4BY7I

Elongating rna polymerase ii-bye1 tld complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA polymerase II complexes with Bye1, a chromatin-binding PHF3/DIDO homologue.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4by7I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4by7I02
1USPB 3GKQA 2BJOA 1Y1VI 2JS4A 3H0GI 4NBBA 2E2II 4NBHA 2J6AA 3PO3I 3S2DI 2JNYA 3LUSA 1NUIA 3GCFA 3HOXI 2DE5A 3VMIA 2B63I 3U50C 1ZB8A 3GTMI 2JR6A 3I4MI 3EERA 1L1OC 3M4OI 3GTKI 1TWGI 4BBSI 4A3II 4A3MI 3D6WA 1WW9A 4NB8A 3ESWA 4NBFA 3M3YI 2R93I 1N2FA 1RO4A 1DL6A 4QTUA 4MH4A 2F4MA 5C3EI 4NBCA 4A93I 2F4OA 4NBGA 1Y1VS 2JA5I 1QYPA 3S2HI 1LQLA 1X3WA 1Y1WI 4A3DI 3H3VJ 2PK7A 3S1QI 1TWCI 2JA6I 5IP7I 4XX2A 4NB9A 1I6HI 3S1NI 5C44I 4Y7NI 1YUAA 3GTMS 1TWHI 3PO2I 4BXXI 4A3GI 3HOWI 4BY7I 1ZB9A 1SFOI 2VUMI 2DE6A 1USPA 4Y52I 1I3QI 1R9TI 4BY1I 1RLYA 5CM2M 2RBLA 3CQZI 4A3KI 2K5RA 2P3YA 1K83I 3FKII 2KPIA 2NVTI 2HF1A 3S1RI 4A3EI 2E2HI 2DE7A 1TFIA 2AKLA 5FLMI 3HOUI 4A3LI 3PO3S 1TWAI 2R7ZI 3VMHA 4A3CI 2R92I 3HOZI 3S1MI 4NBDA 4QTTA 5C4JI 3HOVI 1X3ZA 2NVQI 3GTGI 1PFTA 2E2JI 2NVYI 4NOZA 3GTQI 1ML8A 2NVXI 4X6AI 1TWFI 3K7AI 3S14I 3RZDI 4NBEA 3Q87A 3I4NI 3I07A 4BBRI 3S16I 2JA8I 3RZOI 3S17I 1I50I 3GTLI 3S15I 2JA7I 4A3FI 3GTJI 5IP9I 3HOYI 3GTPI 5C4XI 4A3BI 1WCMI 2YU9I 1VLAA 4NBAA 3GTOI 3VMGA 3VB9A 4A3JI
chains in the Genus database with same CATH superfamily
2HU9A 2OTJ1 3H0GI 1YJW1 4HH4A 3CPWZ 2QA4Z 3PO3I 2JNYA 3LUSA 1NUIA 3GCFA 2M6NA 2B63I 1ZB8A 1VQ71 1L1OC 3M4OI 1JJ2Y 1JWHC 2VUGA 1QVFY 3CC4Z 2JMOA 3BG0B 2GTIA 3CD6Z 2QREB 3M3YI 4RVGA 1N2FA 4QTUA 3OW2Y 4A93I 2K3RA 4TNUA 2F4OA 2P28A 1Y1VS 1YHQ1 1X3WA 3H3VJ 3I56Z 5D1PA 1TWCI 2IZ3A 1VQPZ 3S1NI 2OOYB 2GU2A 3GTMS 3CCMZ 3JAMb 1KC81 3CXCZ 1VQ9Z 2OTJZ 4NFRA 2DE6A 1USPA 3NH8A 1R9TI 5CM2M 1YJWZ 3CQZI 3KIHA 2LEXA 1Q16A 2W04A 4A3KI 3TE5B 1K83I 2KPIA 4A3EI 2IV2X 1Q862 3QWUA 1VQL1 1YJN1 2VF1A 3PO3S 1VQ7Z 1TWAI 2R7ZI 2R92I 1RO0A 3MZKB 4NBDA 4QTTA 5C4JI 1Z03A 4MXUA 3HOVI 2VPZA 5T67A 1X3ZA 1KD11 1WIIA 3IX0A 3CCV1 3JAMf 3CC2Z 1WJ2A 1I50I 1S7MA 2JA7I 4A3FI 5IP9I 2G2KA 3GTPI 4A3BI 1VQ51 3CCR1 1USPB 4MONA 3GKQA 1Y1VI 4NBBA 2O53A 4DGLA 1Q7Y1 2J6AA 3S2DI 3U50C 3GTMI 2JR6A 4DK1A 1VQLZ 4A3II 3EEDA 1M901 4RV9A 3D6WA 1WW9A 4NB8A 1X0TA 2R93I 3G711 5LL6f 1K731 1RO4A 4NBCA 1ZH1A 3G6E1 3CCVZ 1QYPA 3IFUA 2W03A 3CC71 2OTL1 4DQYB 4RVHA 2QKDA 4XX2A 1QVFZ 1I6HI 3G4S1 1NP6A 1VQ5Z 3CCE1 3J80b 3CCRZ 3HOWI 1ZB9A 3F3PC 3OW2Z 2VUMI 1WZNA 1I3QI 1RLYA 2RBLA 2P3YA 3FKII 1S72Z 3S1RI 3NDIA 1RQFA 2DE7A 3NH5A 1TFIA 2GTHA 2O4HA 2RPRA 1FDOA 1VQ41 1RO2A 3TDHB 4CL1A 1YI2Z 1FDIA 1QF8A 5T6BA 3I551 1QVGY 1Q822 2NVQI 3G71Z 2Y0SA 2E2JI 4E2YA 1NJI2 1VQN1 1TWFI 3J80f 3K7AI 3G6EZ 3S14I 1Z02A 1N8R2 2OOXB 3CME1 3S16I 2EGTA 3NFZA 2M48A 5IT9b 3GTLI 2JIMA 3CC7Z 2OTLZ 1YJ91 2I3CA 3HOYI 1M1K1 1Q812 1WCMI 2YU9I 2VPXA 4MD9A 3G4SZ 3CCEZ 1KQSY 4A3JI 2BJOA 4E2WA 4MD8A 1K9M1 1YUKA 2E9HA 4RS4A 4NBHA 3CCJ1 1SIWA 4E32A 4MD7A 1YIT1 2PMZA 3T4NB 4AYBA 3HOXI 2DE5A 1AA6A 2H85A 1K8A1 2LFUA 2V8KA 3NDJA 1YHQZ 2IZ4A 4BBSI 2QRDB 4A3MI 1RNIA 5IT9f 3I55Z 2RHBA 1DL6A 1P9NA 4MH4A 1VQ61 2JUBA 2JA5I 1YIJ1 1KRLA 3CMEZ 3CCU1 1Y1WI 1VQK1 3IF8A 3J7A4 5IP7I 2YADA 1W2BY 4NB9A 1YJNZ 1YJ9Z 5C44I 2Q51A 2ZAEB 3PO2I 1VQO1 4BY7I 5A2Qb 1SFOI 2V45A 1KC82 4Y52I 4BY1I 3MZLB 3CCJZ 1Q861 4RVFA 1YITZ 2HF1A 4S1TA 1Y8CA 5FLMI 4RVDA 4NH1C 1JJ2Z 2PM9A 3VMHA 3CCM1 4E2ZA 4HGYA 3GTGI 3CMA1 2R6MA 4E30A 1QXFA 1KD12 3D9XA 3NH4A 1VQM1 4NOZA 3GTQI 1K9M2 2NVXI 1VQ6Z 4E31A 3RZDI 4NBEA 5A2Qf 3CPWY 3I4NI 4BBRI 1YIJZ 2JA8I 3CCUZ 3RZOI 3S17I 3KIFA 1VQKZ 2QEX1 2VPYA 1K8A2 3GTJI 5C4XI 1QVGZ 1VLAA 3GTOI 5AN9F 3VB9A 3CCQ1 1VQOZ 2JS4A 1VQ81 5D1OA 2RIQA 2E2II 3CCL1 3CC21 1Q7Y2 2E7ZA 3VMIA 3I4MI 3EERA 2QRCB 3GTKI 2JIRA 1TWGI 2QLVB 2JIOA 1KQSZ 5FLXb 3ESWA 3CCS1 4NBFA 1M902 3CXCY 3CMAZ 4E2XA 2LIYA 2F4MA 5C3EI 1K732 1VQMZ 2NAPA 2V3VA 4NBGA 3S2HI 1LQLA 5T64A 4A3DI 2PK7A 3S1QI 3BG1B 2JA6I 2AYDA 3J81b 2V8IA 2QEXZ 4Y7NI 4EWCA 1YUAA 4BXXI 1TWHI 4MRIA 4A3GI 1VQ4Z 5D1OB 2QR1B 3CCQZ 2Q4ZA 3P5JB 1VQ8Z 2QA41 3CCLZ 3HKZA 5FLXf 2K5RA 1VQNZ 2NVTI 2E2HI 1W2BZ 2AKLA 3HOUI 4A3LI 4E33A 2OZKA 4A3CI 3HOZI 3S1MI 3CC41 1Q821 3FQMA 3CD61 3IR7A 2JIQA 3F3FC 2WB1A 3CCSZ 3J81f 1PFTA 3MONA 1NJI1 1Z01A 3FQQA 2NVYI 1N8R1 1ML8A 4X6AI 2V8JA 3VTNA 1S721 3Q87A 3I07A 3I561 1VQP1 1Q811 3S15I 2KI7B 2RT9A 2VPWA 1YI21 3D2LA 4HGZA 4NBAA 1M1K2 2JIPA 2WAQA 3VMGA 1VQ91
chains in the Genus database with same CATH topology
2HU9A 2OTJ1 3H0GI 1YJW1 4HH4A 3CPWZ 2QA4Z 3PO3I 2JNYA 3LUSA 1NUIA 3GCFA 2M6NA 2B63I 1ZB8A 1VQ71 1L1OC 3M4OI 1JJ2Y 1JWHC 2VUGA 1QVFY 3CC4Z 2JMOA 3BG0B 2GTIA 3CD6Z 2QREB 3M3YI 4RVGA 1N2FA 4QTUA 3OW2Y 4A93I 2K3RA 4TNUA 2F4OA 2P28A 1Y1VS 1YHQ1 1X3WA 3H3VJ 3I56Z 5D1PA 1TWCI 2IZ3A 1VQPZ 3S1NI 2OOYB 2GU2A 3GTMS 3CCMZ 3JAMb 1KC81 3CXCZ 1VQ9Z 2OTJZ 4NFRA 2DE6A 1USPA 3NH8A 1R9TI 5CM2M 1YJWZ 3CQZI 3KIHA 2W04A 4A3KI 3TE5B 1K83I 2KPIA 4A3EI 1Q862 3QWUA 1VQL1 1YJN1 2VF1A 3PO3S 1VQ7Z 1TWAI 2R7ZI 2R92I 1RO0A 3MZKB 4NBDA 4QTTA 5C4JI 1Z03A 4MXUA 3HOVI 5T67A 1X3ZA 1KD11 1WIIA 3IX0A 3CCV1 3JAMf 3CC2Z 1I50I 1S7MA 2JA7I 4A3FI 5IP9I 2G2KA 3GTPI 4A3BI 1VQ51 3CCR1 1USPB 4MONA 3GKQA 1Y1VI 4NBBA 2O53A 4DGLA 1Q7Y1 2J6AA 3S2DI 3U50C 3GTMI 2JR6A 4DK1A 1VQLZ 4A3II 3EEDA 1M901 4RV9A 3D6WA 1WW9A 4NB8A 1X0TA 2R93I 3G711 5LL6f 1K731 1RO4A 4NBCA 1ZH1A 3G6E1 3CCVZ 1QYPA 3IFUA 2W03A 3CC71 2OTL1 4DQYB 4RVHA 2QKDA 4XX2A 1QVFZ 1I6HI 3G4S1 1NP6A 1VQ5Z 3CCE1 3J80b 3CCRZ 3HOWI 1ZB9A 3F3PC 3OW2Z 2VUMI 1I3QI 1RLYA 2RBLA 2P3YA 3FKII 1S72Z 3S1RI 3NDIA 1RQFA 2DE7A 3NH5A 1TFIA 2GTHA 2O4HA 2RPRA 1VQ41 1RO2A 3TDHB 4CL1A 1YI2Z 5T6BA 1QF8A 3I551 1QVGY 2NVQI 1Q822 3G71Z 2Y0SA 2E2JI 4E2YA 1NJI2 1VQN1 1TWFI 3J80f 3K7AI 3G6EZ 3S14I 1Z02A 1N8R2 2OOXB 3CME1 3S16I 2EGTA 3NFZA 2M48A 5IT9b 3GTLI 3CC7Z 2OTLZ 1YJ91 2I3CA 3HOYI 1M1K1 1Q812 1WCMI 2YU9I 4MD9A 3G4SZ 3CCEZ 1KQSY 4A3JI 2BJOA 4E2WA 4MD8A 1K9M1 1YUKA 2E9HA 4RS4A 4NBHA 3CCJ1 4E32A 4MD7A 1YIT1 2PMZA 3T4NB 4AYBA 3HOXI 2DE5A 2H85A 1K8A1 2LFUA 2V8KA 3NDJA 1YHQZ 2IZ4A 4BBSI 2QRDB 4A3MI 1RNIA 5IT9f 3I55Z 2RHBA 1DL6A 1P9NA 4MH4A 1VQ61 2JUBA 2JA5I 1YIJ1 1KRLA 3CMEZ 3CCU1 1Y1WI 1VQK1 3IF8A 3J7A4 5IP7I 2YADA 1W2BY 4NB9A 1YJNZ 1YJ9Z 5C44I 2Q51A 2ZAEB 3PO2I 1VQO1 4BY7I 5A2Qb 1SFOI 1KC82 4Y52I 4BY1I 3MZLB 3CCJZ 1Q861 4RVFA 1YITZ 2HF1A 4S1TA 5FLMI 4RVDA 4NH1C 1JJ2Z 2PM9A 3VMHA 3CCM1 4E2ZA 4HGYA 3GTGI 3CMA1 2R6MA 4E30A 1KD12 3D9XA 3NH4A 1VQM1 4NOZA 3GTQI 1K9M2 2NVXI 1VQ6Z 4E31A 3RZDI 4NBEA 5A2Qf 3CPWY 3I4NI 4BBRI 1YIJZ 2JA8I 3CCUZ 3RZOI 3S17I 3KIFA 1VQKZ 2QEX1 1K8A2 3GTJI 5C4XI 1QVGZ 1VLAA 3GTOI 5AN9F 3VB9A 3CCQ1 1VQOZ 2JS4A 1VQ81 5D1OA 2RIQA 2E2II 3CCL1 3CC21 1Q7Y2 3VMIA 3I4MI 3EERA 2QRCB 3GTKI 1TWGI 2QLVB 1KQSZ 5FLXb 3ESWA 3CCS1 4NBFA 1M902 3CXCY 3CMAZ 4E2XA 2LIYA 2F4MA 5C3EI 1K732 1VQMZ 4NBGA 3S2HI 1LQLA 5T64A 4A3DI 2PK7A 3S1QI 3BG1B 2JA6I 3J81b 2V8IA 2QEXZ 4Y7NI 4EWCA 1YUAA 4BXXI 1TWHI 4MRIA 4A3GI 1VQ4Z 5D1OB 2QR1B 3CCQZ 2Q4ZA 3P5JB 1VQ8Z 2QA41 3CCLZ 3HKZA 5FLXf 2K5RA 1VQNZ 2NVTI 2E2HI 1W2BZ 2AKLA 3HOUI 4A3LI 4E33A 2OZKA 4A3CI 3HOZI 3S1MI 3CC41 1Q821 3FQMA 3CD61 3F3FC 2WB1A 3CCSZ 3J81f 1PFTA 3MONA 1NJI1 1Z01A 3FQQA 2NVYI 1N8R1 1ML8A 4X6AI 2V8JA 3VTNA 1S721 3Q87A 3I07A 3I561 1VQP1 1Q811 3S15I 2KI7B 2RT9A 1YI21 4HGZA 4NBAA 1M1K2 2WAQA 3VMGA 1VQ91
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1USP B;  3GKQ A;  2BJO A;  1Y1V I;  2JS4 A;  3H0G I;  4NBB A;  2E2I I;  4NBH A;  2J6A A;  3PO3 I;  3S2D I;  2JNY A;  3LUS A;  1NUI A;  3GCF A;  3HOX I;  2DE5 A;  3VMI A;  2B63 I;  3U50 C;  1ZB8 A;  3GTM I;  2JR6 A;  3I4M I;  3EER A;  1L1O C;  3M4O I;  3GTK I;  1TWG I;  4BBS I;  4A3I I;  4A3M I;  3D6W A;  1WW9 A;  4NB8 A;  3ESW A;  4NBF A;  3M3Y I;  2R93 I;  1N2F A;  1RO4 A;  1DL6 A;  4QTU A;  4MH4 A;  2F4M A;  5C3E I;  4NBC A;  4A93 I;  2F4O A;  4NBG A;  1Y1V S;  2JA5 I;  1QYP A;  3S2H I;  1LQL A;  1X3W A;  1Y1W I;  4A3D I;  3H3V J;  2PK7 A;  3S1Q I;  1TWC I;  2JA6 I;  5IP7 I;  4XX2 A;  4NB9 A;  1I6H I;  3S1N I;  5C44 I;  4Y7N I;  1YUA A;  3GTM S;  1TWH I;  3PO2 I;  4BXX I;  4A3G I;  3HOW I;  4BY7 I;  1ZB9 A;  1SFO I;  2VUM I;  2DE6 A;  1USP A;  4Y52 I;  1I3Q I;  1R9T I;  4BY1 I;  1RLY A;  5CM2 M;  2RBL A;  3CQZ I;  4A3K I;  2K5R A;  2P3Y A;  1K83 I;  3FKI I;  2KPI A;  2NVT I;  2HF1 A;  3S1R I;  4A3E I;  2E2H I;  2DE7 A;  1TFI A;  2AKL A;  5FLM I;  3HOU I;  4A3L I;  3PO3 S;  1TWA I;  2R7Z I;  3VMH A;  4A3C I;  2R92 I;  3HOZ I;  3S1M I;  4NBD A;  4QTT A;  5C4J I;  3HOV I;  1X3Z A;  2NVQ I;  3GTG I;  1PFT A;  2E2J I;  2NVY I;  4NOZ A;  3GTQ I;  1ML8 A;  2NVX I;  4X6A I;  1TWF I;  3K7A I;  3S14 I;  3RZD I;  4NBE A;  3Q87 A;  3I4N I;  3I07 A;  4BBR I;  3S16 I;  2JA8 I;  3RZO I;  3S17 I;  1I50 I;  3GTL I;  3S15 I;  2JA7 I;  4A3F I;  3GTJ I;  5IP9 I;  3HOY I;  3GTP I;  5C4X I;  4A3B I;  1WCM I;  2YU9 I;  1VLA A;  4NBA A;  3GTO I;  3VMG A;  3VB9 A;  4A3J I; 
#chains in the Genus database with same CATH topology
 2HU9 A;  2OTJ 1;  3H0G I;  1YJW 1;  4HH4 A;  3CPW Z;  2QA4 Z;  3PO3 I;  2JNY A;  3LUS A;  1NUI A;  3GCF A;  2M6N A;  2B63 I;  1ZB8 A;  1VQ7 1;  1L1O C;  3M4O I;  1JJ2 Y;  1JWH C;  2VUG A;  1QVF Y;  3CC4 Z;  2JMO A;  3BG0 B;  2GTI A;  3CD6 Z;  2QRE B;  3M3Y I;  4RVG A;  1N2F A;  4QTU A;  3OW2 Y;  4A93 I;  2K3R A;  4TNU A;  2F4O A;  2P28 A;  1Y1V S;  1YHQ 1;  1X3W A;  3H3V J;  3I56 Z;  5D1P A;  1TWC I;  2IZ3 A;  1VQP Z;  3S1N I;  2OOY B;  2GU2 A;  3GTM S;  3CCM Z;  3JAM b;  1KC8 1;  3CXC Z;  1VQ9 Z;  2OTJ Z;  4NFR A;  2DE6 A;  1USP A;  3NH8 A;  1R9T I;  5CM2 M;  1YJW Z;  3CQZ I;  3KIH A;  2LEX A;  1Q16 A;  2W04 A;  4A3K I;  3TE5 B;  1K83 I;  2KPI A;  4A3E I;  2IV2 X;  1Q86 2;  3QWU A;  1VQL 1;  1YJN 1;  2VF1 A;  3PO3 S;  1VQ7 Z;  1TWA I;  2R7Z I;  2R92 I;  1RO0 A;  3MZK B;  4NBD A;  4QTT A;  5C4J I;  1Z03 A;  4MXU A;  3HOV I;  2VPZ A;  5T67 A;  1X3Z A;  1KD1 1;  1WII A;  3IX0 A;  3CCV 1;  3JAM f;  3CC2 Z;  1WJ2 A;  1I50 I;  1S7M A;  2JA7 I;  4A3F I;  5IP9 I;  2G2K A;  3GTP I;  4A3B I;  1VQ5 1;  3CCR 1;  1USP B;  4MON A;  3GKQ A;  1Y1V I;  4NBB A;  2O53 A;  4DGL A;  1Q7Y 1;  2J6A A;  3S2D I;  3U50 C;  3GTM I;  2JR6 A;  4DK1 A;  1VQL Z;  4A3I I;  3EED A;  1M90 1;  4RV9 A;  3D6W A;  1WW9 A;  4NB8 A;  1X0T A;  2R93 I;  3G71 1;  5LL6 f;  1K73 1;  1RO4 A;  4NBC A;  1ZH1 A;  3G6E 1;  3CCV Z;  1QYP A;  3IFU A;  2W03 A;  3CC7 1;  2OTL 1;  4DQY B;  4RVH A;  2QKD A;  4XX2 A;  1QVF Z;  1I6H I;  3G4S 1;  1NP6 A;  1VQ5 Z;  3CCE 1;  3J80 b;  3CCR Z;  3HOW I;  1ZB9 A;  3F3P C;  3OW2 Z;  2VUM I;  1WZN A;  1I3Q I;  1RLY A;  2RBL A;  2P3Y A;  3FKI I;  1S72 Z;  3S1R I;  3NDI A;  1RQF A;  2DE7 A;  3NH5 A;  1TFI A;  2GTH A;  2O4H A;  2RPR A;  1FDO A;  1VQ4 1;  1RO2 A;  3TDH B;  4CL1 A;  1YI2 Z;  1FDI A;  1QF8 A;  5T6B A;  3I55 1;  1QVG Y;  1Q82 2;  2NVQ I;  3G71 Z;  2Y0S A;  2E2J I;  4E2Y A;  1NJI 2;  1VQN 1;  1TWF I;  3J80 f;  3K7A I;  3G6E Z;  3S14 I;  1Z02 A;  1N8R 2;  2OOX B;  3CME 1;  3S16 I;  2EGT A;  3NFZ A;  2M48 A;  5IT9 b;  3GTL I;  2JIM A;  3CC7 Z;  2OTL Z;  1YJ9 1;  2I3C A;  3HOY I;  1M1K 1;  1Q81 2;  1WCM I;  2YU9 I;  2VPX A;  4MD9 A;  3G4S Z;  3CCE Z;  1KQS Y;  4A3J I;  2BJO A;  4E2W A;  4MD8 A;  1K9M 1;  1YUK A;  2E9H A;  4RS4 A;  4NBH A;  3CCJ 1;  1SIW A;  4E32 A;  4MD7 A;  1YIT 1;  2PMZ A;  3T4N B;  4AYB A;  3HOX I;  2DE5 A;  1AA6 A;  2H85 A;  1K8A 1;  2LFU A;  2V8K A;  3NDJ A;  1YHQ Z;  2IZ4 A;  4BBS I;  2QRD B;  4A3M I;  1RNI A;  5IT9 f;  3I55 Z;  2RHB A;  1DL6 A;  1P9N A;  4MH4 A;  1VQ6 1;  2JUB A;  2JA5 I;  1YIJ 1;  1KRL A;  3CME Z;  3CCU 1;  1Y1W I;  1VQK 1;  3IF8 A;  3J7A 4;  5IP7 I;  2YAD A;  1W2B Y;  4NB9 A;  1YJN Z;  1YJ9 Z;  5C44 I;  2Q51 A;  2ZAE B;  3PO2 I;  1VQO 1;  4BY7 I;  5A2Q b;  1SFO I;  2V45 A;  1KC8 2;  4Y52 I;  4BY1 I;  3MZL B;  3CCJ Z;  1Q86 1;  4RVF A;  1YIT Z;  2HF1 A;  4S1T A;  1Y8C A;  5FLM I;  4RVD A;  4NH1 C;  1JJ2 Z;  2PM9 A;  3VMH A;  3CCM 1;  4E2Z A;  4HGY A;  3GTG I;  3CMA 1;  2R6M A;  4E30 A;  1QXF A;  1KD1 2;  3D9X A;  3NH4 A;  1VQM 1;  4NOZ A;  3GTQ I;  1K9M 2;  2NVX I;  1VQ6 Z;  4E31 A;  3RZD I;  4NBE A;  5A2Q f;  3CPW Y;  3I4N I;  4BBR I;  1YIJ Z;  2JA8 I;  3CCU Z;  3RZO I;  3S17 I;  3KIF A;  1VQK Z;  2QEX 1;  2VPY A;  1K8A 2;  3GTJ I;  5C4X I;  1QVG Z;  1VLA A;  3GTO I;  5AN9 F;  3VB9 A;  3CCQ 1;  1VQO Z;  2JS4 A;  1VQ8 1;  5D1O A;  2RIQ A;  2E2I I;  3CCL 1;  3CC2 1;  1Q7Y 2;  2E7Z A;  3VMI A;  3I4M I;  3EER A;  2QRC B;  3GTK I;  2JIR A;  1TWG I;  2QLV B;  2JIO A;  1KQS Z;  5FLX b;  3ESW A;  3CCS 1;  4NBF A;  1M90 2;  3CXC Y;  3CMA Z;  4E2X A;  2LIY A;  2F4M A;  5C3E I;  1K73 2;  1VQM Z;  2NAP A;  2V3V A;  4NBG A;  3S2H I;  1LQL A;  5T64 A;  4A3D I;  2PK7 A;  3S1Q I;  3BG1 B;  2JA6 I;  2AYD A;  3J81 b;  2V8I A;  2QEX Z;  4Y7N I;  4EWC A;  1YUA A;  4BXX I;  1TWH I;  4MRI A;  4A3G I;  1VQ4 Z;  5D1O B;  2QR1 B;  3CCQ Z;  2Q4Z A;  3P5J B;  1VQ8 Z;  2QA4 1;  3CCL Z;  3HKZ A;  5FLX f;  2K5R A;  1VQN Z;  2NVT I;  2E2H I;  1W2B Z;  2AKL A;  3HOU I;  4A3L I;  4E33 A;  2OZK A;  4A3C I;  3HOZ I;  3S1M I;  3CC4 1;  1Q82 1;  3FQM A;  3CD6 1;  3IR7 A;  2JIQ A;  3F3F C;  2WB1 A;  3CCS Z;  3J81 f;  1PFT A;  3MON A;  1NJI 1;  1Z01 A;  3FQQ A;  2NVY I;  1N8R 1;  1ML8 A;  4X6A I;  2V8J A;  3VTN A;  1S72 1;  3Q87 A;  3I07 A;  3I56 1;  1VQP 1;  1Q81 1;  3S15 I;  2KI7 B;  2RT9 A;  2VPW A;  1YI2 1;  3D2L A;  4HGZ A;  4NBA A;  1M1K 2;  2JIP A;  2WAQ A;  3VMG A;  1VQ9 1; 
#chains in the Genus database with same CATH homology
 2HU9 A;  2OTJ 1;  3H0G I;  1YJW 1;  4HH4 A;  3CPW Z;  2QA4 Z;  3PO3 I;  2JNY A;  3LUS A;  1NUI A;  3GCF A;  2M6N A;  2B63 I;  1ZB8 A;  1VQ7 1;  1L1O C;  3M4O I;  1JJ2 Y;  1JWH C;  2VUG A;  1QVF Y;  3CC4 Z;  2JMO A;  3BG0 B;  2GTI A;  3CD6 Z;  2QRE B;  3M3Y I;  4RVG A;  1N2F A;  4QTU A;  3OW2 Y;  4A93 I;  2K3R A;  4TNU A;  2F4O A;  2P28 A;  1Y1V S;  1YHQ 1;  1X3W A;  3H3V J;  3I56 Z;  5D1P A;  1TWC I;  2IZ3 A;  1VQP Z;  3S1N I;  2OOY B;  2GU2 A;  3GTM S;  3CCM Z;  3JAM b;  1KC8 1;  3CXC Z;  1VQ9 Z;  2OTJ Z;  4NFR A;  2DE6 A;  1USP A;  3NH8 A;  1R9T I;  5CM2 M;  1YJW Z;  3CQZ I;  3KIH A;  2W04 A;  4A3K I;  3TE5 B;  1K83 I;  2KPI A;  4A3E I;  1Q86 2;  3QWU A;  1VQL 1;  1YJN 1;  2VF1 A;  3PO3 S;  1VQ7 Z;  1TWA I;  2R7Z I;  2R92 I;  1RO0 A;  3MZK B;  4NBD A;  4QTT A;  5C4J I;  1Z03 A;  4MXU A;  3HOV I;  5T67 A;  1X3Z A;  1KD1 1;  1WII A;  3IX0 A;  3CCV 1;  3JAM f;  3CC2 Z;  1I50 I;  1S7M A;  2JA7 I;  4A3F I;  5IP9 I;  2G2K A;  3GTP I;  4A3B I;  1VQ5 1;  3CCR 1;  1USP B;  4MON A;  3GKQ A;  1Y1V I;  4NBB A;  2O53 A;  4DGL A;  1Q7Y 1;  2J6A A;  3S2D I;  3U50 C;  3GTM I;  2JR6 A;  4DK1 A;  1VQL Z;  4A3I I;  3EED A;  1M90 1;  4RV9 A;  3D6W A;  1WW9 A;  4NB8 A;  1X0T A;  2R93 I;  3G71 1;  5LL6 f;  1K73 1;  1RO4 A;  4NBC A;  1ZH1 A;  3G6E 1;  3CCV Z;  1QYP A;  3IFU A;  2W03 A;  3CC7 1;  2OTL 1;  4DQY B;  4RVH A;  2QKD A;  4XX2 A;  1QVF Z;  1I6H I;  3G4S 1;  1NP6 A;  1VQ5 Z;  3CCE 1;  3J80 b;  3CCR Z;  3HOW I;  1ZB9 A;  3F3P C;  3OW2 Z;  2VUM I;  1I3Q I;  1RLY A;  2RBL A;  2P3Y A;  3FKI I;  1S72 Z;  3S1R I;  3NDI A;  1RQF A;  2DE7 A;  3NH5 A;  1TFI A;  2GTH A;  2O4H A;  2RPR A;  1VQ4 1;  1RO2 A;  3TDH B;  4CL1 A;  1YI2 Z;  5T6B A;  1QF8 A;  3I55 1;  1QVG Y;  2NVQ I;  1Q82 2;  3G71 Z;  2Y0S A;  2E2J I;  4E2Y A;  1NJI 2;  1VQN 1;  1TWF I;  3J80 f;  3K7A I;  3G6E Z;  3S14 I;  1Z02 A;  1N8R 2;  2OOX B;  3CME 1;  3S16 I;  2EGT A;  3NFZ A;  2M48 A;  5IT9 b;  3GTL I;  3CC7 Z;  2OTL Z;  1YJ9 1;  2I3C A;  3HOY I;  1M1K 1;  1Q81 2;  1WCM I;  2YU9 I;  4MD9 A;  3G4S Z;  3CCE Z;  1KQS Y;  4A3J I;  2BJO A;  4E2W A;  4MD8 A;  1K9M 1;  1YUK A;  2E9H A;  4RS4 A;  4NBH A;  3CCJ 1;  4E32 A;  4MD7 A;  1YIT 1;  2PMZ A;  3T4N B;  4AYB A;  3HOX I;  2DE5 A;  2H85 A;  1K8A 1;  2LFU A;  2V8K A;  3NDJ A;  1YHQ Z;  2IZ4 A;  4BBS I;  2QRD B;  4A3M I;  1RNI A;  5IT9 f;  3I55 Z;  2RHB A;  1DL6 A;  1P9N A;  4MH4 A;  1VQ6 1;  2JUB A;  2JA5 I;  1YIJ 1;  1KRL A;  3CME Z;  3CCU 1;  1Y1W I;  1VQK 1;  3IF8 A;  3J7A 4;  5IP7 I;  2YAD A;  1W2B Y;  4NB9 A;  1YJN Z;  1YJ9 Z;  5C44 I;  2Q51 A;  2ZAE B;  3PO2 I;  1VQO 1;  4BY7 I;  5A2Q b;  1SFO I;  1KC8 2;  4Y52 I;  4BY1 I;  3MZL B;  3CCJ Z;  1Q86 1;  4RVF A;  1YIT Z;  2HF1 A;  4S1T A;  5FLM I;  4RVD A;  4NH1 C;  1JJ2 Z;  2PM9 A;  3VMH A;  3CCM 1;  4E2Z A;  4HGY A;  3GTG I;  3CMA 1;  2R6M A;  4E30 A;  1KD1 2;  3D9X A;  3NH4 A;  1VQM 1;  4NOZ A;  3GTQ I;  1K9M 2;  2NVX I;  1VQ6 Z;  4E31 A;  3RZD I;  4NBE A;  5A2Q f;  3CPW Y;  3I4N I;  4BBR I;  1YIJ Z;  2JA8 I;  3CCU Z;  3RZO I;  3S17 I;  3KIF A;  1VQK Z;  2QEX 1;  1K8A 2;  3GTJ I;  5C4X I;  1QVG Z;  1VLA A;  3GTO I;  5AN9 F;  3VB9 A;  3CCQ 1;  1VQO Z;  2JS4 A;  1VQ8 1;  5D1O A;  2RIQ A;  2E2I I;  3CCL 1;  3CC2 1;  1Q7Y 2;  3VMI A;  3I4M I;  3EER A;  2QRC B;  3GTK I;  1TWG I;  2QLV B;  1KQS Z;  5FLX b;  3ESW A;  3CCS 1;  4NBF A;  1M90 2;  3CXC Y;  3CMA Z;  4E2X A;  2LIY A;  2F4M A;  5C3E I;  1K73 2;  1VQM Z;  4NBG A;  3S2H I;  1LQL A;  5T64 A;  4A3D I;  2PK7 A;  3S1Q I;  3BG1 B;  2JA6 I;  3J81 b;  2V8I A;  2QEX Z;  4Y7N I;  4EWC A;  1YUA A;  4BXX I;  1TWH I;  4MRI A;  4A3G I;  1VQ4 Z;  5D1O B;  2QR1 B;  3CCQ Z;  2Q4Z A;  3P5J B;  1VQ8 Z;  2QA4 1;  3CCL Z;  3HKZ A;  5FLX f;  2K5R A;  1VQN Z;  2NVT I;  2E2H I;  1W2B Z;  2AKL A;  3HOU I;  4A3L I;  4E33 A;  2OZK A;  4A3C I;  3HOZ I;  3S1M I;  3CC4 1;  1Q82 1;  3FQM A;  3CD6 1;  3F3F C;  2WB1 A;  3CCS Z;  3J81 f;  1PFT A;  3MON A;  1NJI 1;  1Z01 A;  3FQQ A;  2NVY I;  1N8R 1;  1ML8 A;  4X6A I;  2V8J A;  3VTN A;  1S72 1;  3Q87 A;  3I07 A;  3I56 1;  1VQP 1;  1Q81 1;  3S15 I;  2KI7 B;  2RT9 A;  1YI2 1;  4HGZ A;  4NBA A;  1M1K 2;  2WAQ A;  3VMG A;  1VQ9 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...