4HGZ A;  1M90 2;  3J80 b;  1VQP Z;  2E2J I;  3M3Y I;  3F3F C;  3VMH A;  3HOU I;  3CCV Z;  4NBF A;  4RVH A;  3GCF A;  1S72 1;  1KQS Y;  2H85 A;  1PFT A;  4E32 A;  5FLM I;  3GTL I;  3I55 1;  3S17 I;  4NBD A;  1VQO 1;  1VQ4 Z;  2DE6 A;  3MZK B;  2DE5 A;  5A2Q f;  4RVD A;  2OOY B;  4E2X A;  3QWU A;  3H0G I;  4A3B I;  3HOW I;  1JJ2 Z;  3NH5 A;  3G4S Z;  1JWH C;  1VQN Z;  2WAQ A;  1YUK A;  3OW2 Y;  5AN9 F;  2OTJ Z;  3CME 1;  3H3V J;  5LL6 f;  1VQ5 Z;  2HF1 A;  4EWC A;  3HOX I;  4XX2 A;  3M4O I;  1QYP A;  2VUM I;  2JNY A;  5T67 A;  1TWH I;  3CCJ Z;  3PO2 I;  2E9H A;  2QA4 Z;  1Q82 1;  4BBR I;  4RVG A;  3S1Q I;  1LQL A;  1S7M A;  3NDI A;  3G4S 1;  1QVF Y;  5IT9 b;  1VQN 1;  3CCQ 1;  1VQ9 1;  2YU9 I;  3S2H I;  4MD9 A;  1YJN Z;  2NVY I;  5IP9 I;  3K7A I;  1SFO I;  1VQ6 Z;  1KQS Z;  2F4O A;  3ESW A;  2JA7 I;  3EED A;  4MH4 A;  3S15 I;  1VQ7 Z;  1YIT 1;  3S14 I;  3CCJ 1;  3J81 b;  4DGL A;  2RIQ A;  1S72 Z;  1X3Z A;  3HOY I;  1VQL Z;  2B63 I;  3VB9 A;  1WW9 A;  2LFU A;  2QR1 B;  1YI2 1;  3I55 Z;  1VQO Z;  1VQK 1;  1YJN 1;  1N8R 1;  4RS4 A;  3OW2 Z;  1ML8 A;  5C4J I;  4E2Y A;  3S2D I;  1VQ6 1;  3CMA Z;  1YJ9 1;  4NBE A;  1Y1W I;  1YJW Z;  5CM2 M;  4A3G I;  5D1O B;  3JAM b;  2O53 A;  1VQ7 1;  4E2Z A;  1ZB9 A;  2PM9 A;  3FQQ A;  2F4M A;  2K3R A;  3CME Z;  4A3J I;  2Q51 A;  4MRI A;  2QRD B;  1VQL 1;  4A3C I;  2JA8 I;  2RT9 A;  3S16 I;  1DL6 A;  3S1M I;  1TFI A;  1KC8 1;  3NH8 A;  4MXU A;  1QVF Z;  1RQF A;  1Q86 1;  3I4N I;  3CCS Z;  1M1K 1;  2HU9 A;  3KIH A;  4CL1 A;  3CMA 1;  2RHB A;  1YJW 1;  1N8R 2;  1RO0 A;  2QEX 1;  4MD7 A;  2KI7 B;  4S1T A;  1P9N A;  3CCQ Z;  1VQ9 Z;  2QKD A;  4QTT A;  4NB9 A;  3GKQ A;  3I56 Z;  4AYB A;  3HOV I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...