4BY7I

Elongating rna polymerase ii-bye1 tld complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA polymerase II complexes with Bye1, a chromatin-binding PHF3/DIDO homologue.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4by7I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4by7I02
1RO4A 2R7ZI 3M3YI 4BY7I 5IP9I 2AKLA 3FKII 3LUSA 2JR6A 3HOXI 5C44I 2JA8I 4NBAA 4A3MI 2KPIA 2NVTI 4Y7NI 4QTUA 4NBCA 3H3VJ 5CM2M 2E2JI 2JA7I 3VB9A 4NBGA 3PO3S 1TWCI 2BJOA 1L1OC 1SFOI 4BY1I 3S17I 1TWGI 2RBLA 4A3CI 3GCFA 3GTLI 3S15I 3S1MI 2J6AA 1X3ZA 3GTMS 2F4OA 4A3FI 2PK7A 1ZB8A 1DL6A 2DE7A 5IP7I 4A3KI 1WW9A 4A3DI 4A3LI 1I3QI 4NBHA 4X6AI 3S2HI 1USPA 3VMHA 2NVQI 3RZDI 2K5RA 2F4MA 1TWAI 3K7AI 3GKQA 2JA6I 3Q87A 4A3BI 4NBEA 3HOUI 3I4MI 3PO3I 2DE6A 3HOWI 1Y1VI 1TFIA 3M4OI 1ML8A 3S1RI 4NB9A 1TWHI 1Y1WI 3CQZI 3I07A 1PFTA 4A3JI 4NBFA 1K83I 3HOYI 1LQLA 3EERA 4A3GI 3S14I 3S1QI 2JA5I 4A93I 5FLMI 3S2DI 1I6HI 3PO2I 3GTOI 2JS4A 4BXXI 3S1NI 3HOZI 1X3WA 3VMIA 3D6WA 4XX2A 1RLYA 3S16I 1NUIA 2NVYI 3H0GI 2R92I 2JNYA 4MH4A 1WCMI 4QTTA 1I50I 5C4JI 3GTJI 2R93I 1ZB9A 3RZOI 4A3EI 2HF1A 1YUAA 4NBBA 3ESWA 4NBDA 3GTPI 3GTQI 2P3YA 2DE5A 4A3II 4BBRI 3GTMI 3VMGA 5C3EI 1TWFI 2E2HI 3HOVI 1QYPA 2E2II 3U50C 3GTKI 2VUMI 5C4XI 2NVXI 1VLAA 1USPB 4NB8A 2YU9I 1R9TI 3I4NI 1N2FA 4NOZA 3GTGI 2B63I 4Y52I 4BBSI 1Y1VS
chains in the Genus database with same CATH superfamily
2E7ZA 1RQFA 2AKLA 2IZ3A 1YJN1 2JR6A 3CD61 5C44I 2JA8I 2NVTI 5D1OA 4Y7NI 3H3VJ 1RO2A 3J81f 1KRLA 2M48A 2Q51A 2RPRA 1VQ41 4E2XA 2NAPA 3PO3S 4RS4A 1VQ91 3CCQ1 1FDOA 1YJWZ 1QVGY 2RBLA 4A3CI 3GTLI 3CCSZ 1VQ6Z 3S1MI 4E33A 2JIRA 4MD9A 2DE7A 2OZKA 4A3KI 1QVFY 1RNIA 1I3QI 4NBHA 1USPA 3VMHA 2F4MA 3K7AI 1NJI2 2QRCB 3I4MI 1NJI1 3PO3I 3I56Z 1TFIA 3CME1 2E9HA 2I3CA 3IX0A 4NB9A 4NFRA 2VUGA 1YJNZ 2RIQA 3EERA 4E2ZA 5D1PA 3NH5A 3S1QI 5FLMI 4MRIA 1W2BZ 1Q812 1Q862 3GTOI 3J80f 3CCM1 2VF1A 3CC71 1VQ4Z 5A2Qb 3S1NI 2R6MA 4RVHA 2OTL1 1VQ9Z 3MONA 3D6WA 3CCQZ 2KI7B 2VPYA 3D2LA 3D9XA 4MH4A 5C4JI 3KIFA 2V8IA 2K3RA 3IR7A 1VQP1 2HF1A 2V8KA 1S721 1WJ2A 2LIYA 3HOVI 2LEXA 1JWHC 2E2II 2VUMI 1AA6A 1VLAA 2YU9I 1YITZ 1R9TI 1N2FA 3GTGI 2JUBA 1VQ51 3NH8A 1KD11 2R7ZI 4DQYB 1YJW1 2IV2X 1QVGZ 1VQ61 5IP9I 2GU2A 3NDIA 4E31A 3CCV1 4NBAA 3I55Z 2JIQA 4QTUA 4NBCA 1YIJ1 5FLXb 1QVFZ 3CCMZ 3CC7Z 3CCR1 1YHQZ 2HU9A 1L1OC 4NH1C 4BY1I 3S17I 2GTHA 3GCFA 3I561 1K731 2QA4Z 2AYDA 2JIOA 1VQPZ 1S72Z 4A3FI 2PK7A 1ZB8A 1VQM1 3J7A4 3G71Z 3FQQA 1Z03A 4A3LI 2GTIA 1QXFA 2V45A 4X6AI 2OOXB 3S2HI 1VQ5Z 1TWAI 1YJ91 3Q87A 4E2YA 1KQSY 1Y1VI 1VQ81 4CL1A 4RVDA 3CQZI 4NBFA 3JAMf 3CCVZ 1LQLA 3S14I 1RO0A 3CC4Z 2OOYB 3TE5B 3PO2I 3OW2Y 1YIJZ 3CMA1 1YIT1 3CCRZ 3HOZI 4E30A 2V3VA 3S16I 2NVYI 3H0GI 1M901 1ZB9A 3RZOI 3ESWA 4NBBA 4NBDA 2DE5A 1VQMZ 1JJ2Z 2EGTA 2QR1B 1VQK1 3VMGA 5C3EI 3GTKI 3KIHA 5C4XI 1Y8CA 3I551 1N8R2 1VQN1 1N8R1 2B63I 3HKZA 4Y52I 1YJ9Z 1YHQ1 3QWUA 4EWCA 4BY7I 2WAQA 3MZKB 2O53A 4RV9A 4HH4A 1VQ8Z 3J80b 3CCE1 2QA41 1YI21 3LUSA 1SIWA 3CMAZ 3G711 2JMOA 1S7MA 5CM2M 3NH4A 1ZH1A 3VB9A 4NBGA 3CPWY 1KD12 2IZ4A 4RVFA 1SFOI 5T67A 2JIPA 3S15I 3G4S1 2WB1A 1M1K2 1Z02A 2Q4ZA 3GTMS 1KQSZ 4DGLA 1M1K1 4DK1A 1VQKZ 2QEX1 5IP7I 2H85A 1KC81 3CC41 1VQNZ 5IT9f 3BG0B 3OW2Z 3RZDI 1WIIA 1VQ71 2DE6A 1K732 1Q16A 3CCEZ 3HOWI 3CXCY 3IF8A 3M4OI 1ML8A 3S1RI 2QLVB 1YI2Z 3I07A 1PFTA 2JIMA 1K83I 3HOYI 4AYBA 4E32A 1Q822 4A93I 5T64A 1Q821 2JS4A 1K8A2 4TNUA 3CCU1 4HGZA 1NP6A 2YADA 1K8A1 2RT9A 3VTNA 1RLYA 2PMZA 2R92I 3G4SZ 4QTTA 1QF8A 3F3FC 3GTJI 5AN9F 2R93I 3J81b 1VQLZ 1YUAA 4E2WA 3GTPI 3GTQI 2P3YA 2QEXZ 4A3II 4BBRI 1TWFI 1QYPA 3U50C 2NVXI 4NB8A 2PM9A 2P28A 3I4NI 4MONA 3CCJ1 3JAMb 1VQ7Z 1RO4A 4MD8A 3CPWZ 1M902 3M3YI 2W04A 3NFZA 2OTJ1 3FKII 1X0TA 3HOXI 4A3MI 2KPIA 5LL6f 2Y0SA 3CCUZ 2E2JI 2JA7I 4S1TA 1TWCI 2BJOA 3IFUA 1VQO1 3F3PC 3T4NB 1TWGI 4HGYA 3CCL1 2J6AA 1X3ZA 1K9M2 3CXCZ 2F4OA 1DL6A 3CD6Z 5A2Qf 2QRDB 2W03A 1K9M1 3TDHB 3MZLB 2VPZA 1WW9A 4A3DI 2VPWA 3CC21 1Q811 3G6E1 2G2KA 3CCJZ 1Q861 2NVQI 2K5RA 2LFUA 5T6BA 1P9NA 3GKQA 3P5JB 2JA6I 1WZNA 4A3BI 2ZAEB 4NBEA 3HOUI 1YUKA 2VPXA 4RVGA 2QREB 2RHBA 2OTJZ 4MXUA 2V8JA 1TWHI 1Y1WI 1VQL1 4A3JI 2O4HA 2M6NA 4A3GI 5D1OB 1KC82 2JA5I 3S2DI 1I6HI 1Q7Y2 4BXXI 3NDJA 1Q7Y1 1X3WA 1VQOZ 3VMIA 1Z01A 4XX2A 3BG1B 5IT9b 3FQMA 1NUIA 4MD7A 3CCLZ 2JNYA 3CMEZ 1WCMI 1I50I 3CCS1 1JJ2Y 5FLXf 4A3EI 1W2BY 3GTMI 2E2HI 3EEDA 3CC2Z 1USPB 3G6EZ 4NOZA 1FDIA 2OTLZ 2QKDA 4BBSI 1Y1VS
chains in the Genus database with same CATH topology
1RQFA 2AKLA 2IZ3A 1YJN1 2JR6A 3CD61 5C44I 2JA8I 2NVTI 5D1OA 4Y7NI 3H3VJ 1RO2A 3J81f 1KRLA 2M48A 2Q51A 2RPRA 1VQ41 4E2XA 3PO3S 4RS4A 1VQ91 3CCQ1 1YJWZ 1QVGY 2RBLA 4A3CI 3GTLI 3CCSZ 1VQ6Z 3S1MI 4E33A 4MD9A 2DE7A 2OZKA 4A3KI 1QVFY 1RNIA 1I3QI 4NBHA 1USPA 3VMHA 2F4MA 3K7AI 1NJI2 2QRCB 3I4MI 1NJI1 3PO3I 3I56Z 1TFIA 3CME1 2E9HA 2I3CA 3IX0A 4NB9A 4NFRA 2VUGA 1YJNZ 2RIQA 3EERA 4E2ZA 5D1PA 3NH5A 3S1QI 5FLMI 4MRIA 1W2BZ 1Q812 1Q862 3GTOI 3J80f 3CCM1 2VF1A 3CC71 1VQ4Z 5A2Qb 3S1NI 2R6MA 4RVHA 2OTL1 1VQ9Z 3MONA 3D6WA 3CCQZ 2KI7B 3D9XA 4MH4A 5C4JI 3KIFA 2V8IA 2K3RA 1VQP1 2HF1A 2V8KA 1S721 2LIYA 3HOVI 1JWHC 2E2II 2VUMI 1VLAA 2YU9I 1YITZ 1R9TI 1N2FA 3GTGI 2JUBA 1VQ51 3NH8A 1KD11 2R7ZI 4DQYB 1YJW1 1QVGZ 1VQ61 5IP9I 2GU2A 3NDIA 4E31A 3CCV1 4NBAA 3I55Z 4QTUA 4NBCA 1YIJ1 5FLXb 1QVFZ 3CCMZ 3CC7Z 3CCR1 1YHQZ 2HU9A 1L1OC 4NH1C 4BY1I 3S17I 2GTHA 3GCFA 3I561 1K731 2QA4Z 1VQPZ 1S72Z 4A3FI 2PK7A 1ZB8A 1VQM1 3J7A4 3G71Z 3FQQA 1Z03A 4A3LI 2GTIA 4X6AI 2OOXB 3S2HI 1VQ5Z 1TWAI 1YJ91 3Q87A 4E2YA 1KQSY 1Y1VI 1VQ81 4CL1A 4RVDA 3CQZI 4NBFA 3JAMf 3CCVZ 1LQLA 3S14I 1RO0A 3CC4Z 2OOYB 3TE5B 3PO2I 3OW2Y 1YIJZ 3CMA1 1YIT1 3CCRZ 3HOZI 4E30A 3S16I 2NVYI 3H0GI 1M901 1ZB9A 3RZOI 3ESWA 4NBBA 4NBDA 2DE5A 1VQMZ 1JJ2Z 2EGTA 2QR1B 1VQK1 3VMGA 5C3EI 3GTKI 3KIHA 5C4XI 3I551 1N8R2 1VQN1 1N8R1 2B63I 3HKZA 4Y52I 1YJ9Z 1YHQ1 3QWUA 4EWCA 4BY7I 2WAQA 3MZKB 2O53A 4RV9A 4HH4A 1VQ8Z 3J80b 3CCE1 2QA41 1YI21 3LUSA 3CMAZ 3G711 2JMOA 1S7MA 5CM2M 3NH4A 1ZH1A 3VB9A 4NBGA 3CPWY 1KD12 2IZ4A 4RVFA 1SFOI 5T67A 3S15I 3G4S1 2WB1A 1M1K2 1Z02A 2Q4ZA 3GTMS 1KQSZ 4DGLA 1M1K1 4DK1A 1VQKZ 2QEX1 5IP7I 2H85A 1KC81 3CC41 1VQNZ 5IT9f 3BG0B 3OW2Z 3RZDI 1WIIA 1VQ71 2DE6A 1K732 3CCEZ 3HOWI 3CXCY 3IF8A 3M4OI 1ML8A 3S1RI 2QLVB 1YI2Z 3I07A 1PFTA 1K83I 3HOYI 4AYBA 4E32A 1Q822 4A93I 5T64A 1Q821 2JS4A 1K8A2 4TNUA 3CCU1 4HGZA 1NP6A 2YADA 1K8A1 2RT9A 3VTNA 1RLYA 2PMZA 2R92I 3G4SZ 4QTTA 1QF8A 3F3FC 3GTJI 5AN9F 2R93I 3J81b 1VQLZ 1YUAA 4E2WA 3GTPI 3GTQI 2P3YA 2QEXZ 4A3II 4BBRI 1TWFI 1QYPA 3U50C 2NVXI 4NB8A 2PM9A 2P28A 3I4NI 4MONA 3CCJ1 3JAMb 1VQ7Z 1RO4A 4MD8A 3CPWZ 1M902 3M3YI 2W04A 3NFZA 2OTJ1 3FKII 1X0TA 3HOXI 4A3MI 2KPIA 5LL6f 2Y0SA 3CCUZ 2E2JI 2JA7I 4S1TA 1TWCI 2BJOA 3IFUA 1VQO1 3F3PC 3T4NB 1TWGI 4HGYA 3CCL1 2J6AA 1X3ZA 1K9M2 3CXCZ 2F4OA 1DL6A 3CD6Z 5A2Qf 2QRDB 2W03A 1K9M1 3TDHB 3MZLB 1WW9A 4A3DI 3CC21 1Q811 3G6E1 2G2KA 3CCJZ 1Q861 2NVQI 2K5RA 2LFUA 5T6BA 1P9NA 3GKQA 3P5JB 2JA6I 4A3BI 2ZAEB 4NBEA 3HOUI 1YUKA 4RVGA 2QREB 2RHBA 2OTJZ 4MXUA 2V8JA 1TWHI 1Y1WI 1VQL1 4A3JI 2O4HA 2M6NA 4A3GI 5D1OB 1KC82 2JA5I 3S2DI 1I6HI 1Q7Y2 4BXXI 3NDJA 1Q7Y1 1X3WA 1VQOZ 3VMIA 1Z01A 4XX2A 3BG1B 5IT9b 3FQMA 1NUIA 4MD7A 3CCLZ 2JNYA 3CMEZ 1WCMI 1I50I 3CCS1 1JJ2Y 5FLXf 4A3EI 1W2BY 3GTMI 2E2HI 3EEDA 3CC2Z 1USPB 3G6EZ 4NOZA 2OTLZ 2QKDA 4BBSI 1Y1VS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RO4 A;  2R7Z I;  3M3Y I;  4BY7 I;  5IP9 I;  2AKL A;  3FKI I;  3LUS A;  2JR6 A;  3HOX I;  5C44 I;  2JA8 I;  4NBA A;  4A3M I;  2KPI A;  2NVT I;  4Y7N I;  4QTU A;  4NBC A;  3H3V J;  5CM2 M;  2E2J I;  2JA7 I;  3VB9 A;  4NBG A;  3PO3 S;  1TWC I;  2BJO A;  1L1O C;  1SFO I;  4BY1 I;  3S17 I;  1TWG I;  2RBL A;  4A3C I;  3GCF A;  3GTL I;  3S15 I;  3S1M I;  2J6A A;  1X3Z A;  3GTM S;  2F4O A;  4A3F I;  2PK7 A;  1ZB8 A;  1DL6 A;  2DE7 A;  5IP7 I;  4A3K I;  1WW9 A;  4A3D I;  4A3L I;  1I3Q I;  4NBH A;  4X6A I;  3S2H I;  1USP A;  3VMH A;  2NVQ I;  3RZD I;  2K5R A;  2F4M A;  1TWA I;  3K7A I;  3GKQ A;  2JA6 I;  3Q87 A;  4A3B I;  4NBE A;  3HOU I;  3I4M I;  3PO3 I;  2DE6 A;  3HOW I;  1Y1V I;  1TFI A;  3M4O I;  1ML8 A;  3S1R I;  4NB9 A;  1TWH I;  1Y1W I;  3CQZ I;  3I07 A;  1PFT A;  4A3J I;  4NBF A;  1K83 I;  3HOY I;  1LQL A;  3EER A;  4A3G I;  3S14 I;  3S1Q I;  2JA5 I;  4A93 I;  5FLM I;  3S2D I;  1I6H I;  3PO2 I;  3GTO I;  2JS4 A;  4BXX I;  3S1N I;  3HOZ I;  1X3W A;  3VMI A;  3D6W A;  4XX2 A;  1RLY A;  3S16 I;  1NUI A;  2NVY I;  3H0G I;  2R92 I;  2JNY A;  4MH4 A;  1WCM I;  4QTT A;  1I50 I;  5C4J I;  3GTJ I;  2R93 I;  1ZB9 A;  3RZO I;  4A3E I;  2HF1 A;  1YUA A;  4NBB A;  3ESW A;  4NBD A;  3GTP I;  3GTQ I;  2P3Y A;  2DE5 A;  4A3I I;  4BBR I;  3GTM I;  3VMG A;  5C3E I;  1TWF I;  2E2H I;  3HOV I;  1QYP A;  2E2I I;  3U50 C;  3GTK I;  2VUM I;  5C4X I;  2NVX I;  1VLA A;  1USP B;  4NB8 A;  2YU9 I;  1R9T I;  3I4N I;  1N2F A;  4NOZ A;  3GTG I;  2B63 I;  4Y52 I;  4BBS I;  1Y1V S; 
#chains in the Genus database with same CATH topology
 2E7Z A;  1RQF A;  2AKL A;  2IZ3 A;  1YJN 1;  2JR6 A;  3CD6 1;  5C44 I;  2JA8 I;  2NVT I;  5D1O A;  4Y7N I;  3H3V J;  1RO2 A;  3J81 f;  1KRL A;  2M48 A;  2Q51 A;  2RPR A;  1VQ4 1;  4E2X A;  2NAP A;  3PO3 S;  4RS4 A;  1VQ9 1;  3CCQ 1;  1FDO A;  1YJW Z;  1QVG Y;  2RBL A;  4A3C I;  3GTL I;  3CCS Z;  1VQ6 Z;  3S1M I;  4E33 A;  2JIR A;  4MD9 A;  2DE7 A;  2OZK A;  4A3K I;  1QVF Y;  1RNI A;  1I3Q I;  4NBH A;  1USP A;  3VMH A;  2F4M A;  3K7A I;  1NJI 2;  2QRC B;  3I4M I;  1NJI 1;  3PO3 I;  3I56 Z;  1TFI A;  3CME 1;  2E9H A;  2I3C A;  3IX0 A;  4NB9 A;  4NFR A;  2VUG A;  1YJN Z;  2RIQ A;  3EER A;  4E2Z A;  5D1P A;  3NH5 A;  3S1Q I;  5FLM I;  4MRI A;  1W2B Z;  1Q81 2;  1Q86 2;  3GTO I;  3J80 f;  3CCM 1;  2VF1 A;  3CC7 1;  1VQ4 Z;  5A2Q b;  3S1N I;  2R6M A;  4RVH A;  2OTL 1;  1VQ9 Z;  3MON A;  3D6W A;  3CCQ Z;  2KI7 B;  2VPY A;  3D2L A;  3D9X A;  4MH4 A;  5C4J I;  3KIF A;  2V8I A;  2K3R A;  3IR7 A;  1VQP 1;  2HF1 A;  2V8K A;  1S72 1;  1WJ2 A;  2LIY A;  3HOV I;  2LEX A;  1JWH C;  2E2I I;  2VUM I;  1AA6 A;  1VLA A;  2YU9 I;  1YIT Z;  1R9T I;  1N2F A;  3GTG I;  2JUB A;  1VQ5 1;  3NH8 A;  1KD1 1;  2R7Z I;  4DQY B;  1YJW 1;  2IV2 X;  1QVG Z;  1VQ6 1;  5IP9 I;  2GU2 A;  3NDI A;  4E31 A;  3CCV 1;  4NBA A;  3I55 Z;  2JIQ A;  4QTU A;  4NBC A;  1YIJ 1;  5FLX b;  1QVF Z;  3CCM Z;  3CC7 Z;  3CCR 1;  1YHQ Z;  2HU9 A;  1L1O C;  4NH1 C;  4BY1 I;  3S17 I;  2GTH A;  3GCF A;  3I56 1;  1K73 1;  2QA4 Z;  2AYD A;  2JIO A;  1VQP Z;  1S72 Z;  4A3F I;  2PK7 A;  1ZB8 A;  1VQM 1;  3J7A 4;  3G71 Z;  3FQQ A;  1Z03 A;  4A3L I;  2GTI A;  1QXF A;  2V45 A;  4X6A I;  2OOX B;  3S2H I;  1VQ5 Z;  1TWA I;  1YJ9 1;  3Q87 A;  4E2Y A;  1KQS Y;  1Y1V I;  1VQ8 1;  4CL1 A;  4RVD A;  3CQZ I;  4NBF A;  3JAM f;  3CCV Z;  1LQL A;  3S14 I;  1RO0 A;  3CC4 Z;  2OOY B;  3TE5 B;  3PO2 I;  3OW2 Y;  1YIJ Z;  3CMA 1;  1YIT 1;  3CCR Z;  3HOZ I;  4E30 A;  2V3V A;  3S16 I;  2NVY I;  3H0G I;  1M90 1;  1ZB9 A;  3RZO I;  3ESW A;  4NBB A;  4NBD A;  2DE5 A;  1VQM Z;  1JJ2 Z;  2EGT A;  2QR1 B;  1VQK 1;  3VMG A;  5C3E I;  3GTK I;  3KIH A;  5C4X I;  1Y8C A;  3I55 1;  1N8R 2;  1VQN 1;  1N8R 1;  2B63 I;  3HKZ A;  4Y52 I;  1YJ9 Z;  1YHQ 1;  3QWU A;  4EWC A;  4BY7 I;  2WAQ A;  3MZK B;  2O53 A;  4RV9 A;  4HH4 A;  1VQ8 Z;  3J80 b;  3CCE 1;  2QA4 1;  1YI2 1;  3LUS A;  1SIW A;  3CMA Z;  3G71 1;  2JMO A;  1S7M A;  5CM2 M;  3NH4 A;  1ZH1 A;  3VB9 A;  4NBG A;  3CPW Y;  1KD1 2;  2IZ4 A;  4RVF A;  1SFO I;  5T67 A;  2JIP A;  3S15 I;  3G4S 1;  2WB1 A;  1M1K 2;  1Z02 A;  2Q4Z A;  3GTM S;  1KQS Z;  4DGL A;  1M1K 1;  4DK1 A;  1VQK Z;  2QEX 1;  5IP7 I;  2H85 A;  1KC8 1;  3CC4 1;  1VQN Z;  5IT9 f;  3BG0 B;  3OW2 Z;  3RZD I;  1WII A;  1VQ7 1;  2DE6 A;  1K73 2;  1Q16 A;  3CCE Z;  3HOW I;  3CXC Y;  3IF8 A;  3M4O I;  1ML8 A;  3S1R I;  2QLV B;  1YI2 Z;  3I07 A;  1PFT A;  2JIM A;  1K83 I;  3HOY I;  4AYB A;  4E32 A;  1Q82 2;  4A93 I;  5T64 A;  1Q82 1;  2JS4 A;  1K8A 2;  4TNU A;  3CCU 1;  4HGZ A;  1NP6 A;  2YAD A;  1K8A 1;  2RT9 A;  3VTN A;  1RLY A;  2PMZ A;  2R92 I;  3G4S Z;  4QTT A;  1QF8 A;  3F3F C;  3GTJ I;  5AN9 F;  2R93 I;  3J81 b;  1VQL Z;  1YUA A;  4E2W A;  3GTP I;  3GTQ I;  2P3Y A;  2QEX Z;  4A3I I;  4BBR I;  1TWF I;  1QYP A;  3U50 C;  2NVX I;  4NB8 A;  2PM9 A;  2P28 A;  3I4N I;  4MON A;  3CCJ 1;  3JAM b;  1VQ7 Z;  1RO4 A;  4MD8 A;  3CPW Z;  1M90 2;  3M3Y I;  2W04 A;  3NFZ A;  2OTJ 1;  3FKI I;  1X0T A;  3HOX I;  4A3M I;  2KPI A;  5LL6 f;  2Y0S A;  3CCU Z;  2E2J I;  2JA7 I;  4S1T A;  1TWC I;  2BJO A;  3IFU A;  1VQO 1;  3F3P C;  3T4N B;  1TWG I;  4HGY A;  3CCL 1;  2J6A A;  1X3Z A;  1K9M 2;  3CXC Z;  2F4O A;  1DL6 A;  3CD6 Z;  5A2Q f;  2QRD B;  2W03 A;  1K9M 1;  3TDH B;  3MZL B;  2VPZ A;  1WW9 A;  4A3D I;  2VPW A;  3CC2 1;  1Q81 1;  3G6E 1;  2G2K A;  3CCJ Z;  1Q86 1;  2NVQ I;  2K5R A;  2LFU A;  5T6B A;  1P9N A;  3GKQ A;  3P5J B;  2JA6 I;  1WZN A;  4A3B I;  2ZAE B;  4NBE A;  3HOU I;  1YUK A;  2VPX A;  4RVG A;  2QRE B;  2RHB A;  2OTJ Z;  4MXU A;  2V8J A;  1TWH I;  1Y1W I;  1VQL 1;  4A3J I;  2O4H A;  2M6N A;  4A3G I;  5D1O B;  1KC8 2;  2JA5 I;  3S2D I;  1I6H I;  1Q7Y 2;  4BXX I;  3NDJ A;  1Q7Y 1;  1X3W A;  1VQO Z;  3VMI A;  1Z01 A;  4XX2 A;  3BG1 B;  5IT9 b;  3FQM A;  1NUI A;  4MD7 A;  3CCL Z;  2JNY A;  3CME Z;  1WCM I;  1I50 I;  3CCS 1;  1JJ2 Y;  5FLX f;  4A3E I;  1W2B Y;  3GTM I;  2E2H I;  3EED A;  3CC2 Z;  1USP B;  3G6E Z;  4NOZ A;  1FDI A;  2OTL Z;  2QKD A;  4BBS I;  1Y1V S; 
#chains in the Genus database with same CATH homology
 1RQF A;  2AKL A;  2IZ3 A;  1YJN 1;  2JR6 A;  3CD6 1;  5C44 I;  2JA8 I;  2NVT I;  5D1O A;  4Y7N I;  3H3V J;  1RO2 A;  3J81 f;  1KRL A;  2M48 A;  2Q51 A;  2RPR A;  1VQ4 1;  4E2X A;  3PO3 S;  4RS4 A;  1VQ9 1;  3CCQ 1;  1YJW Z;  1QVG Y;  2RBL A;  4A3C I;  3GTL I;  3CCS Z;  1VQ6 Z;  3S1M I;  4E33 A;  4MD9 A;  2DE7 A;  2OZK A;  4A3K I;  1QVF Y;  1RNI A;  1I3Q I;  4NBH A;  1USP A;  3VMH A;  2F4M A;  3K7A I;  1NJI 2;  2QRC B;  3I4M I;  1NJI 1;  3PO3 I;  3I56 Z;  1TFI A;  3CME 1;  2E9H A;  2I3C A;  3IX0 A;  4NB9 A;  4NFR A;  2VUG A;  1YJN Z;  2RIQ A;  3EER A;  4E2Z A;  5D1P A;  3NH5 A;  3S1Q I;  5FLM I;  4MRI A;  1W2B Z;  1Q81 2;  1Q86 2;  3GTO I;  3J80 f;  3CCM 1;  2VF1 A;  3CC7 1;  1VQ4 Z;  5A2Q b;  3S1N I;  2R6M A;  4RVH A;  2OTL 1;  1VQ9 Z;  3MON A;  3D6W A;  3CCQ Z;  2KI7 B;  3D9X A;  4MH4 A;  5C4J I;  3KIF A;  2V8I A;  2K3R A;  1VQP 1;  2HF1 A;  2V8K A;  1S72 1;  2LIY A;  3HOV I;  1JWH C;  2E2I I;  2VUM I;  1VLA A;  2YU9 I;  1YIT Z;  1R9T I;  1N2F A;  3GTG I;  2JUB A;  1VQ5 1;  3NH8 A;  1KD1 1;  2R7Z I;  4DQY B;  1YJW 1;  1QVG Z;  1VQ6 1;  5IP9 I;  2GU2 A;  3NDI A;  4E31 A;  3CCV 1;  4NBA A;  3I55 Z;  4QTU A;  4NBC A;  1YIJ 1;  5FLX b;  1QVF Z;  3CCM Z;  3CC7 Z;  3CCR 1;  1YHQ Z;  2HU9 A;  1L1O C;  4NH1 C;  4BY1 I;  3S17 I;  2GTH A;  3GCF A;  3I56 1;  1K73 1;  2QA4 Z;  1VQP Z;  1S72 Z;  4A3F I;  2PK7 A;  1ZB8 A;  1VQM 1;  3J7A 4;  3G71 Z;  3FQQ A;  1Z03 A;  4A3L I;  2GTI A;  4X6A I;  2OOX B;  3S2H I;  1VQ5 Z;  1TWA I;  1YJ9 1;  3Q87 A;  4E2Y A;  1KQS Y;  1Y1V I;  1VQ8 1;  4CL1 A;  4RVD A;  3CQZ I;  4NBF A;  3JAM f;  3CCV Z;  1LQL A;  3S14 I;  1RO0 A;  3CC4 Z;  2OOY B;  3TE5 B;  3PO2 I;  3OW2 Y;  1YIJ Z;  3CMA 1;  1YIT 1;  3CCR Z;  3HOZ I;  4E30 A;  3S16 I;  2NVY I;  3H0G I;  1M90 1;  1ZB9 A;  3RZO I;  3ESW A;  4NBB A;  4NBD A;  2DE5 A;  1VQM Z;  1JJ2 Z;  2EGT A;  2QR1 B;  1VQK 1;  3VMG A;  5C3E I;  3GTK I;  3KIH A;  5C4X I;  3I55 1;  1N8R 2;  1VQN 1;  1N8R 1;  2B63 I;  3HKZ A;  4Y52 I;  1YJ9 Z;  1YHQ 1;  3QWU A;  4EWC A;  4BY7 I;  2WAQ A;  3MZK B;  2O53 A;  4RV9 A;  4HH4 A;  1VQ8 Z;  3J80 b;  3CCE 1;  2QA4 1;  1YI2 1;  3LUS A;  3CMA Z;  3G71 1;  2JMO A;  1S7M A;  5CM2 M;  3NH4 A;  1ZH1 A;  3VB9 A;  4NBG A;  3CPW Y;  1KD1 2;  2IZ4 A;  4RVF A;  1SFO I;  5T67 A;  3S15 I;  3G4S 1;  2WB1 A;  1M1K 2;  1Z02 A;  2Q4Z A;  3GTM S;  1KQS Z;  4DGL A;  1M1K 1;  4DK1 A;  1VQK Z;  2QEX 1;  5IP7 I;  2H85 A;  1KC8 1;  3CC4 1;  1VQN Z;  5IT9 f;  3BG0 B;  3OW2 Z;  3RZD I;  1WII A;  1VQ7 1;  2DE6 A;  1K73 2;  3CCE Z;  3HOW I;  3CXC Y;  3IF8 A;  3M4O I;  1ML8 A;  3S1R I;  2QLV B;  1YI2 Z;  3I07 A;  1PFT A;  1K83 I;  3HOY I;  4AYB A;  4E32 A;  1Q82 2;  4A93 I;  5T64 A;  1Q82 1;  2JS4 A;  1K8A 2;  4TNU A;  3CCU 1;  4HGZ A;  1NP6 A;  2YAD A;  1K8A 1;  2RT9 A;  3VTN A;  1RLY A;  2PMZ A;  2R92 I;  3G4S Z;  4QTT A;  1QF8 A;  3F3F C;  3GTJ I;  5AN9 F;  2R93 I;  3J81 b;  1VQL Z;  1YUA A;  4E2W A;  3GTP I;  3GTQ I;  2P3Y A;  2QEX Z;  4A3I I;  4BBR I;  1TWF I;  1QYP A;  3U50 C;  2NVX I;  4NB8 A;  2PM9 A;  2P28 A;  3I4N I;  4MON A;  3CCJ 1;  3JAM b;  1VQ7 Z;  1RO4 A;  4MD8 A;  3CPW Z;  1M90 2;  3M3Y I;  2W04 A;  3NFZ A;  2OTJ 1;  3FKI I;  1X0T A;  3HOX I;  4A3M I;  2KPI A;  5LL6 f;  2Y0S A;  3CCU Z;  2E2J I;  2JA7 I;  4S1T A;  1TWC I;  2BJO A;  3IFU A;  1VQO 1;  3F3P C;  3T4N B;  1TWG I;  4HGY A;  3CCL 1;  2J6A A;  1X3Z A;  1K9M 2;  3CXC Z;  2F4O A;  1DL6 A;  3CD6 Z;  5A2Q f;  2QRD B;  2W03 A;  1K9M 1;  3TDH B;  3MZL B;  1WW9 A;  4A3D I;  3CC2 1;  1Q81 1;  3G6E 1;  2G2K A;  3CCJ Z;  1Q86 1;  2NVQ I;  2K5R A;  2LFU A;  5T6B A;  1P9N A;  3GKQ A;  3P5J B;  2JA6 I;  4A3B I;  2ZAE B;  4NBE A;  3HOU I;  1YUK A;  4RVG A;  2QRE B;  2RHB A;  2OTJ Z;  4MXU A;  2V8J A;  1TWH I;  1Y1W I;  1VQL 1;  4A3J I;  2O4H A;  2M6N A;  4A3G I;  5D1O B;  1KC8 2;  2JA5 I;  3S2D I;  1I6H I;  1Q7Y 2;  4BXX I;  3NDJ A;  1Q7Y 1;  1X3W A;  1VQO Z;  3VMI A;  1Z01 A;  4XX2 A;  3BG1 B;  5IT9 b;  3FQM A;  1NUI A;  4MD7 A;  3CCL Z;  2JNY A;  3CME Z;  1WCM I;  1I50 I;  3CCS 1;  1JJ2 Y;  5FLX f;  4A3E I;  1W2B Y;  3GTM I;  2E2H I;  3EED A;  3CC2 Z;  1USP B;  3G6E Z;  4NOZ A;  2OTL Z;  2QKD A;  4BBS I;  1Y1V S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...