4BY7I

Elongating rna polymerase ii-bye1 tld complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA polymerase II complexes with Bye1, a chromatin-binding PHF3/DIDO homologue.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4by7I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4by7I02
1K83I 2DE5A 2DE7A 3EERA 3H3VJ 3S14I 2NVXI 3GCFA 1PFTA 1ZB8A 4QTTA 3I4MI 4NBAA 2P3YA 4NBEA 2E2II 2JA6I 3D6WA 4QTUA 2JA7I 2JA8I 4NBCA 3GTQI 5CM2M 3S2HI 4BY7I 2RBLA 2JNYA 3GTGI 2NVYI 3HOUI 3PO2I 3FKII 4NBFA 4A3CI 3PO3I 4BBSI 5C4XI 3PO3S 4A3KI 1LQLA 3HOWI 3S2DI 1ML8A 5C44I 2R7ZI 2BJOA 3I07A 4A3LI 3VMIA 4BY1I 5C4JI 3M4OI 1TWGI 2R93I 1I50I 4X6AI 3I4NI 3GTPI 4MH4A 3K7AI 1TWHI 1VLAA 2NVTI 3HOVI 1DL6A 2F4OA 4A3II 1WW9A 4NB9A 3S1MI 3GTKI 1TWFI 5IP7I 3CQZI 3GKQA 2R92I 2JR6A 3VMHA 1USPA 4Y7NI 3ESWA 1USPB 2JS4A 2E2HI 3M3YI 4A3GI 3S16I 2AKLA 1NUIA 4A3BI 4A93I 2E2JI 2YU9I 3GTOI 2VUMI 2KPIA 1WCMI 1I3QI 1TWAI 1SFOI 3GTLI 3RZOI 3S1QI 3GTJI 2DE6A 4NOZA 3VMGA 4XX2A 3Q87A 1I6HI 1X3WA 2F4MA 4NBHA 2J6AA 4A3FI 4Y52I 5FLMI 4NBBA 1RO4A 3U50C 3GTMI 3VB9A 2K5RA 3S1NI 4A3DI 1N2FA 3GTMS 1RLYA 3S1RI 1Y1VI 2PK7A 3HOXI 5IP9I 4A3MI 3RZDI 4BBRI 1Y1VS 4NB8A 3H0GI 1YUAA 4A3JI 3HOYI 3S17I 3LUSA 2NVQI 1QYPA 2JA5I 5C3EI 1TFIA 1X3ZA 1R9TI 3S15I 4BXXI 4NBGA 1TWCI 1L1OC 4NBDA 2B63I 2HF1A 1Y1WI 1ZB9A 4A3EI 3HOZI
chains in the Genus database with same CATH superfamily
1JJ2Y 5IT9b 1QVFY 1YITZ 1QXFA 2ZAEB 3G71Z 4RVFA 3CC71 1PFTA 1ZB8A 2WAQA 2HU9A 5T6BA 1YIJZ 2JA8I 4NBCA 3CMEZ 2RBLA 3GTGI 3NH8A 2OOXB 1WIIA 3MZLB 5IT9f 3J81b 4BBSI 2RIQA 2QA41 2JIOA 2V8JA 1LQLA 3P5JB 3I56Z 2V3VA 1RNIA 3FQQA 1NJI1 1Q811 3I4NI 3GTPI 3CC21 1Z02A 4MH4A 3K7AI 4E2WA 3J7A4 5LL6f 3HOVI 1Z01A 1DL6A 1YJW1 1FDOA 3CCR1 3BG1B 1WW9A 4NB9A 1QVGY 2KI7B 2QA4Z 4MONA 4CL1A 4Y7NI 1KQSZ 3ESWA 1K9M1 3CPWZ 1N8R2 1VQ7Z 2OZKA 4A3BI 1KD12 3CXCY 1JJ2Z 1QVFZ 2LIYA 3VTNA 1KC81 3GTLI 3TDHB 3GTJI 2O53A 1YJWZ 3CCRZ 4XX2A 3Q87A 3JAMf 1YUKA 5AN9F 3IFUA 3VB9A 1N2FA 3S1RI 1JWHC 1Y1VI 3TE5B 5IP9I 4A3MI 2WB1A 3CCQZ 1KRLA 2GTIA 1VQPZ 3NH4A 3EEDA 2VPZA 3CCJ1 2M6NA 1QYPA 3OW2Y 2JA5I 4NBGA 1TWCI 4NBDA 1M901 2B63I 2HF1A 5FLXb 2W04A 4A3EI 3G4S1 3EERA 3S14I 1YIT1 4DGLA 4MRIA 3NFZA 1QVGZ 3I4MI 2JA6I 3D6WA 2JA7I 3CCU1 3BG0B 2Q4ZA 2GU2A 3CME1 4E32A 2JNYA 2RT9A 2NVYI 3CCJZ 1VQN1 4A3CI 3D2LA 3CXCZ 1P9NA 3PO3S 4A3KI 2IZ3A 3J80f 3HOWI 3S2DI 4AYBA 5C44I 2EGTA 3T4NB 2E7ZA 2RPRA 3G4SZ 1Y8CA 2R7ZI 1VQKZ 2G2KA 2IV2X 3VMIA 4E33A 3M4OI 2PMZA 1TWGI 1I50I 5D1OA 3CCUZ 1Q16A 5D1OB 2NVTI 2GTHA 2F4OA 1VQNZ 3GTKI 1TWFI 2V8IA 5IP7I 2QREB 3GKQA 2JR6A 3VMHA 1USPA 3OW2Z 5T67A 1USPB 2JS4A 2LEXA 3M3YI 3S16I 2AKLA 3MZKB 1VQ71 3CCS1 3CCL1 4NFRA 1RQFA 3J81f 1VQ9Z 2VUMI 3CC4Z 1I3QI 2VPYA 1SFOI 3CCV1 3S1QI 2V45A 3KIFA 1YJ91 2J6AA 1RO4A 4A3DI 3HKZA 1Z03A 1RLYA 2PK7A 3HOXI 3RZDI 1W2BY 3CCQ1 3CCSZ 3CCLZ 4NB8A 4E31A 1VQP1 3H0GI 3S17I 2W03A 2NVQI 1VQ41 3MONA 4E2ZA 1N8R1 1X3ZA 4MXUA 3CCVZ 1KD11 2QLVB 2IZ4A 2OTLZ 1M1K2 1K83I 2QRCB 1YJ9Z 3NDIA 2P28A 4HGYA 4NBAA 1WJ2A 2VUGA 4QTUA 4HGZA 1Q7Y2 4TNUA 3S2HI 4E30A 2Y0SA 1QF8A 4NBFA 1VQ4Z 3PO3I 3G6E1 1VQ51 1Q862 2K3RA 1ML8A 1VQ61 4RV9A 2OTJZ 1VQK1 1K8A2 3I07A 4A3LI 4S1TA 4BY1I 5C4JI 2OOYB 1YI21 3CMAZ 4X6AI 3I551 2QRDB 5FLXf 1TWHI 2JIMA 5A2Qb 1W2BZ 2V8KA 2VPWA 2I3CA 1VQOZ 3G6EZ 3CQZI 4MD8A 1VQ5Z 1Q822 4RS4A 4RVHA 1K732 1VQ6Z 4A3GI 3CCMZ 2RHBA 1VQ91 2E2JI 3GTOI 1YI2Z 2KPIA 1WCMI 2JUBA 3CC41 1S72Z 3I55Z 3KIHA 2NAPA 1RO2A 3F3PC 1YJN1 4NOZA 3VMGA 3CCE1 1X3WA 2F4MA 2QEX1 4RVGA 4NBHA 5FLMI 5D1PA 3S1NI 2YADA 2H85A 3GTMS 2PM9A 3HOYI 1WZNA 3LUSA 4HH4A 4DQYB 1YHQ1 1NJI2 1YJNZ 1L1OC 1Y1WI 1Q812 1ZB9A 2OTL1 3HOZI 3CCEZ 2QEXZ 2DE5A 2DE7A 2E9HA 2JIRA 3H3VJ 2NVXI 3GCFA 5T64A 1X0TA 1VQ81 3CC7Z 4QTTA 2E2II 2P3YA 4NBEA 3IF8A 3GTQI 5CM2M 3NDJA 4DK1A 4BY7I 1K9M2 3HOUI 3PO2I 3FKII 1YHQZ 1VQM1 2VPXA 5C4XI 3NH5A 1RO0A 2JMOA 2OTJ1 1KC82 2BJOA 3QWUA 1FDIA 3JAMb 2QKDA 2R6MA 1VQ8Z 3CD61 3CMA1 2R93I 3FQMA 1AA6A 1M1K1 3F3FC 3CC2Z 2AYDA 3D9XA 4RVDA 1VLAA 2JIPA 1ZH1A 4NH1C 4A3II 1VQO1 3S1MI 1VQMZ 4E2YA 1Q7Y1 2R92I 1VQL1 2QR1B 1SIWA 2E2HI 1NUIA 1M902 4MD7A 2Q51A 3CCM1 1Q861 3CD6Z 4A93I 2LFUA 2YU9I 1S721 4EWCA 1TWAI 1K8A1 2M48A 3RZOI 2DE6A 1I6HI 2JIQA 1VQLZ 3G711 4A3FI 4Y52I 4NBBA 3U50C 3GTMI 3J80b 2K5RA 3IX0A 1YIJ1 5A2Qf 1S7MA 4BBRI 1Y1VS 1YUAA 4A3JI 1Q821 1K731 1KQSY 3IR7A 5C3EI 1TFIA 1R9TI 3S15I 4BXXI 1NP6A 2VF1A 3CPWY 3I561 2O4HA 4MD9A 4E2XA
chains in the Genus database with same CATH topology
1JJ2Y 5IT9b 1QVFY 1YITZ 2ZAEB 3G71Z 4RVFA 3CC71 1PFTA 1ZB8A 2WAQA 2HU9A 5T6BA 1YIJZ 2JA8I 4NBCA 3CMEZ 2RBLA 3GTGI 3NH8A 2OOXB 1WIIA 3MZLB 5IT9f 3J81b 4BBSI 2RIQA 2QA41 2V8JA 1LQLA 3P5JB 3I56Z 1RNIA 3FQQA 1NJI1 1Q811 3I4NI 3GTPI 3CC21 1Z02A 4MH4A 3K7AI 4E2WA 3J7A4 5LL6f 3HOVI 1Z01A 1DL6A 1YJW1 3CCR1 3BG1B 1WW9A 4NB9A 1QVGY 2KI7B 2QA4Z 4MONA 4CL1A 4Y7NI 1KQSZ 3ESWA 1K9M1 3CPWZ 1N8R2 1VQ7Z 2OZKA 4A3BI 1KD12 3CXCY 1JJ2Z 1QVFZ 2LIYA 3VTNA 1KC81 3GTLI 3TDHB 3GTJI 2O53A 1YJWZ 3CCRZ 4XX2A 3Q87A 3JAMf 1YUKA 5AN9F 3IFUA 3VB9A 1N2FA 3S1RI 1JWHC 4A3MI 1Y1VI 3TE5B 5IP9I 2WB1A 3CCQZ 1KRLA 2GTIA 1VQPZ 3NH4A 3EEDA 3CCJ1 2M6NA 1QYPA 3OW2Y 2JA5I 4NBGA 1TWCI 4NBDA 1M901 2B63I 2HF1A 5FLXb 2W04A 4A3EI 3G4S1 3EERA 3S14I 1YIT1 4DGLA 4MRIA 3NFZA 1QVGZ 3I4MI 2JA6I 3D6WA 2JA7I 3CCU1 3BG0B 2Q4ZA 2GU2A 3CME1 4E32A 2JNYA 2RT9A 2NVYI 3CCJZ 1VQN1 4A3CI 3CXCZ 1P9NA 3PO3S 4A3KI 2IZ3A 3J80f 3HOWI 3S2DI 4AYBA 5C44I 2EGTA 3T4NB 2RPRA 3G4SZ 2R7ZI 1VQKZ 2G2KA 3VMIA 4E33A 3M4OI 2PMZA 1TWGI 1I50I 5D1OA 3CCUZ 5D1OB 2NVTI 2GTHA 2F4OA 1VQNZ 3GTKI 1TWFI 2V8IA 5IP7I 2QREB 3GKQA 2JR6A 3VMHA 1USPA 3OW2Z 5T67A 1USPB 2JS4A 3M3YI 3S16I 2AKLA 3MZKB 1VQ71 3CCS1 3CCL1 4NFRA 1RQFA 3J81f 1VQ9Z 2VUMI 3CC4Z 1I3QI 1SFOI 3CCV1 3S1QI 3KIFA 1YJ91 2J6AA 1RO4A 4A3DI 3HKZA 1Z03A 1RLYA 2PK7A 3RZDI 3HOXI 1W2BY 3CCQ1 3CCSZ 3CCLZ 4NB8A 4E31A 1VQP1 3H0GI 3S17I 2W03A 2NVQI 1VQ41 3MONA 4E2ZA 1N8R1 1X3ZA 4MXUA 3CCVZ 1KD11 2QLVB 2IZ4A 2OTLZ 1M1K2 1K83I 2QRCB 1YJ9Z 3NDIA 2P28A 4HGYA 4NBAA 2VUGA 4QTUA 4HGZA 1Q7Y2 4TNUA 3S2HI 4E30A 2Y0SA 1QF8A 4NBFA 1VQ4Z 3PO3I 3G6E1 1VQ51 1Q862 2K3RA 1ML8A 1VQ61 4RV9A 2OTJZ 1VQK1 1K8A2 3I07A 4A3LI 4S1TA 4BY1I 5C4JI 2OOYB 1YI21 3CMAZ 4X6AI 3I551 2QRDB 5FLXf 1TWHI 5A2Qb 1W2BZ 2V8KA 2I3CA 1VQOZ 3G6EZ 3CQZI 4MD8A 1VQ5Z 1Q822 4RS4A 4RVHA 1K732 1VQ6Z 4A3GI 3CCMZ 2RHBA 1VQ91 2E2JI 3GTOI 1YI2Z 2KPIA 1WCMI 2JUBA 3CC41 1S72Z 3I55Z 3KIHA 1RO2A 3F3PC 1YJN1 4NOZA 3VMGA 3CCE1 1X3WA 2F4MA 2QEX1 4RVGA 4NBHA 5FLMI 5D1PA 3S1NI 2YADA 2H85A 3GTMS 2PM9A 3HOYI 3LUSA 4HH4A 4DQYB 1YHQ1 1NJI2 1YJNZ 1L1OC 1Y1WI 1Q812 1ZB9A 2OTL1 3HOZI 3CCEZ 2QEXZ 2DE5A 2DE7A 2E9HA 3H3VJ 2NVXI 3GCFA 5T64A 1X0TA 1VQ81 3CC7Z 4QTTA 2E2II 2P3YA 4NBEA 3IF8A 3GTQI 5CM2M 3NDJA 4DK1A 4BY7I 1K9M2 3HOUI 3PO2I 3FKII 1YHQZ 1VQM1 5C4XI 3NH5A 1RO0A 2JMOA 2OTJ1 1KC82 2BJOA 3QWUA 3JAMb 2QKDA 2R6MA 1VQ8Z 3CD61 3CMA1 2R93I 3FQMA 1M1K1 3F3FC 3CC2Z 3D9XA 4RVDA 1VLAA 1ZH1A 4NH1C 4A3II 1VQO1 3S1MI 1VQMZ 4E2YA 1Q7Y1 2R92I 1VQL1 2QR1B 2E2HI 1NUIA 1M902 4MD7A 2Q51A 3CCM1 1Q861 3CD6Z 4A93I 2LFUA 2YU9I 1S721 4EWCA 1TWAI 1K8A1 2M48A 3RZOI 2DE6A 1I6HI 1VQLZ 3G711 4A3FI 4Y52I 4NBBA 3U50C 3GTMI 3J80b 2K5RA 3IX0A 1YIJ1 5A2Qf 1S7MA 4BBRI 1Y1VS 1YUAA 4A3JI 1Q821 1K731 1KQSY 5C3EI 1TFIA 1R9TI 3S15I 4BXXI 1NP6A 2VF1A 3CPWY 3I561 2O4HA 4MD9A 4E2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K83 I;  2DE5 A;  2DE7 A;  3EER A;  3H3V J;  3S14 I;  2NVX I;  3GCF A;  1PFT A;  1ZB8 A;  4QTT A;  3I4M I;  4NBA A;  2P3Y A;  4NBE A;  2E2I I;  2JA6 I;  3D6W A;  4QTU A;  2JA7 I;  2JA8 I;  4NBC A;  3GTQ I;  5CM2 M;  3S2H I;  4BY7 I;  2RBL A;  2JNY A;  3GTG I;  2NVY I;  3HOU I;  3PO2 I;  3FKI I;  4NBF A;  4A3C I;  3PO3 I;  4BBS I;  5C4X I;  3PO3 S;  4A3K I;  1LQL A;  3HOW I;  3S2D I;  1ML8 A;  5C44 I;  2R7Z I;  2BJO A;  3I07 A;  4A3L I;  3VMI A;  4BY1 I;  5C4J I;  3M4O I;  1TWG I;  2R93 I;  1I50 I;  4X6A I;  3I4N I;  3GTP I;  4MH4 A;  3K7A I;  1TWH I;  1VLA A;  2NVT I;  3HOV I;  1DL6 A;  2F4O A;  4A3I I;  1WW9 A;  4NB9 A;  3S1M I;  3GTK I;  1TWF I;  5IP7 I;  3CQZ I;  3GKQ A;  2R92 I;  2JR6 A;  3VMH A;  1USP A;  4Y7N I;  3ESW A;  1USP B;  2JS4 A;  2E2H I;  3M3Y I;  4A3G I;  3S16 I;  2AKL A;  1NUI A;  4A3B I;  4A93 I;  2E2J I;  2YU9 I;  3GTO I;  2VUM I;  2KPI A;  1WCM I;  1I3Q I;  1TWA I;  1SFO I;  3GTL I;  3RZO I;  3S1Q I;  3GTJ I;  2DE6 A;  4NOZ A;  3VMG A;  4XX2 A;  3Q87 A;  1I6H I;  1X3W A;  2F4M A;  4NBH A;  2J6A A;  4A3F I;  4Y52 I;  5FLM I;  4NBB A;  1RO4 A;  3U50 C;  3GTM I;  3VB9 A;  2K5R A;  3S1N I;  4A3D I;  1N2F A;  3GTM S;  1RLY A;  3S1R I;  1Y1V I;  2PK7 A;  3HOX I;  5IP9 I;  4A3M I;  3RZD I;  4BBR I;  1Y1V S;  4NB8 A;  3H0G I;  1YUA A;  4A3J I;  3HOY I;  3S17 I;  3LUS A;  2NVQ I;  1QYP A;  2JA5 I;  5C3E I;  1TFI A;  1X3Z A;  1R9T I;  3S15 I;  4BXX I;  4NBG A;  1TWC I;  1L1O C;  4NBD A;  2B63 I;  2HF1 A;  1Y1W I;  1ZB9 A;  4A3E I;  3HOZ I; 
#chains in the Genus database with same CATH topology
 1JJ2 Y;  5IT9 b;  1QVF Y;  1YIT Z;  1QXF A;  2ZAE B;  3G71 Z;  4RVF A;  3CC7 1;  1PFT A;  1ZB8 A;  2WAQ A;  2HU9 A;  5T6B A;  1YIJ Z;  2JA8 I;  4NBC A;  3CME Z;  2RBL A;  3GTG I;  3NH8 A;  2OOX B;  1WII A;  3MZL B;  5IT9 f;  3J81 b;  4BBS I;  2RIQ A;  2QA4 1;  2JIO A;  2V8J A;  1LQL A;  3P5J B;  3I56 Z;  2V3V A;  1RNI A;  3FQQ A;  1NJI 1;  1Q81 1;  3I4N I;  3GTP I;  3CC2 1;  1Z02 A;  4MH4 A;  3K7A I;  4E2W A;  3J7A 4;  5LL6 f;  3HOV I;  1Z01 A;  1DL6 A;  1YJW 1;  1FDO A;  3CCR 1;  3BG1 B;  1WW9 A;  4NB9 A;  1QVG Y;  2KI7 B;  2QA4 Z;  4MON A;  4CL1 A;  4Y7N I;  1KQS Z;  3ESW A;  1K9M 1;  3CPW Z;  1N8R 2;  1VQ7 Z;  2OZK A;  4A3B I;  1KD1 2;  3CXC Y;  1JJ2 Z;  1QVF Z;  2LIY A;  3VTN A;  1KC8 1;  3GTL I;  3TDH B;  3GTJ I;  2O53 A;  1YJW Z;  3CCR Z;  4XX2 A;  3Q87 A;  3JAM f;  1YUK A;  5AN9 F;  3IFU A;  3VB9 A;  1N2F A;  3S1R I;  1JWH C;  1Y1V I;  3TE5 B;  5IP9 I;  4A3M I;  2WB1 A;  3CCQ Z;  1KRL A;  2GTI A;  1VQP Z;  3NH4 A;  3EED A;  2VPZ A;  3CCJ 1;  2M6N A;  1QYP A;  3OW2 Y;  2JA5 I;  4NBG A;  1TWC I;  4NBD A;  1M90 1;  2B63 I;  2HF1 A;  5FLX b;  2W04 A;  4A3E I;  3G4S 1;  3EER A;  3S14 I;  1YIT 1;  4DGL A;  4MRI A;  3NFZ A;  1QVG Z;  3I4M I;  2JA6 I;  3D6W A;  2JA7 I;  3CCU 1;  3BG0 B;  2Q4Z A;  2GU2 A;  3CME 1;  4E32 A;  2JNY A;  2RT9 A;  2NVY I;  3CCJ Z;  1VQN 1;  4A3C I;  3D2L A;  3CXC Z;  1P9N A;  3PO3 S;  4A3K I;  2IZ3 A;  3J80 f;  3HOW I;  3S2D I;  4AYB A;  5C44 I;  2EGT A;  3T4N B;  2E7Z A;  2RPR A;  3G4S Z;  1Y8C A;  2R7Z I;  1VQK Z;  2G2K A;  2IV2 X;  3VMI A;  4E33 A;  3M4O I;  2PMZ A;  1TWG I;  1I50 I;  5D1O A;  3CCU Z;  1Q16 A;  5D1O B;  2NVT I;  2GTH A;  2F4O A;  1VQN Z;  3GTK I;  1TWF I;  2V8I A;  5IP7 I;  2QRE B;  3GKQ A;  2JR6 A;  3VMH A;  1USP A;  3OW2 Z;  5T67 A;  1USP B;  2JS4 A;  2LEX A;  3M3Y I;  3S16 I;  2AKL A;  3MZK B;  1VQ7 1;  3CCS 1;  3CCL 1;  4NFR A;  1RQF A;  3J81 f;  1VQ9 Z;  2VUM I;  3CC4 Z;  1I3Q I;  2VPY A;  1SFO I;  3CCV 1;  3S1Q I;  2V45 A;  3KIF A;  1YJ9 1;  2J6A A;  1RO4 A;  4A3D I;  3HKZ A;  1Z03 A;  1RLY A;  2PK7 A;  3HOX I;  3RZD I;  1W2B Y;  3CCQ 1;  3CCS Z;  3CCL Z;  4NB8 A;  4E31 A;  1VQP 1;  3H0G I;  3S17 I;  2W03 A;  2NVQ I;  1VQ4 1;  3MON A;  4E2Z A;  1N8R 1;  1X3Z A;  4MXU A;  3CCV Z;  1KD1 1;  2QLV B;  2IZ4 A;  2OTL Z;  1M1K 2;  1K83 I;  2QRC B;  1YJ9 Z;  3NDI A;  2P28 A;  4HGY A;  4NBA A;  1WJ2 A;  2VUG A;  4QTU A;  4HGZ A;  1Q7Y 2;  4TNU A;  3S2H I;  4E30 A;  2Y0S A;  1QF8 A;  4NBF A;  1VQ4 Z;  3PO3 I;  3G6E 1;  1VQ5 1;  1Q86 2;  2K3R A;  1ML8 A;  1VQ6 1;  4RV9 A;  2OTJ Z;  1VQK 1;  1K8A 2;  3I07 A;  4A3L I;  4S1T A;  4BY1 I;  5C4J I;  2OOY B;  1YI2 1;  3CMA Z;  4X6A I;  3I55 1;  2QRD B;  5FLX f;  1TWH I;  2JIM A;  5A2Q b;  1W2B Z;  2V8K A;  2VPW A;  2I3C A;  1VQO Z;  3G6E Z;  3CQZ I;  4MD8 A;  1VQ5 Z;  1Q82 2;  4RS4 A;  4RVH A;  1K73 2;  1VQ6 Z;  4A3G I;  3CCM Z;  2RHB A;  1VQ9 1;  2E2J I;  3GTO I;  1YI2 Z;  2KPI A;  1WCM I;  2JUB A;  3CC4 1;  1S72 Z;  3I55 Z;  3KIH A;  2NAP A;  1RO2 A;  3F3P C;  1YJN 1;  4NOZ A;  3VMG A;  3CCE 1;  1X3W A;  2F4M A;  2QEX 1;  4RVG A;  4NBH A;  5FLM I;  5D1P A;  3S1N I;  2YAD A;  2H85 A;  3GTM S;  2PM9 A;  3HOY I;  1WZN A;  3LUS A;  4HH4 A;  4DQY B;  1YHQ 1;  1NJI 2;  1YJN Z;  1L1O C;  1Y1W I;  1Q81 2;  1ZB9 A;  2OTL 1;  3HOZ I;  3CCE Z;  2QEX Z;  2DE5 A;  2DE7 A;  2E9H A;  2JIR A;  3H3V J;  2NVX I;  3GCF A;  5T64 A;  1X0T A;  1VQ8 1;  3CC7 Z;  4QTT A;  2E2I I;  2P3Y A;  4NBE A;  3IF8 A;  3GTQ I;  5CM2 M;  3NDJ A;  4DK1 A;  4BY7 I;  1K9M 2;  3HOU I;  3PO2 I;  3FKI I;  1YHQ Z;  1VQM 1;  2VPX A;  5C4X I;  3NH5 A;  1RO0 A;  2JMO A;  2OTJ 1;  1KC8 2;  2BJO A;  3QWU A;  1FDI A;  3JAM b;  2QKD A;  2R6M A;  1VQ8 Z;  3CD6 1;  3CMA 1;  2R93 I;  3FQM A;  1AA6 A;  1M1K 1;  3F3F C;  3CC2 Z;  2AYD A;  3D9X A;  4RVD A;  1VLA A;  2JIP A;  1ZH1 A;  4NH1 C;  4A3I I;  1VQO 1;  3S1M I;  1VQM Z;  4E2Y A;  1Q7Y 1;  2R92 I;  1VQL 1;  2QR1 B;  1SIW A;  2E2H I;  1NUI A;  1M90 2;  4MD7 A;  2Q51 A;  3CCM 1;  1Q86 1;  3CD6 Z;  4A93 I;  2LFU A;  2YU9 I;  1S72 1;  4EWC A;  1TWA I;  1K8A 1;  2M48 A;  3RZO I;  2DE6 A;  1I6H I;  2JIQ A;  1VQL Z;  3G71 1;  4A3F I;  4Y52 I;  4NBB A;  3U50 C;  3GTM I;  3J80 b;  2K5R A;  3IX0 A;  1YIJ 1;  5A2Q f;  1S7M A;  4BBR I;  1Y1V S;  1YUA A;  4A3J I;  1Q82 1;  1K73 1;  1KQS Y;  3IR7 A;  5C3E I;  1TFI A;  1R9T I;  3S15 I;  4BXX I;  1NP6 A;  2VF1 A;  3CPW Y;  3I56 1;  2O4H A;  4MD9 A;  4E2X A; 
#chains in the Genus database with same CATH homology
 1JJ2 Y;  5IT9 b;  1QVF Y;  1YIT Z;  2ZAE B;  3G71 Z;  4RVF A;  3CC7 1;  1PFT A;  1ZB8 A;  2WAQ A;  2HU9 A;  5T6B A;  1YIJ Z;  2JA8 I;  4NBC A;  3CME Z;  2RBL A;  3GTG I;  3NH8 A;  2OOX B;  1WII A;  3MZL B;  5IT9 f;  3J81 b;  4BBS I;  2RIQ A;  2QA4 1;  2V8J A;  1LQL A;  3P5J B;  3I56 Z;  1RNI A;  3FQQ A;  1NJI 1;  1Q81 1;  3I4N I;  3GTP I;  3CC2 1;  1Z02 A;  4MH4 A;  3K7A I;  4E2W A;  3J7A 4;  5LL6 f;  3HOV I;  1Z01 A;  1DL6 A;  1YJW 1;  3CCR 1;  3BG1 B;  1WW9 A;  4NB9 A;  1QVG Y;  2KI7 B;  2QA4 Z;  4MON A;  4CL1 A;  4Y7N I;  1KQS Z;  3ESW A;  1K9M 1;  3CPW Z;  1N8R 2;  1VQ7 Z;  2OZK A;  4A3B I;  1KD1 2;  3CXC Y;  1JJ2 Z;  1QVF Z;  2LIY A;  3VTN A;  1KC8 1;  3GTL I;  3TDH B;  3GTJ I;  2O53 A;  1YJW Z;  3CCR Z;  4XX2 A;  3Q87 A;  3JAM f;  1YUK A;  5AN9 F;  3IFU A;  3VB9 A;  1N2F A;  3S1R I;  1JWH C;  4A3M I;  1Y1V I;  3TE5 B;  5IP9 I;  2WB1 A;  3CCQ Z;  1KRL A;  2GTI A;  1VQP Z;  3NH4 A;  3EED A;  3CCJ 1;  2M6N A;  1QYP A;  3OW2 Y;  2JA5 I;  4NBG A;  1TWC I;  4NBD A;  1M90 1;  2B63 I;  2HF1 A;  5FLX b;  2W04 A;  4A3E I;  3G4S 1;  3EER A;  3S14 I;  1YIT 1;  4DGL A;  4MRI A;  3NFZ A;  1QVG Z;  3I4M I;  2JA6 I;  3D6W A;  2JA7 I;  3CCU 1;  3BG0 B;  2Q4Z A;  2GU2 A;  3CME 1;  4E32 A;  2JNY A;  2RT9 A;  2NVY I;  3CCJ Z;  1VQN 1;  4A3C I;  3CXC Z;  1P9N A;  3PO3 S;  4A3K I;  2IZ3 A;  3J80 f;  3HOW I;  3S2D I;  4AYB A;  5C44 I;  2EGT A;  3T4N B;  2RPR A;  3G4S Z;  2R7Z I;  1VQK Z;  2G2K A;  3VMI A;  4E33 A;  3M4O I;  2PMZ A;  1TWG I;  1I50 I;  5D1O A;  3CCU Z;  5D1O B;  2NVT I;  2GTH A;  2F4O A;  1VQN Z;  3GTK I;  1TWF I;  2V8I A;  5IP7 I;  2QRE B;  3GKQ A;  2JR6 A;  3VMH A;  1USP A;  3OW2 Z;  5T67 A;  1USP B;  2JS4 A;  3M3Y I;  3S16 I;  2AKL A;  3MZK B;  1VQ7 1;  3CCS 1;  3CCL 1;  4NFR A;  1RQF A;  3J81 f;  1VQ9 Z;  2VUM I;  3CC4 Z;  1I3Q I;  1SFO I;  3CCV 1;  3S1Q I;  3KIF A;  1YJ9 1;  2J6A A;  1RO4 A;  4A3D I;  3HKZ A;  1Z03 A;  1RLY A;  2PK7 A;  3RZD I;  3HOX I;  1W2B Y;  3CCQ 1;  3CCS Z;  3CCL Z;  4NB8 A;  4E31 A;  1VQP 1;  3H0G I;  3S17 I;  2W03 A;  2NVQ I;  1VQ4 1;  3MON A;  4E2Z A;  1N8R 1;  1X3Z A;  4MXU A;  3CCV Z;  1KD1 1;  2QLV B;  2IZ4 A;  2OTL Z;  1M1K 2;  1K83 I;  2QRC B;  1YJ9 Z;  3NDI A;  2P28 A;  4HGY A;  4NBA A;  2VUG A;  4QTU A;  4HGZ A;  1Q7Y 2;  4TNU A;  3S2H I;  4E30 A;  2Y0S A;  1QF8 A;  4NBF A;  1VQ4 Z;  3PO3 I;  3G6E 1;  1VQ5 1;  1Q86 2;  2K3R A;  1ML8 A;  1VQ6 1;  4RV9 A;  2OTJ Z;  1VQK 1;  1K8A 2;  3I07 A;  4A3L I;  4S1T A;  4BY1 I;  5C4J I;  2OOY B;  1YI2 1;  3CMA Z;  4X6A I;  3I55 1;  2QRD B;  5FLX f;  1TWH I;  5A2Q b;  1W2B Z;  2V8K A;  2I3C A;  1VQO Z;  3G6E Z;  3CQZ I;  4MD8 A;  1VQ5 Z;  1Q82 2;  4RS4 A;  4RVH A;  1K73 2;  1VQ6 Z;  4A3G I;  3CCM Z;  2RHB A;  1VQ9 1;  2E2J I;  3GTO I;  1YI2 Z;  2KPI A;  1WCM I;  2JUB A;  3CC4 1;  1S72 Z;  3I55 Z;  3KIH A;  1RO2 A;  3F3P C;  1YJN 1;  4NOZ A;  3VMG A;  3CCE 1;  1X3W A;  2F4M A;  2QEX 1;  4RVG A;  4NBH A;  5FLM I;  5D1P A;  3S1N I;  2YAD A;  2H85 A;  3GTM S;  2PM9 A;  3HOY I;  3LUS A;  4HH4 A;  4DQY B;  1YHQ 1;  1NJI 2;  1YJN Z;  1L1O C;  1Y1W I;  1Q81 2;  1ZB9 A;  2OTL 1;  3HOZ I;  3CCE Z;  2QEX Z;  2DE5 A;  2DE7 A;  2E9H A;  3H3V J;  2NVX I;  3GCF A;  5T64 A;  1X0T A;  1VQ8 1;  3CC7 Z;  4QTT A;  2E2I I;  2P3Y A;  4NBE A;  3IF8 A;  3GTQ I;  5CM2 M;  3NDJ A;  4DK1 A;  4BY7 I;  1K9M 2;  3HOU I;  3PO2 I;  3FKI I;  1YHQ Z;  1VQM 1;  5C4X I;  3NH5 A;  1RO0 A;  2JMO A;  2OTJ 1;  1KC8 2;  2BJO A;  3QWU A;  3JAM b;  2QKD A;  2R6M A;  1VQ8 Z;  3CD6 1;  3CMA 1;  2R93 I;  3FQM A;  1M1K 1;  3F3F C;  3CC2 Z;  3D9X A;  4RVD A;  1VLA A;  1ZH1 A;  4NH1 C;  4A3I I;  1VQO 1;  3S1M I;  1VQM Z;  4E2Y A;  1Q7Y 1;  2R92 I;  1VQL 1;  2QR1 B;  2E2H I;  1NUI A;  1M90 2;  4MD7 A;  2Q51 A;  3CCM 1;  1Q86 1;  3CD6 Z;  4A93 I;  2LFU A;  2YU9 I;  1S72 1;  4EWC A;  1TWA I;  1K8A 1;  2M48 A;  3RZO I;  2DE6 A;  1I6H I;  1VQL Z;  3G71 1;  4A3F I;  4Y52 I;  4NBB A;  3U50 C;  3GTM I;  3J80 b;  2K5R A;  3IX0 A;  1YIJ 1;  5A2Q f;  1S7M A;  4BBR I;  1Y1V S;  1YUA A;  4A3J I;  1Q82 1;  1K73 1;  1KQS Y;  5C3E I;  1TFI A;  1R9T I;  3S15 I;  4BXX I;  1NP6 A;  2VF1 A;  3CPW Y;  3I56 1;  2O4H A;  4MD9 A;  4E2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...