3I4NI

8-oxoguanine containing rna polymerase ii elongation complex e
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
117
structure length
117
Chain Sequence
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 9
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3i4nI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3i4nI02
2JA8I 4NBCA 2DE7A 1R9TI 2R92I 2JR6A 3I07A 2DE5A 3GTGI 3S17I 4A3GI 3CQZI 1TWCI 4BY7I 5C44I 5C4XI 3I4MI 3HOVI 5C4JI 4A3LI 3ESWA 2NVQI 2BJOA 1TWFI 4NBAA 1YUAA 2VUMI 3K7AI 1RLYA 3RZOI 1VLAA 4NBGA 4QTUA 2JNYA 1ML8A 1K83I 2R7ZI 3LUSA 4BY1I 1USPB 3HOXI 4QTTA 3S1MI 3PO3S 3S2DI 3GTMI 3GTPI 1TWAI 4X6AI 4NBBA 5CM2M 5C3EI 3RZDI 3GTMS 3S16I 2JA7I 2E2JI 2E2II 4Y52I 3VMGA 5IP9I 2AKLA 3S1QI 1RO4A 4XX2A 1SFOI 4NBHA 4A3II 4NBEA 2R93I 3D6WA 3VMIA 4NBDA 1TFIA 3HOWI 1L1OC 2HF1A 2NVTI 4A3KI 2JA6I 1N2FA 2NVXI 2K5RA 3GTJI 3U50C 1DL6A 3M3YI 3EERA 4A3JI 4A93I 1Y1VS 3FKII 3I4NI 3M4OI 1ZB9A 3H0GI 4Y7NI 3HOYI 3VMHA 2J6AA 1PFTA 1WW9A 3PO3I 2RBLA 4A3CI 4BBSI 1I6HI 1LQLA 4A3FI 1TWHI 2YU9I 4NBFA 2F4MA 3GTOI 2PK7A 2JS4A 3GTLI 5IP7I 1QYPA 4A3EI 2P3YA 1X3ZA 1X3WA 4A3BI 1WCMI 3GTKI 4A3MI 3S15I 2JA5I 4MH4A 2F4OA 4NB9A 3PO2I 1USPA 3HOZI 3HOUI 2DE6A 1Y1WI 4NB8A 2B63I 2NVYI 1NUIA 3GCFA 3S1NI 1I50I 2E2HI 1TWGI 3VB9A 3H3VJ 3GTQI 4BBRI 3GKQA 5FLMI 1I3QI 3S14I 3Q87A 4NOZA 1Y1VI 4BXXI 2KPIA 4A3DI 3S1RI 3S2HI 1ZB8A
chains in the Genus database with same CATH superfamily
4MD7A 4NBCA 1R9TI 4DQYB 2QKDA 4RVHA 3MZKB 1K8A1 3G711 5A2Qf 5C4JI 2NVQI 4NBAA 1TWFI 3CCQZ 2LIYA 2JUBA 2JIMA 1YIJZ 4AYBA 2V8JA 1KQSY 4NBGA 1N8R1 1VQ7Z 4RVDA 2R7ZI 4BY1I 3D2LA 3S2DI 1VQN1 3GTMI 3GTPI 3TE5B 1VQ6Z 2PMZA 1Z03A 3CD6Z 2E2II 4MD9A 3CMAZ 4NBHA 2OTJ1 2Q51A 3VMIA 2GTHA 3CC2Z 2HF1A 3NH5A 2NVTI 5FLXb 3I561 3CCVZ 3U50C 3CC71 3MONA 5A2Qb 3CCE1 2QA41 2Y0SA 3J7A4 1K9M1 2GU2A 1S7MA 1Y1VS 4RS4A 1K732 3CCL1 3VMHA 3IX0A 1WZNA 2WAQA 2RBLA 1WJ2A 1YJN1 3CXCY 2VF1A 4HGYA 1I6HI 2OTJZ 2O53A 3CCM1 3CCMZ 2K3RA 1JJ2Z 1VQ4Z 1VQ71 4A3BI 3S15I 5FLXf 3CCS1 4MH4A 3OW2Z 3PO2I 3HOUI 1YI2Z 1YI21 1VQM1 1Y1WI 4E30A 2B63I 2NVYI 3CXCZ 5FLMI 1I3QI 1VQ51 2QR1B 4NOZA 3CCUZ 1QXFA 3S2HI 5C44I 3JAMb 5IT9f 3NDJA 3T4NB 3S17I 2QRCB 1VQKZ 1NJI2 2W04A 1VQ81 2V8IA 1VQ8Z 1TWCI 4BY7I 1YITZ 2JIQA 5LL6f 3CC7Z 1YIT1 2WB1A 1YUAA 3K7AI 1RLYA 3RZOI 4QTUA 4E2XA 1VQL1 4QTTA 3S1MI 3NH8A 1QVGZ 1TWAI 2VPYA 1YJNZ 4NBBA 5CM2M 3CMA1 2AYDA 3CCU1 3S16I 2JA7I 2GTIA 4HGZA 2E2JI 2IZ3A 3G4SZ 3VMGA 2QREB 1VQO1 3IR7A 2AKLA 3FQQA 4XX2A 3KIHA 3CCQ1 4A3II 2P28A 4MONA 1Q812 4A3KI 2K5RA 2YADA 3GTJI 2RPRA 2QRDB 2W03A 4A3JI 2R6MA 1VQ5Z 2E9HA 2OTLZ 3FKII 1QVFZ 3M4OI 1ZB9A 1Z01A 3H0GI 3G4S1 2J6AA 1PFTA 1WW9A 3PO3I 3CC21 1LQLA 2OOYB 1TWHI 4A3FI 4NBFA 2YU9I 2OOXB 2PK7A 2JS4A 5IP7I 1JJ2Y 2P3YA 3F3FC 1KD11 5D1OA 1X3ZA 1X3WA 1VQMZ 1WIIA 4A3MI 3OW2Y 3CD61 1K731 2F4OA 4NB9A 4NFRA 2QLVB 2VUGA 4DGLA 2OTL1 2DE6A 4RVGA 1NUIA 4HH4A 1VQPZ 1I50I 1VQOZ 1TWGI 3H3VJ 3GKQA 5D1PA 2LEXA 2KI7B 4BXXI 1VQK1 4A3DI 3S1RI 2G2KA 3NH4A 2JA8I 1VQ41 2DE7A 1RO2A 3VTNA 2DE5A 3GTGI 4A3GI 3CQZI 1QVGY 2V8KA 1VQ61 2E7ZA 3CCRZ 5T67A 5C4XI 3HOVI 1S72Z 4A3LI 3CCLZ 2BJOA 1VLAA 1W2BY 2JNYA 3KIFA 1USPB 3J81f 3PO3S 1RNIA 3IFUA 2O4HA 4Y52I 3NDIA 2M6NA 5IP9I 4DK1A 4S1TA 1RO4A 1SFOI 1W2BZ 3D6WA 1SIWA 4NBDA 2V45A 3HOWI 2JIRA 1KC81 2HU9A 1M1K1 3BG0B 3G6EZ 1FDIA 1YJ9Z 1YJ91 1DL6A 3FQMA 3EERA 1NJI1 1Q7Y1 2OZKA 1KRLA 1Z02A 1KQSZ 3CCJ1 4EWCA 3D9XA 3I56Z 1YIJ1 2IZ4A 4A3CI 3CC41 1FDOA 2V3VA 4BBSI 3MZLB 2F4MA 3NFZA 1KC82 1S721 3GTOI 2RT9A 2H85A 3CCR1 3GTLI 4RVFA 4E32A 1WCMI 3GTKI 1Q862 2JA5I 3G71Z 1USPA 4RV9A 2QEXZ 1NP6A 4NB8A 1YUKA 3GCFA 1Q811 1K8A2 4BBRI 3P5JB 4E2YA 3Q87A 1Y1VI 3QWUA 3J80f 4TNUA 2M48A 3BG1B 4MXUA 3CPWZ 1ZB8A 4E31A 1JWHC 2R92I 2JR6A 3I07A 3J81b 1K9M2 1RO0A 2ZAEB 1Q16A 3I4MI 3ESWA 2VPXA 2VPWA 5D1OB 2VUMI 1M1K2 1QVFY 2EGTA 1QF8A 5AN9F 3JAMf 1ML8A 1K83I 1Q7Y2 3LUSA 1YJWZ 3HOXI 2JIOA 3IF8A 3CCV1 4X6AI 1RQFA 2RIQA 2JMOA 3RZDI 5C3EI 4E2ZA 3GTMS 3CCEZ 2QA4Z 1P9NA 1Q822 1M902 3J80b 1VQ9Z 1VQ91 3S1QI 3G6E1 1KD12 4NBEA 2R93I 1TFIA 1L1OC 1Q861 1VQP1 2QEX1 2VPZA 2JA6I 1N2FA 1N8R2 2NVXI 2PM9A 5T64A 1Y8CA 3CCJZ 1YJW1 3M3YI 4A93I 5T6BA 1ZH1A 4E2WA 1Q821 1YHQ1 1M901 2NAPA 3CCSZ 1YHQZ 3CC4Z 4E33A 4Y7NI 1VQNZ 3HOYI 5IT9b 3I551 3EEDA 1AA6A 2LFUA 2Q4ZA 3TDHB 2RHBA 1QYPA 4A3EI 4MRIA 4CL1A 3CMEZ 3CME1 3HOZI 4MD8A 3S1NI 2JIPA 2E2HI 3VB9A 3GTQI 3S14I 4NH1C 3I55Z 2IV2X 1VQLZ 1X0TA 3F3PC 3HKZA 3CPWY 2KPIA 2I3CA 3I4NI
chains in the Genus database with same CATH topology
4MD7A 4NBCA 1R9TI 4DQYB 2QKDA 4RVHA 3MZKB 1K8A1 3G711 5A2Qf 5C4JI 2NVQI 4NBAA 1TWFI 3CCQZ 2LIYA 2JUBA 1YIJZ 4AYBA 2V8JA 1KQSY 4NBGA 1N8R1 1VQ7Z 4RVDA 2R7ZI 4BY1I 3S2DI 1VQN1 3GTMI 3GTPI 3TE5B 1VQ6Z 2PMZA 1Z03A 3CD6Z 2E2II 4MD9A 3CMAZ 4NBHA 2OTJ1 2Q51A 3VMIA 2GTHA 3CC2Z 2HF1A 3NH5A 2NVTI 5FLXb 3I561 3CCVZ 3U50C 3CC71 3MONA 5A2Qb 3CCE1 2QA41 2Y0SA 3J7A4 1K9M1 2GU2A 1S7MA 1Y1VS 4RS4A 1K732 3CCL1 3VMHA 3IX0A 2WAQA 2RBLA 1YJN1 3CXCY 2VF1A 4HGYA 1I6HI 2OTJZ 2O53A 3CCM1 3CCMZ 2K3RA 1JJ2Z 1VQ4Z 1VQ71 4A3BI 3S15I 5FLXf 3CCS1 4MH4A 3OW2Z 3PO2I 3HOUI 1YI2Z 1YI21 1VQM1 1Y1WI 4E30A 2B63I 2NVYI 3CXCZ 5FLMI 1I3QI 1VQ51 2QR1B 4NOZA 3CCUZ 3S2HI 5C44I 3JAMb 5IT9f 3NDJA 3T4NB 3S17I 2QRCB 1VQKZ 1NJI2 2W04A 1VQ81 2V8IA 1VQ8Z 1TWCI 4BY7I 1YITZ 5LL6f 3CC7Z 1YIT1 2WB1A 1YUAA 3K7AI 1RLYA 3RZOI 4QTUA 4E2XA 1VQL1 4QTTA 3S1MI 3NH8A 1QVGZ 1TWAI 1YJNZ 4NBBA 5CM2M 3CMA1 3CCU1 3S16I 2JA7I 2GTIA 4HGZA 2E2JI 2IZ3A 3G4SZ 3VMGA 2QREB 1VQO1 2AKLA 3FQQA 4XX2A 3KIHA 3CCQ1 4A3II 2P28A 4MONA 1Q812 4A3KI 2K5RA 2YADA 3GTJI 2RPRA 2QRDB 2W03A 4A3JI 2R6MA 1VQ5Z 2E9HA 2OTLZ 3FKII 1QVFZ 3M4OI 1ZB9A 1Z01A 3H0GI 3G4S1 2J6AA 1PFTA 1WW9A 3PO3I 3CC21 1LQLA 2OOYB 1TWHI 4A3FI 4NBFA 2YU9I 2OOXB 2PK7A 2JS4A 5IP7I 1JJ2Y 2P3YA 3F3FC 1KD11 5D1OA 1X3ZA 1X3WA 1VQMZ 1WIIA 4A3MI 3OW2Y 3CD61 1K731 2F4OA 4NB9A 4NFRA 2QLVB 2VUGA 4DGLA 2OTL1 2DE6A 4RVGA 1NUIA 4HH4A 1VQPZ 1I50I 1VQOZ 1TWGI 3H3VJ 3GKQA 5D1PA 2KI7B 4BXXI 1VQK1 4A3DI 3S1RI 2G2KA 3NH4A 2JA8I 1VQ41 2DE7A 1RO2A 3VTNA 2DE5A 3GTGI 4A3GI 3CQZI 1QVGY 2V8KA 1VQ61 3CCRZ 5T67A 5C4XI 3HOVI 1S72Z 4A3LI 3CCLZ 2BJOA 1VLAA 1W2BY 2JNYA 3KIFA 1USPB 3J81f 3PO3S 1RNIA 3IFUA 2O4HA 4Y52I 3NDIA 2M6NA 5IP9I 4DK1A 4S1TA 1RO4A 1SFOI 1W2BZ 3D6WA 4NBDA 3HOWI 1KC81 2HU9A 1M1K1 3BG0B 3G6EZ 1YJ9Z 1YJ91 1DL6A 3FQMA 3EERA 1NJI1 1Q7Y1 2OZKA 1KRLA 1Z02A 1KQSZ 3CCJ1 4EWCA 3D9XA 3I56Z 1YIJ1 2IZ4A 4A3CI 3CC41 4BBSI 3MZLB 2F4MA 3NFZA 1KC82 1S721 3GTOI 2RT9A 2H85A 3CCR1 3GTLI 4RVFA 4E32A 1WCMI 3GTKI 1Q862 2JA5I 3G71Z 1USPA 4RV9A 2QEXZ 1NP6A 4NB8A 1YUKA 3GCFA 1Q811 1K8A2 4BBRI 3P5JB 4E2YA 3Q87A 1Y1VI 3QWUA 3J80f 4TNUA 2M48A 3BG1B 4MXUA 3CPWZ 1ZB8A 4E31A 1JWHC 2R92I 2JR6A 3I07A 3J81b 1K9M2 1RO0A 2ZAEB 3I4MI 3ESWA 5D1OB 2VUMI 1M1K2 1QVFY 2EGTA 1QF8A 5AN9F 3JAMf 1ML8A 1K83I 1Q7Y2 3LUSA 1YJWZ 3HOXI 3IF8A 3CCV1 4X6AI 1RQFA 2RIQA 2JMOA 5C3EI 3RZDI 4E2ZA 3GTMS 3CCEZ 2QA4Z 1P9NA 1Q822 1M902 3J80b 1VQ9Z 1VQ91 3S1QI 3G6E1 1KD12 4NBEA 2R93I 1TFIA 1L1OC 1Q861 1VQP1 2QEX1 2JA6I 1N2FA 1N8R2 2NVXI 2PM9A 5T64A 3CCJZ 1YJW1 3M3YI 4A93I 5T6BA 1ZH1A 4E2WA 1Q821 1YHQ1 1M901 3CCSZ 1YHQZ 3CC4Z 4E33A 4Y7NI 1VQNZ 3HOYI 5IT9b 3I551 3EEDA 2LFUA 2Q4ZA 3TDHB 2RHBA 1QYPA 4A3EI 4MRIA 4CL1A 3CMEZ 3CME1 3HOZI 4MD8A 3S1NI 2E2HI 3VB9A 3GTQI 3S14I 4NH1C 3I55Z 1VQLZ 1X0TA 3F3PC 3HKZA 3CPWY 2KPIA 2I3CA 3I4NI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA8 I;  4NBC A;  2DE7 A;  1R9T I;  2R92 I;  2JR6 A;  3I07 A;  2DE5 A;  3GTG I;  3S17 I;  4A3G I;  3CQZ I;  1TWC I;  4BY7 I;  5C44 I;  5C4X I;  3I4M I;  3HOV I;  5C4J I;  4A3L I;  3ESW A;  2NVQ I;  2BJO A;  1TWF I;  4NBA A;  1YUA A;  2VUM I;  3K7A I;  1RLY A;  3RZO I;  1VLA A;  4NBG A;  4QTU A;  2JNY A;  1ML8 A;  1K83 I;  2R7Z I;  3LUS A;  4BY1 I;  1USP B;  3HOX I;  4QTT A;  3S1M I;  3PO3 S;  3S2D I;  3GTM I;  3GTP I;  1TWA I;  4X6A I;  4NBB A;  5CM2 M;  5C3E I;  3RZD I;  3GTM S;  3S16 I;  2JA7 I;  2E2J I;  2E2I I;  4Y52 I;  3VMG A;  5IP9 I;  2AKL A;  3S1Q I;  1RO4 A;  4XX2 A;  1SFO I;  4NBH A;  4A3I I;  4NBE A;  2R93 I;  3D6W A;  3VMI A;  4NBD A;  1TFI A;  3HOW I;  1L1O C;  2HF1 A;  2NVT I;  4A3K I;  2JA6 I;  1N2F A;  2NVX I;  2K5R A;  3GTJ I;  3U50 C;  1DL6 A;  3M3Y I;  3EER A;  4A3J I;  4A93 I;  1Y1V S;  3FKI I;  3I4N I;  3M4O I;  1ZB9 A;  3H0G I;  4Y7N I;  3HOY I;  3VMH A;  2J6A A;  1PFT A;  1WW9 A;  3PO3 I;  2RBL A;  4A3C I;  4BBS I;  1I6H I;  1LQL A;  4A3F I;  1TWH I;  2YU9 I;  4NBF A;  2F4M A;  3GTO I;  2PK7 A;  2JS4 A;  3GTL I;  5IP7 I;  1QYP A;  4A3E I;  2P3Y A;  1X3Z A;  1X3W A;  4A3B I;  1WCM I;  3GTK I;  4A3M I;  3S15 I;  2JA5 I;  4MH4 A;  2F4O A;  4NB9 A;  3PO2 I;  1USP A;  3HOZ I;  3HOU I;  2DE6 A;  1Y1W I;  4NB8 A;  2B63 I;  2NVY I;  1NUI A;  3GCF A;  3S1N I;  1I50 I;  2E2H I;  1TWG I;  3VB9 A;  3H3V J;  3GTQ I;  4BBR I;  3GKQ A;  5FLM I;  1I3Q I;  3S14 I;  3Q87 A;  4NOZ A;  1Y1V I;  4BXX I;  2KPI A;  4A3D I;  3S1R I;  3S2H I;  1ZB8 A; 
#chains in the Genus database with same CATH topology
 4MD7 A;  4NBC A;  1R9T I;  4DQY B;  2QKD A;  4RVH A;  3MZK B;  1K8A 1;  3G71 1;  5A2Q f;  5C4J I;  2NVQ I;  4NBA A;  1TWF I;  3CCQ Z;  2LIY A;  2JUB A;  2JIM A;  1YIJ Z;  4AYB A;  2V8J A;  1KQS Y;  4NBG A;  1N8R 1;  1VQ7 Z;  4RVD A;  2R7Z I;  4BY1 I;  3D2L A;  3S2D I;  1VQN 1;  3GTM I;  3GTP I;  3TE5 B;  1VQ6 Z;  2PMZ A;  1Z03 A;  3CD6 Z;  2E2I I;  4MD9 A;  3CMA Z;  4NBH A;  2OTJ 1;  2Q51 A;  3VMI A;  2GTH A;  3CC2 Z;  2HF1 A;  3NH5 A;  2NVT I;  5FLX b;  3I56 1;  3CCV Z;  3U50 C;  3CC7 1;  3MON A;  5A2Q b;  3CCE 1;  2QA4 1;  2Y0S A;  3J7A 4;  1K9M 1;  2GU2 A;  1S7M A;  1Y1V S;  4RS4 A;  1K73 2;  3CCL 1;  3VMH A;  3IX0 A;  1WZN A;  2WAQ A;  2RBL A;  1WJ2 A;  1YJN 1;  3CXC Y;  2VF1 A;  4HGY A;  1I6H I;  2OTJ Z;  2O53 A;  3CCM 1;  3CCM Z;  2K3R A;  1JJ2 Z;  1VQ4 Z;  1VQ7 1;  4A3B I;  3S15 I;  5FLX f;  3CCS 1;  4MH4 A;  3OW2 Z;  3PO2 I;  3HOU I;  1YI2 Z;  1YI2 1;  1VQM 1;  1Y1W I;  4E30 A;  2B63 I;  2NVY I;  3CXC Z;  5FLM I;  1I3Q I;  1VQ5 1;  2QR1 B;  4NOZ A;  3CCU Z;  1QXF A;  3S2H I;  5C44 I;  3JAM b;  5IT9 f;  3NDJ A;  3T4N B;  3S17 I;  2QRC B;  1VQK Z;  1NJI 2;  2W04 A;  1VQ8 1;  2V8I A;  1VQ8 Z;  1TWC I;  4BY7 I;  1YIT Z;  2JIQ A;  5LL6 f;  3CC7 Z;  1YIT 1;  2WB1 A;  1YUA A;  3K7A I;  1RLY A;  3RZO I;  4QTU A;  4E2X A;  1VQL 1;  4QTT A;  3S1M I;  3NH8 A;  1QVG Z;  1TWA I;  2VPY A;  1YJN Z;  4NBB A;  5CM2 M;  3CMA 1;  2AYD A;  3CCU 1;  3S16 I;  2JA7 I;  2GTI A;  4HGZ A;  2E2J I;  2IZ3 A;  3G4S Z;  3VMG A;  2QRE B;  1VQO 1;  3IR7 A;  2AKL A;  3FQQ A;  4XX2 A;  3KIH A;  3CCQ 1;  4A3I I;  2P28 A;  4MON A;  1Q81 2;  4A3K I;  2K5R A;  2YAD A;  3GTJ I;  2RPR A;  2QRD B;  2W03 A;  4A3J I;  2R6M A;  1VQ5 Z;  2E9H A;  2OTL Z;  3FKI I;  1QVF Z;  3M4O I;  1ZB9 A;  1Z01 A;  3H0G I;  3G4S 1;  2J6A A;  1PFT A;  1WW9 A;  3PO3 I;  3CC2 1;  1LQL A;  2OOY B;  1TWH I;  4A3F I;  4NBF A;  2YU9 I;  2OOX B;  2PK7 A;  2JS4 A;  5IP7 I;  1JJ2 Y;  2P3Y A;  3F3F C;  1KD1 1;  5D1O A;  1X3Z A;  1X3W A;  1VQM Z;  1WII A;  4A3M I;  3OW2 Y;  3CD6 1;  1K73 1;  2F4O A;  4NB9 A;  4NFR A;  2QLV B;  2VUG A;  4DGL A;  2OTL 1;  2DE6 A;  4RVG A;  1NUI A;  4HH4 A;  1VQP Z;  1I50 I;  1VQO Z;  1TWG I;  3H3V J;  3GKQ A;  5D1P A;  2LEX A;  2KI7 B;  4BXX I;  1VQK 1;  4A3D I;  3S1R I;  2G2K A;  3NH4 A;  2JA8 I;  1VQ4 1;  2DE7 A;  1RO2 A;  3VTN A;  2DE5 A;  3GTG I;  4A3G I;  3CQZ I;  1QVG Y;  2V8K A;  1VQ6 1;  2E7Z A;  3CCR Z;  5T67 A;  5C4X I;  3HOV I;  1S72 Z;  4A3L I;  3CCL Z;  2BJO A;  1VLA A;  1W2B Y;  2JNY A;  3KIF A;  1USP B;  3J81 f;  3PO3 S;  1RNI A;  3IFU A;  2O4H A;  4Y52 I;  3NDI A;  2M6N A;  5IP9 I;  4DK1 A;  4S1T A;  1RO4 A;  1SFO I;  1W2B Z;  3D6W A;  1SIW A;  4NBD A;  2V45 A;  3HOW I;  2JIR A;  1KC8 1;  2HU9 A;  1M1K 1;  3BG0 B;  3G6E Z;  1FDI A;  1YJ9 Z;  1YJ9 1;  1DL6 A;  3FQM A;  3EER A;  1NJI 1;  1Q7Y 1;  2OZK A;  1KRL A;  1Z02 A;  1KQS Z;  3CCJ 1;  4EWC A;  3D9X A;  3I56 Z;  1YIJ 1;  2IZ4 A;  4A3C I;  3CC4 1;  1FDO A;  2V3V A;  4BBS I;  3MZL B;  2F4M A;  3NFZ A;  1KC8 2;  1S72 1;  3GTO I;  2RT9 A;  2H85 A;  3CCR 1;  3GTL I;  4RVF A;  4E32 A;  1WCM I;  3GTK I;  1Q86 2;  2JA5 I;  3G71 Z;  1USP A;  4RV9 A;  2QEX Z;  1NP6 A;  4NB8 A;  1YUK A;  3GCF A;  1Q81 1;  1K8A 2;  4BBR I;  3P5J B;  4E2Y A;  3Q87 A;  1Y1V I;  3QWU A;  3J80 f;  4TNU A;  2M48 A;  3BG1 B;  4MXU A;  3CPW Z;  1ZB8 A;  4E31 A;  1JWH C;  2R92 I;  2JR6 A;  3I07 A;  3J81 b;  1K9M 2;  1RO0 A;  2ZAE B;  1Q16 A;  3I4M I;  3ESW A;  2VPX A;  2VPW A;  5D1O B;  2VUM I;  1M1K 2;  1QVF Y;  2EGT A;  1QF8 A;  5AN9 F;  3JAM f;  1ML8 A;  1K83 I;  1Q7Y 2;  3LUS A;  1YJW Z;  3HOX I;  2JIO A;  3IF8 A;  3CCV 1;  4X6A I;  1RQF A;  2RIQ A;  2JMO A;  3RZD I;  5C3E I;  4E2Z A;  3GTM S;  3CCE Z;  2QA4 Z;  1P9N A;  1Q82 2;  1M90 2;  3J80 b;  1VQ9 Z;  1VQ9 1;  3S1Q I;  3G6E 1;  1KD1 2;  4NBE A;  2R93 I;  1TFI A;  1L1O C;  1Q86 1;  1VQP 1;  2QEX 1;  2VPZ A;  2JA6 I;  1N2F A;  1N8R 2;  2NVX I;  2PM9 A;  5T64 A;  1Y8C A;  3CCJ Z;  1YJW 1;  3M3Y I;  4A93 I;  5T6B A;  1ZH1 A;  4E2W A;  1Q82 1;  1YHQ 1;  1M90 1;  2NAP A;  3CCS Z;  1YHQ Z;  3CC4 Z;  4E33 A;  4Y7N I;  1VQN Z;  3HOY I;  5IT9 b;  3I55 1;  3EED A;  1AA6 A;  2LFU A;  2Q4Z A;  3TDH B;  2RHB A;  1QYP A;  4A3E I;  4MRI A;  4CL1 A;  3CME Z;  3CME 1;  3HOZ I;  4MD8 A;  3S1N I;  2JIP A;  2E2H I;  3VB9 A;  3GTQ I;  3S14 I;  4NH1 C;  3I55 Z;  2IV2 X;  1VQL Z;  1X0T A;  3F3P C;  3HKZ A;  3CPW Y;  2KPI A;  2I3C A;  3I4N I; 
#chains in the Genus database with same CATH homology
 4MD7 A;  4NBC A;  1R9T I;  4DQY B;  2QKD A;  4RVH A;  3MZK B;  1K8A 1;  3G71 1;  5A2Q f;  5C4J I;  2NVQ I;  4NBA A;  1TWF I;  3CCQ Z;  2LIY A;  2JUB A;  1YIJ Z;  4AYB A;  2V8J A;  1KQS Y;  4NBG A;  1N8R 1;  1VQ7 Z;  4RVD A;  2R7Z I;  4BY1 I;  3S2D I;  1VQN 1;  3GTM I;  3GTP I;  3TE5 B;  1VQ6 Z;  2PMZ A;  1Z03 A;  3CD6 Z;  2E2I I;  4MD9 A;  3CMA Z;  4NBH A;  2OTJ 1;  2Q51 A;  3VMI A;  2GTH A;  3CC2 Z;  2HF1 A;  3NH5 A;  2NVT I;  5FLX b;  3I56 1;  3CCV Z;  3U50 C;  3CC7 1;  3MON A;  5A2Q b;  3CCE 1;  2QA4 1;  2Y0S A;  3J7A 4;  1K9M 1;  2GU2 A;  1S7M A;  1Y1V S;  4RS4 A;  1K73 2;  3CCL 1;  3VMH A;  3IX0 A;  2WAQ A;  2RBL A;  1YJN 1;  3CXC Y;  2VF1 A;  4HGY A;  1I6H I;  2OTJ Z;  2O53 A;  3CCM 1;  3CCM Z;  2K3R A;  1JJ2 Z;  1VQ4 Z;  1VQ7 1;  4A3B I;  3S15 I;  5FLX f;  3CCS 1;  4MH4 A;  3OW2 Z;  3PO2 I;  3HOU I;  1YI2 Z;  1YI2 1;  1VQM 1;  1Y1W I;  4E30 A;  2B63 I;  2NVY I;  3CXC Z;  5FLM I;  1I3Q I;  1VQ5 1;  2QR1 B;  4NOZ A;  3CCU Z;  3S2H I;  5C44 I;  3JAM b;  5IT9 f;  3NDJ A;  3T4N B;  3S17 I;  2QRC B;  1VQK Z;  1NJI 2;  2W04 A;  1VQ8 1;  2V8I A;  1VQ8 Z;  1TWC I;  4BY7 I;  1YIT Z;  5LL6 f;  3CC7 Z;  1YIT 1;  2WB1 A;  1YUA A;  3K7A I;  1RLY A;  3RZO I;  4QTU A;  4E2X A;  1VQL 1;  4QTT A;  3S1M I;  3NH8 A;  1QVG Z;  1TWA I;  1YJN Z;  4NBB A;  5CM2 M;  3CMA 1;  3CCU 1;  3S16 I;  2JA7 I;  2GTI A;  4HGZ A;  2E2J I;  2IZ3 A;  3G4S Z;  3VMG A;  2QRE B;  1VQO 1;  2AKL A;  3FQQ A;  4XX2 A;  3KIH A;  3CCQ 1;  4A3I I;  2P28 A;  4MON A;  1Q81 2;  4A3K I;  2K5R A;  2YAD A;  3GTJ I;  2RPR A;  2QRD B;  2W03 A;  4A3J I;  2R6M A;  1VQ5 Z;  2E9H A;  2OTL Z;  3FKI I;  1QVF Z;  3M4O I;  1ZB9 A;  1Z01 A;  3H0G I;  3G4S 1;  2J6A A;  1PFT A;  1WW9 A;  3PO3 I;  3CC2 1;  1LQL A;  2OOY B;  1TWH I;  4A3F I;  4NBF A;  2YU9 I;  2OOX B;  2PK7 A;  2JS4 A;  5IP7 I;  1JJ2 Y;  2P3Y A;  3F3F C;  1KD1 1;  5D1O A;  1X3Z A;  1X3W A;  1VQM Z;  1WII A;  4A3M I;  3OW2 Y;  3CD6 1;  1K73 1;  2F4O A;  4NB9 A;  4NFR A;  2QLV B;  2VUG A;  4DGL A;  2OTL 1;  2DE6 A;  4RVG A;  1NUI A;  4HH4 A;  1VQP Z;  1I50 I;  1VQO Z;  1TWG I;  3H3V J;  3GKQ A;  5D1P A;  2KI7 B;  4BXX I;  1VQK 1;  4A3D I;  3S1R I;  2G2K A;  3NH4 A;  2JA8 I;  1VQ4 1;  2DE7 A;  1RO2 A;  3VTN A;  2DE5 A;  3GTG I;  4A3G I;  3CQZ I;  1QVG Y;  2V8K A;  1VQ6 1;  3CCR Z;  5T67 A;  5C4X I;  3HOV I;  1S72 Z;  4A3L I;  3CCL Z;  2BJO A;  1VLA A;  1W2B Y;  2JNY A;  3KIF A;  1USP B;  3J81 f;  3PO3 S;  1RNI A;  3IFU A;  2O4H A;  4Y52 I;  3NDI A;  2M6N A;  5IP9 I;  4DK1 A;  4S1T A;  1RO4 A;  1SFO I;  1W2B Z;  3D6W A;  4NBD A;  3HOW I;  1KC8 1;  2HU9 A;  1M1K 1;  3BG0 B;  3G6E Z;  1YJ9 Z;  1YJ9 1;  1DL6 A;  3FQM A;  3EER A;  1NJI 1;  1Q7Y 1;  2OZK A;  1KRL A;  1Z02 A;  1KQS Z;  3CCJ 1;  4EWC A;  3D9X A;  3I56 Z;  1YIJ 1;  2IZ4 A;  4A3C I;  3CC4 1;  4BBS I;  3MZL B;  2F4M A;  3NFZ A;  1KC8 2;  1S72 1;  3GTO I;  2RT9 A;  2H85 A;  3CCR 1;  3GTL I;  4RVF A;  4E32 A;  1WCM I;  3GTK I;  1Q86 2;  2JA5 I;  3G71 Z;  1USP A;  4RV9 A;  2QEX Z;  1NP6 A;  4NB8 A;  1YUK A;  3GCF A;  1Q81 1;  1K8A 2;  4BBR I;  3P5J B;  4E2Y A;  3Q87 A;  1Y1V I;  3QWU A;  3J80 f;  4TNU A;  2M48 A;  3BG1 B;  4MXU A;  3CPW Z;  1ZB8 A;  4E31 A;  1JWH C;  2R92 I;  2JR6 A;  3I07 A;  3J81 b;  1K9M 2;  1RO0 A;  2ZAE B;  3I4M I;  3ESW A;  5D1O B;  2VUM I;  1M1K 2;  1QVF Y;  2EGT A;  1QF8 A;  5AN9 F;  3JAM f;  1ML8 A;  1K83 I;  1Q7Y 2;  3LUS A;  1YJW Z;  3HOX I;  3IF8 A;  3CCV 1;  4X6A I;  1RQF A;  2RIQ A;  2JMO A;  5C3E I;  3RZD I;  4E2Z A;  3GTM S;  3CCE Z;  2QA4 Z;  1P9N A;  1Q82 2;  1M90 2;  3J80 b;  1VQ9 Z;  1VQ9 1;  3S1Q I;  3G6E 1;  1KD1 2;  4NBE A;  2R93 I;  1TFI A;  1L1O C;  1Q86 1;  1VQP 1;  2QEX 1;  2JA6 I;  1N2F A;  1N8R 2;  2NVX I;  2PM9 A;  5T64 A;  3CCJ Z;  1YJW 1;  3M3Y I;  4A93 I;  5T6B A;  1ZH1 A;  4E2W A;  1Q82 1;  1YHQ 1;  1M90 1;  3CCS Z;  1YHQ Z;  3CC4 Z;  4E33 A;  4Y7N I;  1VQN Z;  3HOY I;  5IT9 b;  3I55 1;  3EED A;  2LFU A;  2Q4Z A;  3TDH B;  2RHB A;  1QYP A;  4A3E I;  4MRI A;  4CL1 A;  3CME Z;  3CME 1;  3HOZ I;  4MD8 A;  3S1N I;  2E2H I;  3VB9 A;  3GTQ I;  3S14 I;  4NH1 C;  3I55 Z;  1VQL Z;  1X0T A;  3F3P C;  3HKZ A;  3CPW Y;  2KPI A;  2I3C A;  3I4N I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...