4BY7I

Elongating rna polymerase ii-bye1 tld complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA polymerase II complexes with Bye1, a chromatin-binding PHF3/DIDO homologue.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4by7I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4by7I02
3I07A 3GTJI 2E2HI 4A3DI 2HF1A 2JA5I 1TWAI 3VMIA 2VUMI 3Q87A 1I3QI 1K83I 1ML8A 4A3MI 4NBCA 1PFTA 3GTKI 4A3CI 5IP7I 1R9TI 1TWHI 4A3FI 3GKQA 3HOYI 3VMHA 2J6AA 1TWFI 3S1NI 5CM2M 3PO3I 2JA6I 3LUSA 1TFIA 3RZDI 3D6WA 3M4OI 3S1QI 2F4MA 4A3JI 1L1OC 2R92I 3S1RI 2R7ZI 3GCFA 5C4XI 1ZB8A 4BBRI 1USPB 3I4NI 2DE7A 2E2JI 4A3GI 3CQZI 4A93I 2NVTI 3S15I 3HOXI 1X3ZA 4A3LI 3S14I 3HOUI 2K5RA 5C4JI 3FKII 4NBEA 4BY1I 4NB8A 3I4MI 5FLMI 4A3II 1YUAA 2JNYA 2R93I 3HOVI 1I50I 5IP9I 4Y52I 1VLAA 1N2FA 3PO3S 2NVQI 1DL6A 2BJOA 1RO4A 1I6HI 2JA7I 2RBLA 3S16I 4QTUA 3GTQI 4NB9A 4NBAA 2E2II 1LQLA 4BY7I 4MH4A 1SFOI 4NBDA 2NVYI 4NOZA 3PO2I 4A3EI 3H0GI 4A3BI 2B63I 1QYPA 4BXXI 3HOZI 3S1MI 1TWCI 1WCMI 1Y1VI 4A3KI 3GTMI 3K7AI 3GTLI 3GTGI 3S17I 4X6AI 1ZB9A 1USPA 3U50C 2DE5A 2P3YA 3M3YI 2NVXI 3VB9A 3EERA 3RZOI 1TWGI 5C44I 5C3EI 3ESWA 3S2HI 2KPIA 1Y1WI 4BBSI 4NBGA 3GTOI 2PK7A 4Y7NI 2YU9I 3S2DI 4NBBA 2JR6A 3VMGA 3GTPI 2JS4A 1Y1VS 2F4OA 3HOWI 3GTMS 4QTTA 1X3WA 2DE6A 4NBHA 1RLYA 4NBFA 1NUIA 2JA8I 2AKLA 1WW9A 3H3VJ 4XX2A
chains in the Genus database with same CATH superfamily
2LEXA 3GTJI 2HF1A 3CC7Z 2VUMI 2W03A 3F3PC 4A3MI 4A3CI 2IV2X 3HOYI 1NJI1 4HH4A 2RHBA 5LL6f 1TFIA 1K731 3G71Z 3M4OI 1YJ91 2E9HA 1Q812 2R92I 5D1PA 3GCFA 3J81b 3T4NB 3IF8A 2V45A 3CQZI 4MD7A 2QKDA 3S14I 1VQL1 1VQ51 1M902 3CCU1 1YUAA 2HU9A 2R93I 1VQ91 1VLAA 1N2FA 1YJ9Z 3CCJZ 2IZ3A 2JA7I 3S16I 3JAMf 2E2II 1Z03A 2RT9A 5D1OA 3OW2Y 4NBDA 1VQ5Z 3G4S1 2JUBA 1VQ9Z 2JMOA 3TE5B 1TWCI 2M6NA 3K7AI 3GTMI 3GTGI 2VUGA 4EWCA 4RVDA 4X6AI 2KI7B 3NH8A 1N8R2 3U50C 3F3FC 2P3YA 2RPRA 2NVXI 3VB9A 3EERA 1YITZ 1VQK1 3CXCY 2KPIA 1Q811 5AN9F 3CXCZ 1Q862 2JR6A 5T67A 1RO0A 4DGLA 1M901 2JIMA 1X3WA 1Z02A 1VQKZ 3D9XA 2AKLA 1WW9A 2E2HI 4RS4A 2ZAEB 4A3DI 1YJW1 2AYDA 1K83I 3FQQA 2M48A 1KQSZ 1VQNZ 2P28A 1R9TI 2IZ4A 1JJ2Y 3CC71 5FLXb 3JAMb 1JJ2Z 4A3FI 3CCQZ 1NP6A 1YJWZ 1WZNA 2V8JA 3RZDI 1KC82 3D6WA 1N8R1 3S1QI 1VQM1 1QF8A 2R7ZI 2JIRA 5C4XI 4BBRI 1USPB 3I4NI 4NFRA 2QEX1 3G711 1Q861 3IFUA 2NVTI 3J80f 4BY1I 4NB8A 1VQMZ 3D2LA 4Y52I 2QR1B 3CCR1 1YI21 3NDIA 2RBLA 2QEXZ 3GTQI 4NBAA 3NDJA 3CCMZ 1LQLA 3EEDA 4MH4A 3CC21 4RVGA 3CCJ1 4NOZA 1K8A2 4HGZA 3H0GI 2LFUA 3CCRZ 1QYPA 4BXXI 3S1MI 1Y1VI 4A3KI 1YI2Z 2Y0SA 3GTLI 3CCEZ 1VQ8Z 3CMAZ 2OTJZ 2H85A 3CC2Z 1ZB9A 3QWUA 4RV9A 3TDHB 2DE5A 1KC81 3M3YI 3HKZA 5FLXf 3S2HI 1AA6A 4BBSI 3CC4Z 3OW2Z 4NBBA 2VPZA 4DK1A 1YIT1 3GTPI 4DQYB 2F4OA 1M1K2 3CCL1 3GTMS 3CCVZ 1RO2A 4E2ZA 2JA8I 3KIFA 4S1TA 4XX2A 3I07A 3J80b 3MZLB 2PMZA 4CL1A 1I3QI 3CCLZ 1ML8A 2K3RA 2O4HA 1PFTA 3FQMA 3GTKI 5IP7I 1K8A1 5D1OB 2LIYA 2RIQA 3GKQA 1WIIA 4MD8A 1WJ2A 2PM9A 1VQN1 2J6AA 3PO3I 2JA6I 5T6BA 1VQP1 3CCQ1 2NAPA 3CCS1 1VQ41 2E7ZA 2F4MA 4A3JI 3J7A4 2GTHA 1L1OC 1VQ61 1ZB8A 3CD6Z 1ZH1A 4A93I 2Q4ZA 3S15I 3HOXI 1X3ZA 2K5RA 1K9M2 1YHQZ 4NBEA 1M1K1 1VQPZ 3CCSZ 2JNYA 1VQ4Z 3NFZA 5IP9I 3G6EZ 1JWHC 2NVQI 1DL6A 1YJN1 1VQ6Z 3I561 2BJOA 1RO4A 1I6HI 2OOXB 3BG0B 2WAQA 4QTUA 5A2Qf 4TNUA 2YADA 2QA41 3NH4A 4MONA 1Q822 1QVGY 2QRCB 2G2KA 4A3EI 5IT9f 1QVGZ 2R6MA 1YJNZ 3CCM1 3HOZI 2GU2A 2VF1A 3I56Z 3BG1B 3S17I 1RNIA 4E2YA 2OTL1 2QA4Z 2Q51A 1VQ7Z 3CCE1 2W04A 2OOYB 4RVFA 5C3EI 1VQ81 3ESWA 3CMA1 2OTJ1 1Y1WI 3GTOI 3S2DI 4HGYA 3I55Z 1KRLA 2JS4A 2OTLZ 1SIWA 1Y1VS 1K9M1 2WB1A 4QTTA 3CC41 1W2BY 2DE6A 2OZKA 4NBFA 1W2BZ 1NUIA 2GTIA 2VPXA 3CCV1 1S721 1KD12 2JA5I 1TWAI 3VMIA 3Q87A 4E2WA 1Q821 4NBCA 3MZKB 2QLVB 4E32A 1TWHI 5A2Qb 3CPWY 3MONA 3VMHA 1S72Z 3CPWZ 4AYBA 1TWFI 3S1NI 3P5JB 5CM2M 4E2XA 3LUSA 5IT9b 1VQO1 1YUKA 4MD9A 1VQLZ 3S1RI 3CCUZ 2I3CA 2DE7A 2E2JI 2EGTA 4A3GI 4A3LI 4RVHA 3HOUI 5C4JI 3FKII 3I4MI 5FLMI 1Q16A 4A3II 1VQOZ 1Q7Y2 3HOVI 3CD61 1I50I 3IX0A 3CME1 2O53A 1QXFA 3PO3S 3G4SZ 1YHQ1 4NB9A 1P9NA 3G6E1 1KD11 2VPYA 2V8KA 4MXUA 4BY7I 1SFOI 1FDOA 2NVYI 1YIJ1 3PO2I 1S7MA 3CMEZ 4A3BI 2B63I 1Y8CA 1WCMI 1NJI2 4E31A 3J81f 2JIOA 1X0TA 4MRIA 1K732 1USPA 4NH1C 1YIJZ 3KIHA 3RZOI 1TWGI 5C44I 1KQSY 2QRDB 2QREB 4NBGA 4E30A 1Z01A 3NH5A 2PK7A 1RQFA 2JIPA 4Y7NI 1VQ71 2YU9I 3VMGA 3VTNA 3HOWI 5T64A 4E33A 1Q7Y1 4NBHA 1FDIA 1RLYA 2V3VA 2VPWA 1QVFY 2V8IA 3IR7A 3I551 1QVFZ 3H3VJ 2JIQA
chains in the Genus database with same CATH topology
3GTJI 2HF1A 3CC7Z 2VUMI 2W03A 3F3PC 4A3MI 4A3CI 3HOYI 1NJI1 4HH4A 2RHBA 5LL6f 1TFIA 1K731 3G71Z 3M4OI 1YJ91 2E9HA 1Q812 2R92I 5D1PA 3GCFA 3J81b 3T4NB 3IF8A 3CQZI 4MD7A 2QKDA 3S14I 1VQL1 1VQ51 1M902 3CCU1 1YUAA 2HU9A 2R93I 1VQ91 1VLAA 1N2FA 1YJ9Z 3CCJZ 2IZ3A 2JA7I 3S16I 3JAMf 2E2II 1Z03A 2RT9A 5D1OA 3OW2Y 4NBDA 1VQ5Z 3G4S1 2JUBA 1VQ9Z 2JMOA 3TE5B 1TWCI 2M6NA 3K7AI 3GTMI 3GTGI 2VUGA 4EWCA 4RVDA 4X6AI 2KI7B 3NH8A 1N8R2 3U50C 3F3FC 2P3YA 2RPRA 2NVXI 3VB9A 3EERA 1YITZ 1VQK1 3CXCY 2KPIA 1Q811 5AN9F 3CXCZ 1Q862 2JR6A 5T67A 1RO0A 4DGLA 1M901 1X3WA 1Z02A 1VQKZ 3D9XA 2AKLA 1WW9A 2E2HI 4RS4A 2ZAEB 4A3DI 1YJW1 1K83I 3FQQA 2M48A 1KQSZ 1VQNZ 2P28A 1R9TI 2IZ4A 1JJ2Y 3CC71 5FLXb 3JAMb 1JJ2Z 4A3FI 3CCQZ 1NP6A 1YJWZ 2V8JA 3RZDI 1KC82 3D6WA 1N8R1 3S1QI 1VQM1 1QF8A 2R7ZI 5C4XI 4BBRI 1USPB 3I4NI 4NFRA 2QEX1 3G711 1Q861 3IFUA 2NVTI 3J80f 4BY1I 4NB8A 1VQMZ 4Y52I 2QR1B 3CCR1 1YI21 3NDIA 2RBLA 2QEXZ 3GTQI 4NBAA 3NDJA 3CCMZ 1LQLA 3EEDA 4MH4A 3CC21 4RVGA 3CCJ1 4NOZA 1K8A2 4HGZA 3H0GI 2LFUA 3CCRZ 1QYPA 4BXXI 3S1MI 1Y1VI 4A3KI 1YI2Z 2Y0SA 3GTLI 3CCEZ 1VQ8Z 3CMAZ 2OTJZ 2H85A 3CC2Z 1ZB9A 3QWUA 4RV9A 3TDHB 2DE5A 1KC81 3M3YI 3HKZA 5FLXf 3S2HI 4BBSI 3CC4Z 3OW2Z 4NBBA 4DK1A 1YIT1 3GTPI 4DQYB 2F4OA 1M1K2 3CCL1 3GTMS 3CCVZ 1RO2A 4E2ZA 2JA8I 3KIFA 4S1TA 4XX2A 3I07A 3J80b 3MZLB 2PMZA 4CL1A 1I3QI 3CCLZ 1ML8A 2K3RA 2O4HA 1PFTA 3FQMA 3GTKI 5IP7I 1K8A1 5D1OB 2LIYA 2RIQA 3GKQA 1WIIA 4MD8A 2PM9A 1VQN1 2J6AA 3PO3I 2JA6I 5T6BA 1VQP1 3CCQ1 3CCS1 1VQ41 2F4MA 4A3JI 3J7A4 2GTHA 1L1OC 1VQ61 1ZB8A 3CD6Z 1ZH1A 4A93I 2Q4ZA 3S15I 3HOXI 1X3ZA 2K5RA 1K9M2 1YHQZ 4NBEA 1M1K1 1VQPZ 3CCSZ 2JNYA 1VQ4Z 3NFZA 5IP9I 3G6EZ 1JWHC 2NVQI 1DL6A 1YJN1 1VQ6Z 3I561 2BJOA 1RO4A 1I6HI 2OOXB 3BG0B 2WAQA 4QTUA 5A2Qf 4TNUA 2YADA 2QA41 3NH4A 4MONA 1Q822 1QVGY 2QRCB 2G2KA 4A3EI 5IT9f 1QVGZ 2R6MA 1YJNZ 3CCM1 3HOZI 2GU2A 2VF1A 3I56Z 3BG1B 3S17I 1RNIA 4E2YA 2OTL1 2QA4Z 2Q51A 1VQ7Z 3CCE1 2W04A 2OOYB 4RVFA 5C3EI 1VQ81 3ESWA 3CMA1 2OTJ1 1Y1WI 3GTOI 3S2DI 4HGYA 3I55Z 1KRLA 2JS4A 2OTLZ 1Y1VS 1K9M1 2WB1A 4QTTA 3CC41 1W2BY 2DE6A 2OZKA 4NBFA 1W2BZ 1NUIA 2GTIA 3CCV1 1S721 1KD12 2JA5I 1TWAI 3VMIA 3Q87A 4E2WA 1Q821 4NBCA 3MZKB 2QLVB 4E32A 1TWHI 5A2Qb 3CPWY 3MONA 3VMHA 1S72Z 3CPWZ 4AYBA 1TWFI 3S1NI 3P5JB 5CM2M 4E2XA 3LUSA 5IT9b 1VQO1 1YUKA 4MD9A 1VQLZ 3S1RI 3CCUZ 2I3CA 2DE7A 2E2JI 2EGTA 4A3GI 4A3LI 4RVHA 3HOUI 5C4JI 3FKII 3I4MI 5FLMI 1VQOZ 4A3II 1Q7Y2 3HOVI 3CD61 1I50I 3IX0A 3CME1 2O53A 3PO3S 3G4SZ 1YHQ1 4NB9A 1P9NA 3G6E1 1KD11 2V8KA 4MXUA 4BY7I 1SFOI 2NVYI 1YIJ1 3PO2I 1S7MA 3CMEZ 4A3BI 2B63I 1WCMI 1NJI2 4E31A 3J81f 1X0TA 4MRIA 1K732 1USPA 4NH1C 1YIJZ 3KIHA 3RZOI 1TWGI 5C44I 1KQSY 2QRDB 2QREB 4NBGA 4E30A 1Z01A 3NH5A 2PK7A 1RQFA 4Y7NI 1VQ71 2YU9I 3VMGA 3VTNA 3HOWI 5T64A 4E33A 1Q7Y1 4NBHA 1RLYA 1QVFY 2V8IA 3I551 3H3VJ 1QVFZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I07 A;  3GTJ I;  2E2H I;  4A3D I;  2HF1 A;  2JA5 I;  1TWA I;  3VMI A;  2VUM I;  3Q87 A;  1I3Q I;  1K83 I;  1ML8 A;  4A3M I;  4NBC A;  1PFT A;  3GTK I;  4A3C I;  5IP7 I;  1R9T I;  1TWH I;  4A3F I;  3GKQ A;  3HOY I;  3VMH A;  2J6A A;  1TWF I;  3S1N I;  5CM2 M;  3PO3 I;  2JA6 I;  3LUS A;  1TFI A;  3RZD I;  3D6W A;  3M4O I;  3S1Q I;  2F4M A;  4A3J I;  1L1O C;  2R92 I;  3S1R I;  2R7Z I;  3GCF A;  5C4X I;  1ZB8 A;  4BBR I;  1USP B;  3I4N I;  2DE7 A;  2E2J I;  4A3G I;  3CQZ I;  4A93 I;  2NVT I;  3S15 I;  3HOX I;  1X3Z A;  4A3L I;  3S14 I;  3HOU I;  2K5R A;  5C4J I;  3FKI I;  4NBE A;  4BY1 I;  4NB8 A;  3I4M I;  5FLM I;  4A3I I;  1YUA A;  2JNY A;  2R93 I;  3HOV I;  1I50 I;  5IP9 I;  4Y52 I;  1VLA A;  1N2F A;  3PO3 S;  2NVQ I;  1DL6 A;  2BJO A;  1RO4 A;  1I6H I;  2JA7 I;  2RBL A;  3S16 I;  4QTU A;  3GTQ I;  4NB9 A;  4NBA A;  2E2I I;  1LQL A;  4BY7 I;  4MH4 A;  1SFO I;  4NBD A;  2NVY I;  4NOZ A;  3PO2 I;  4A3E I;  3H0G I;  4A3B I;  2B63 I;  1QYP A;  4BXX I;  3HOZ I;  3S1M I;  1TWC I;  1WCM I;  1Y1V I;  4A3K I;  3GTM I;  3K7A I;  3GTL I;  3GTG I;  3S17 I;  4X6A I;  1ZB9 A;  1USP A;  3U50 C;  2DE5 A;  2P3Y A;  3M3Y I;  2NVX I;  3VB9 A;  3EER A;  3RZO I;  1TWG I;  5C44 I;  5C3E I;  3ESW A;  3S2H I;  2KPI A;  1Y1W I;  4BBS I;  4NBG A;  3GTO I;  2PK7 A;  4Y7N I;  2YU9 I;  3S2D I;  4NBB A;  2JR6 A;  3VMG A;  3GTP I;  2JS4 A;  1Y1V S;  2F4O A;  3HOW I;  3GTM S;  4QTT A;  1X3W A;  2DE6 A;  4NBH A;  1RLY A;  4NBF A;  1NUI A;  2JA8 I;  2AKL A;  1WW9 A;  3H3V J;  4XX2 A; 
#chains in the Genus database with same CATH topology
 2LEX A;  3GTJ I;  2HF1 A;  3CC7 Z;  2VUM I;  2W03 A;  3F3P C;  4A3M I;  4A3C I;  2IV2 X;  3HOY I;  1NJI 1;  4HH4 A;  2RHB A;  5LL6 f;  1TFI A;  1K73 1;  3G71 Z;  3M4O I;  1YJ9 1;  2E9H A;  1Q81 2;  2R92 I;  5D1P A;  3GCF A;  3J81 b;  3T4N B;  3IF8 A;  2V45 A;  3CQZ I;  4MD7 A;  2QKD A;  3S14 I;  1VQL 1;  1VQ5 1;  1M90 2;  3CCU 1;  1YUA A;  2HU9 A;  2R93 I;  1VQ9 1;  1VLA A;  1N2F A;  1YJ9 Z;  3CCJ Z;  2IZ3 A;  2JA7 I;  3S16 I;  3JAM f;  2E2I I;  1Z03 A;  2RT9 A;  5D1O A;  3OW2 Y;  4NBD A;  1VQ5 Z;  3G4S 1;  2JUB A;  1VQ9 Z;  2JMO A;  3TE5 B;  1TWC I;  2M6N A;  3K7A I;  3GTM I;  3GTG I;  2VUG A;  4EWC A;  4RVD A;  4X6A I;  2KI7 B;  3NH8 A;  1N8R 2;  3U50 C;  3F3F C;  2P3Y A;  2RPR A;  2NVX I;  3VB9 A;  3EER A;  1YIT Z;  1VQK 1;  3CXC Y;  2KPI A;  1Q81 1;  5AN9 F;  3CXC Z;  1Q86 2;  2JR6 A;  5T67 A;  1RO0 A;  4DGL A;  1M90 1;  2JIM A;  1X3W A;  1Z02 A;  1VQK Z;  3D9X A;  2AKL A;  1WW9 A;  2E2H I;  4RS4 A;  2ZAE B;  4A3D I;  1YJW 1;  2AYD A;  1K83 I;  3FQQ A;  2M48 A;  1KQS Z;  1VQN Z;  2P28 A;  1R9T I;  2IZ4 A;  1JJ2 Y;  3CC7 1;  5FLX b;  3JAM b;  1JJ2 Z;  4A3F I;  3CCQ Z;  1NP6 A;  1YJW Z;  1WZN A;  2V8J A;  3RZD I;  1KC8 2;  3D6W A;  1N8R 1;  3S1Q I;  1VQM 1;  1QF8 A;  2R7Z I;  2JIR A;  5C4X I;  4BBR I;  1USP B;  3I4N I;  4NFR A;  2QEX 1;  3G71 1;  1Q86 1;  3IFU A;  2NVT I;  3J80 f;  4BY1 I;  4NB8 A;  1VQM Z;  3D2L A;  4Y52 I;  2QR1 B;  3CCR 1;  1YI2 1;  3NDI A;  2RBL A;  2QEX Z;  3GTQ I;  4NBA A;  3NDJ A;  3CCM Z;  1LQL A;  3EED A;  4MH4 A;  3CC2 1;  4RVG A;  3CCJ 1;  4NOZ A;  1K8A 2;  4HGZ A;  3H0G I;  2LFU A;  3CCR Z;  1QYP A;  4BXX I;  3S1M I;  1Y1V I;  4A3K I;  1YI2 Z;  2Y0S A;  3GTL I;  3CCE Z;  1VQ8 Z;  3CMA Z;  2OTJ Z;  2H85 A;  3CC2 Z;  1ZB9 A;  3QWU A;  4RV9 A;  3TDH B;  2DE5 A;  1KC8 1;  3M3Y I;  3HKZ A;  5FLX f;  3S2H I;  1AA6 A;  4BBS I;  3CC4 Z;  3OW2 Z;  4NBB A;  2VPZ A;  4DK1 A;  1YIT 1;  3GTP I;  4DQY B;  2F4O A;  1M1K 2;  3CCL 1;  3GTM S;  3CCV Z;  1RO2 A;  4E2Z A;  2JA8 I;  3KIF A;  4S1T A;  4XX2 A;  3I07 A;  3J80 b;  3MZL B;  2PMZ A;  4CL1 A;  1I3Q I;  3CCL Z;  1ML8 A;  2K3R A;  2O4H A;  1PFT A;  3FQM A;  3GTK I;  5IP7 I;  1K8A 1;  5D1O B;  2LIY A;  2RIQ A;  3GKQ A;  1WII A;  4MD8 A;  1WJ2 A;  2PM9 A;  1VQN 1;  2J6A A;  3PO3 I;  2JA6 I;  5T6B A;  1VQP 1;  3CCQ 1;  2NAP A;  3CCS 1;  1VQ4 1;  2E7Z A;  2F4M A;  4A3J I;  3J7A 4;  2GTH A;  1L1O C;  1VQ6 1;  1ZB8 A;  3CD6 Z;  1ZH1 A;  4A93 I;  2Q4Z A;  3S15 I;  3HOX I;  1X3Z A;  2K5R A;  1K9M 2;  1YHQ Z;  4NBE A;  1M1K 1;  1VQP Z;  3CCS Z;  2JNY A;  1VQ4 Z;  3NFZ A;  5IP9 I;  3G6E Z;  1JWH C;  2NVQ I;  1DL6 A;  1YJN 1;  1VQ6 Z;  3I56 1;  2BJO A;  1RO4 A;  1I6H I;  2OOX B;  3BG0 B;  2WAQ A;  4QTU A;  5A2Q f;  4TNU A;  2YAD A;  2QA4 1;  3NH4 A;  4MON A;  1Q82 2;  1QVG Y;  2QRC B;  2G2K A;  4A3E I;  5IT9 f;  1QVG Z;  2R6M A;  1YJN Z;  3CCM 1;  3HOZ I;  2GU2 A;  2VF1 A;  3I56 Z;  3BG1 B;  3S17 I;  1RNI A;  4E2Y A;  2OTL 1;  2QA4 Z;  2Q51 A;  1VQ7 Z;  3CCE 1;  2W04 A;  2OOY B;  4RVF A;  5C3E I;  1VQ8 1;  3ESW A;  3CMA 1;  2OTJ 1;  1Y1W I;  3GTO I;  3S2D I;  4HGY A;  3I55 Z;  1KRL A;  2JS4 A;  2OTL Z;  1SIW A;  1Y1V S;  1K9M 1;  2WB1 A;  4QTT A;  3CC4 1;  1W2B Y;  2DE6 A;  2OZK A;  4NBF A;  1W2B Z;  1NUI A;  2GTI A;  2VPX A;  3CCV 1;  1S72 1;  1KD1 2;  2JA5 I;  1TWA I;  3VMI A;  3Q87 A;  4E2W A;  1Q82 1;  4NBC A;  3MZK B;  2QLV B;  4E32 A;  1TWH I;  5A2Q b;  3CPW Y;  3MON A;  3VMH A;  1S72 Z;  3CPW Z;  4AYB A;  1TWF I;  3S1N I;  3P5J B;  5CM2 M;  4E2X A;  3LUS A;  5IT9 b;  1VQO 1;  1YUK A;  4MD9 A;  1VQL Z;  3S1R I;  3CCU Z;  2I3C A;  2DE7 A;  2E2J I;  2EGT A;  4A3G I;  4A3L I;  4RVH A;  3HOU I;  5C4J I;  3FKI I;  3I4M I;  5FLM I;  1Q16 A;  4A3I I;  1VQO Z;  1Q7Y 2;  3HOV I;  3CD6 1;  1I50 I;  3IX0 A;  3CME 1;  2O53 A;  1QXF A;  3PO3 S;  3G4S Z;  1YHQ 1;  4NB9 A;  1P9N A;  3G6E 1;  1KD1 1;  2VPY A;  2V8K A;  4MXU A;  4BY7 I;  1SFO I;  1FDO A;  2NVY I;  1YIJ 1;  3PO2 I;  1S7M A;  3CME Z;  4A3B I;  2B63 I;  1Y8C A;  1WCM I;  1NJI 2;  4E31 A;  3J81 f;  2JIO A;  1X0T A;  4MRI A;  1K73 2;  1USP A;  4NH1 C;  1YIJ Z;  3KIH A;  3RZO I;  1TWG I;  5C44 I;  1KQS Y;  2QRD B;  2QRE B;  4NBG A;  4E30 A;  1Z01 A;  3NH5 A;  2PK7 A;  1RQF A;  2JIP A;  4Y7N I;  1VQ7 1;  2YU9 I;  3VMG A;  3VTN A;  3HOW I;  5T64 A;  4E33 A;  1Q7Y 1;  4NBH A;  1FDI A;  1RLY A;  2V3V A;  2VPW A;  1QVF Y;  2V8I A;  3IR7 A;  3I55 1;  1QVF Z;  3H3V J;  2JIQ A; 
#chains in the Genus database with same CATH homology
 3GTJ I;  2HF1 A;  3CC7 Z;  2VUM I;  2W03 A;  3F3P C;  4A3M I;  4A3C I;  3HOY I;  1NJI 1;  4HH4 A;  2RHB A;  5LL6 f;  1TFI A;  1K73 1;  3G71 Z;  3M4O I;  1YJ9 1;  2E9H A;  1Q81 2;  2R92 I;  5D1P A;  3GCF A;  3J81 b;  3T4N B;  3IF8 A;  3CQZ I;  4MD7 A;  2QKD A;  3S14 I;  1VQL 1;  1VQ5 1;  1M90 2;  3CCU 1;  1YUA A;  2HU9 A;  2R93 I;  1VQ9 1;  1VLA A;  1N2F A;  1YJ9 Z;  3CCJ Z;  2IZ3 A;  2JA7 I;  3S16 I;  3JAM f;  2E2I I;  1Z03 A;  2RT9 A;  5D1O A;  3OW2 Y;  4NBD A;  1VQ5 Z;  3G4S 1;  2JUB A;  1VQ9 Z;  2JMO A;  3TE5 B;  1TWC I;  2M6N A;  3K7A I;  3GTM I;  3GTG I;  2VUG A;  4EWC A;  4RVD A;  4X6A I;  2KI7 B;  3NH8 A;  1N8R 2;  3U50 C;  3F3F C;  2P3Y A;  2RPR A;  2NVX I;  3VB9 A;  3EER A;  1YIT Z;  1VQK 1;  3CXC Y;  2KPI A;  1Q81 1;  5AN9 F;  3CXC Z;  1Q86 2;  2JR6 A;  5T67 A;  1RO0 A;  4DGL A;  1M90 1;  1X3W A;  1Z02 A;  1VQK Z;  3D9X A;  2AKL A;  1WW9 A;  2E2H I;  4RS4 A;  2ZAE B;  4A3D I;  1YJW 1;  1K83 I;  3FQQ A;  2M48 A;  1KQS Z;  1VQN Z;  2P28 A;  1R9T I;  2IZ4 A;  1JJ2 Y;  3CC7 1;  5FLX b;  3JAM b;  1JJ2 Z;  4A3F I;  3CCQ Z;  1NP6 A;  1YJW Z;  2V8J A;  3RZD I;  1KC8 2;  3D6W A;  1N8R 1;  3S1Q I;  1VQM 1;  1QF8 A;  2R7Z I;  5C4X I;  4BBR I;  1USP B;  3I4N I;  4NFR A;  2QEX 1;  3G71 1;  1Q86 1;  3IFU A;  2NVT I;  3J80 f;  4BY1 I;  4NB8 A;  1VQM Z;  4Y52 I;  2QR1 B;  3CCR 1;  1YI2 1;  3NDI A;  2RBL A;  2QEX Z;  3GTQ I;  4NBA A;  3NDJ A;  3CCM Z;  1LQL A;  3EED A;  4MH4 A;  3CC2 1;  4RVG A;  3CCJ 1;  4NOZ A;  1K8A 2;  4HGZ A;  3H0G I;  2LFU A;  3CCR Z;  1QYP A;  4BXX I;  3S1M I;  1Y1V I;  4A3K I;  1YI2 Z;  2Y0S A;  3GTL I;  3CCE Z;  1VQ8 Z;  3CMA Z;  2OTJ Z;  2H85 A;  3CC2 Z;  1ZB9 A;  3QWU A;  4RV9 A;  3TDH B;  2DE5 A;  1KC8 1;  3M3Y I;  3HKZ A;  5FLX f;  3S2H I;  4BBS I;  3CC4 Z;  3OW2 Z;  4NBB A;  4DK1 A;  1YIT 1;  3GTP I;  4DQY B;  2F4O A;  1M1K 2;  3CCL 1;  3GTM S;  3CCV Z;  1RO2 A;  4E2Z A;  2JA8 I;  3KIF A;  4S1T A;  4XX2 A;  3I07 A;  3J80 b;  3MZL B;  2PMZ A;  4CL1 A;  1I3Q I;  3CCL Z;  1ML8 A;  2K3R A;  2O4H A;  1PFT A;  3FQM A;  3GTK I;  5IP7 I;  1K8A 1;  5D1O B;  2LIY A;  2RIQ A;  3GKQ A;  1WII A;  4MD8 A;  2PM9 A;  1VQN 1;  2J6A A;  3PO3 I;  2JA6 I;  5T6B A;  1VQP 1;  3CCQ 1;  3CCS 1;  1VQ4 1;  2F4M A;  4A3J I;  3J7A 4;  2GTH A;  1L1O C;  1VQ6 1;  1ZB8 A;  3CD6 Z;  1ZH1 A;  4A93 I;  2Q4Z A;  3S15 I;  3HOX I;  1X3Z A;  2K5R A;  1K9M 2;  1YHQ Z;  4NBE A;  1M1K 1;  1VQP Z;  3CCS Z;  2JNY A;  1VQ4 Z;  3NFZ A;  5IP9 I;  3G6E Z;  1JWH C;  2NVQ I;  1DL6 A;  1YJN 1;  1VQ6 Z;  3I56 1;  2BJO A;  1RO4 A;  1I6H I;  2OOX B;  3BG0 B;  2WAQ A;  4QTU A;  5A2Q f;  4TNU A;  2YAD A;  2QA4 1;  3NH4 A;  4MON A;  1Q82 2;  1QVG Y;  2QRC B;  2G2K A;  4A3E I;  5IT9 f;  1QVG Z;  2R6M A;  1YJN Z;  3CCM 1;  3HOZ I;  2GU2 A;  2VF1 A;  3I56 Z;  3BG1 B;  3S17 I;  1RNI A;  4E2Y A;  2OTL 1;  2QA4 Z;  2Q51 A;  1VQ7 Z;  3CCE 1;  2W04 A;  2OOY B;  4RVF A;  5C3E I;  1VQ8 1;  3ESW A;  3CMA 1;  2OTJ 1;  1Y1W I;  3GTO I;  3S2D I;  4HGY A;  3I55 Z;  1KRL A;  2JS4 A;  2OTL Z;  1Y1V S;  1K9M 1;  2WB1 A;  4QTT A;  3CC4 1;  1W2B Y;  2DE6 A;  2OZK A;  4NBF A;  1W2B Z;  1NUI A;  2GTI A;  3CCV 1;  1S72 1;  1KD1 2;  2JA5 I;  1TWA I;  3VMI A;  3Q87 A;  4E2W A;  1Q82 1;  4NBC A;  3MZK B;  2QLV B;  4E32 A;  1TWH I;  5A2Q b;  3CPW Y;  3MON A;  3VMH A;  1S72 Z;  3CPW Z;  4AYB A;  1TWF I;  3S1N I;  3P5J B;  5CM2 M;  4E2X A;  3LUS A;  5IT9 b;  1VQO 1;  1YUK A;  4MD9 A;  1VQL Z;  3S1R I;  3CCU Z;  2I3C A;  2DE7 A;  2E2J I;  2EGT A;  4A3G I;  4A3L I;  4RVH A;  3HOU I;  5C4J I;  3FKI I;  3I4M I;  5FLM I;  1VQO Z;  4A3I I;  1Q7Y 2;  3HOV I;  3CD6 1;  1I50 I;  3IX0 A;  3CME 1;  2O53 A;  3PO3 S;  3G4S Z;  1YHQ 1;  4NB9 A;  1P9N A;  3G6E 1;  1KD1 1;  2V8K A;  4MXU A;  4BY7 I;  1SFO I;  2NVY I;  1YIJ 1;  3PO2 I;  1S7M A;  3CME Z;  4A3B I;  2B63 I;  1WCM I;  1NJI 2;  4E31 A;  3J81 f;  1X0T A;  4MRI A;  1K73 2;  1USP A;  4NH1 C;  1YIJ Z;  3KIH A;  3RZO I;  1TWG I;  5C44 I;  1KQS Y;  2QRD B;  2QRE B;  4NBG A;  4E30 A;  1Z01 A;  3NH5 A;  2PK7 A;  1RQF A;  4Y7N I;  1VQ7 1;  2YU9 I;  3VMG A;  3VTN A;  3HOW I;  5T64 A;  4E33 A;  1Q7Y 1;  4NBH A;  1RLY A;  1QVF Y;  2V8I A;  3I55 1;  3H3V J;  1QVF Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...