1L1OC

Structure of the human replication protein a (rpa) trimerization core
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
178
structure length
173
Chain Sequence
NTNWKTLYEVKSENLGQGDKPDYFSSVATVVYLRKENCMYQACPTQDCNKKVIDQQNGLYRCEKCDTEFPNFKYRMILSVNIADFQENQWVTCFQESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFRSFIFRVRVKVETYIKATVMDVKPVDYREYGRRLVMSIRRSALM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Replication protein A 14 kDa subunit
publication title Structure of the RPA trimerization core and its role in the multistep DNA-binding mechanism of RPA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 39
structure length 173
sequence length 178
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08646 Rep_fac-A_C Replication factor-A C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1l1oC02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1l1oC01
4AYBE 3H3VJ 1VLAA 3VDYA 3CQZI 5C44G 2R92G 4DV4L 2A1AA 3S15H 5ELOA 2VY3A 4DR4L 2BH8A 1ASZA 1VQ8A 2NVXI 4YY3L 4KHPL 4LF8Q 2R92I 5LMUL 3PO3S 1XNQL 2R93G 2B63I 1VQBA 4A3DH 2JA8G 1EWIA 4P74A 3HOZI 3W5OA 3RZDI 1M1KC 1OXVA 5JJLA 1VQIA 1YHBA 2OWOA 1G51A 3GO5A 2K5HA 3J7ZC 3IRBA 4AQYQ 5FLMG 3AQQA 3GTPH 3L7ZC 5GQOA 4DR3Q 3PF4A 4OX9Q 1OXTA 3HOYI 4A3MH 2ZTEA 1J5EQ 4JI3Q 1P16A 3GTKH 4BY7H 2ZJPA 3KJOA 1CKOA 2LSSA 1UWVA 3S2HH 2N78A 3ICEA 2A8VA 2VQFQ 1I5FA 4R4OA 1ASYA 4PMWA 2HT1A 4DV6L 4YCUA 5C0XJ 4PZ7A 2ZJQA 5GROA 4IOAA 2MO1A 4A93H 1EQRA 4JI0Q 2DGYA 2WB1E 1VQHA 4DV3Q 3S24A 4WJ4A 1VS0A 3HKZG 3PCOB 4A3MG 4MZ9A 3H0GG 1PA6A 1QVFA 2MFIA 2R7ZH 3H0GI 1C0AA 4MNOA 4NBBA 1IBML 1EUJA 3G48A 4OO1G 2NVYI 3HOVG 4DV2L 1XNRQ 1FGUA 4APVA 4GNXB 3PUZA 3HOVI 2VQEQ 1QZHA 2Y0SE 2GN5A 4IO9A 4X64L 2CQOA 5BR8L 2K5VA 4AIMA 3I4OA 4GOPC 2YU9I 4A93G 1K3RA 4DR1Q 2E2IH 1S3OA 4UP8A 1PHJA 4A3BI 3L2PA 4TQUS 4AQYL 1IZ6A 4YCVA 3FHWA 4A4IA 4B3TL 1X55A 4BBSH 2P3YA 3JC66 1WYDA 1QZGA 4JI4Q 4JI3L 1SFOI 2I5MX 1IBLQ 3HOWG 4OWWB 2UXCQ 1Z9FA 1LYLA 3HOWI 3CXCA 2N49A 3GTMS 1B8AA 5M3FH 3PUXA 1Y1VS 3PIPA 5J3BA 2DE6A 4KHZA 1Y1WH 2EXDA 1Y14B 3OTOL 2E8GA 1IBKL 4DAYB 4L5SA 3GCFA 2JS4A 3EIVA 1PYBA 2F4VL 3M85A 4JI1Q 1IL2A 3K0XA 1PV4A 2ZM6Q 3S16I 1BBUA 4MH4A 3Q8DA 1L1OA 1AH9A 4NXNL 1X3WA 2DE5A 3CCUA 2ATWA 1MJCA 5DLQE 4BBSG 1SMXA 2UU9Q 4LFBQ 1Q81C 1FJGL 4X62Q 3J7A5 2RF4A 1J6QA 4NBEA 3W1GA 3ZJYC 2AMCB 1TWFI 2KCTA 1NUIA 1AE2A 4RMFA 3S1NH 3GTLI 4EQ5A 1JMCA 3S1RH 2F3IA 1WW9A 3NBHB 3BZCA 2AHOB 3CC7A 4Y7NH 1I50H 1R9TI 1VQLA 2E2JI 1Z47A 3PUVA 3PO3G 1DL6A 2JA5I 1KXLA 3PO3I 3PF5A 2XGTA 4DR1L 3CC4A 3OW2A 1HNZQ 2R7DA 3BJUA 2VUMI 2UUCQ 2UUAL 1VQGA 5IP9H 5FLXc 4DV4Q 4NB8A 1E24A 4JI4L 2NVTH 4DR4Q 5LMNW 4YY3Q 4KHPQ 1YITA 1YUAA 5LMUQ 1OXUA 1JJCB 1XNQQ 3G4SA 4R4IA 4IPHA 4KI0A 2GVBA 3RNUA 1HR0Q 4B3SL 1WFQA 2OTJA 4BY1H 1AE3A 1TWAI 5C4XI 4OXPA 4A3EI 1Q1EA 1IYJB 4DV7L 2YYZA 5GADC 5FJ8H 4LFAL 1GKHA 1OXSC 5JEAJ 4A3FH 3ULJA 2N8NA 4LW1A 4P73A 4X62L 3TEHB 2MNAA 4MTNA 4QTUA 3A74A 3RZOH 1V43A 1UE5A 1JJGA 1GD7A 3FKIG 3CMEA 2ZTDA 4Y52H 3GTQH 1TWCH 2NZHA 4X6AH 2PQAA 3FKII 3GTGI 3CCEA 1HZAA 1I3QI 1SR3A 1RL2A 4GN3B 4DV6Q 1NTGA 4BY1G 2JEAI 4QGUA 3STBC 1K8GA 4DUYL 3E9IA 4GLXA 3T1YL 1JT8A 5E7NA 3GTMH 2YTYA 2Q2UA 4UPAA 5C3EH 4BBRH 3G6EA 4JI5L 3HFZB 4KLKA 4A3CG 2WAQG 4JI2Q 1A0IA 2QGQA 3I4NI 5FJ8G 4A3CI 3UDGA 4OWTB 4A3FG 3S1QH 4DR5Q 4NB3A 4DV0L 2JJQA 3UDXA 3F2CA 1Q82C 1I6HH 5C44I 1IBMQ 1V9PA 2KHJA 3GTOI 1Q8KA 4DV2Q 4IPDA 1K9MC 1VQJA 1NBWA 3F8TA 1PH9A 2R93I 4LF9L 1HR0L 1K83H 2E5LL 4O2DA 4IJLA 4X64Q 4A3LH 1E1TA 5BR8Q 1PH8A 2JA8I 2DE7A 1VQOA 2JA6H 2K5NA 1Y1VG 2IT1A 3ERSX 2KBNA 2AKLA 1Y1VI 4WJ3M 3HOUH 4X65L 4A3KG 4B3TQ 3I56A 1LM0A 2NZOA 5FLMI 4DV5L 3L0OA 2NN6G 3G71A 4A3KI 1B70B 2KHIA 3K7AI 1SLJA 1L0WA 4JBJA 2JNYA 2NVQH 2ID0A 1N2FA 3S17H 4B3RL 1D7QA 2D0PA 1X65A 4GS3A 3S2DH 4GKKL 4EX5A 4NBFA 2ES2A 2Z6KC 2Q2TA 3MEFA 1MIUA 1VQCA 4A3DG 4LNQA 3OTOQ 1IBKQ 1YJWA 4OONA 2ASBA 4A3LG 4A3DI 2F4VQ 4UP9A 3H3VH 2JA6G 1XPRA 2IHEA 3CCVA 3HKSA 5IE8A 1JJ2A 4BA2I 4JBKA 3HOUG 4OWXB 4NXNQ 1JE5A 4JI2L 4QJFA 3GTPI 5HGQA 4LUZA 4DR5L 2KCMA 4QTTA 1FJGQ 3HKZE 4R4QA 1XTDA 4A3MI 4BY7G 1XJVA 1WCMH 2IX0A 4DR2L 3I4MH 2RHSB 2HIVA 3GTKI 4BY7I 2AKWB 1PH3A 3S2HI 2HHHL 3UE0A 1P8LA 5H1SE 4OO1I 4A3GH 1YJ9A 1KIXA 4BXXH 1LQLA 2BA0A 2QA4A 1VQ4A 1L2FA 5JJKA 4P72A 4JV5Q 5AJ3L 4C3HH 1EFWA 3K7UC 2QEXA 2I0QA 3HOXH 1X3ZA 4GNXC 4R4TA 1N32L 4LWCA 1RO4A 4JCVE 4C2MH 1TWHH 2F4MA 3K80C 4A93I 4GOPA 3K8AA 2MO0A 5IYDH 2JR6A 4QY7A 2UUAQ 1VQNA 3RR5A 3VB9A 1TWGH 1WCMG 1K0RA 3I4MG 2R7ZG 1SROA 2UXDL 1JB7A 3S14H 2R7ZI 3M7NA 1A8VA 3EBEA 3AYHB 4A3GG 5IYCH 2LXJA 4BXXG 3A5UA 4DV1L 4B3SQ 4GLVB 3WWVA 1L1OB 2VNUD 3KLWA 4XTCS 5M3MH 3HOXG 2V1CC 1QVCA 1YZ6A 4NBCA 1KHIA 3RLFA 2FXQA 4NPSA 2E2II 1NMFA 1V1QA 4DV7Q 4K0KQ 5IYDG 3PSIA 2I5HA 4YHHL 1OTCA 4LFAQ 4HJ8A 4IPGA 2UUBL 1NE3A 4A3IH 4DKAC 5C0XG 4BBSI 3KFUA 5C0XI 3J81j 3A0JA 1USPA 5M3FG 4JI7L 3U4ZA 3W1BA 1S40A 1NMGA 5IYCG 3RN2A 1C9OA 2ZTCA 4UY8C 1Y1WG 3NEMA 3M4QA 1Y1WI 3PGZA 4DUYQ 3T1YQ 2IY5B 1BKBA 3M4OH 3CMAA 4JV5L 5M3MG 1VQ9A 3VMIA 1YHAA 4JI5Q 2H5XA 4HIOA 1N36L 3PO2H 4HIDA 3I55A 3J81c 3U4VA 4C3IH 3J81i 1XPUA 1QUQB 4A3IG 4DV0Q 2HF1A 3FP9A 1VQ7A 4X66L 3U50C 2JA7H 1TXYA 4JI8Q 1QUQA 4L5RC 1GVPA 1HNWL 3S1NI 4A3JH 3STBD 4A75A 2KENA 4NXML 4B3MQ 2WP8J 3S1RI 4JBMA 4LF9Q 2ALYB 3GTJH 2E5LQ 1X54A 3CCLA 1GO3E 1VQMA 4QQBX 4IFDG 4RG1A 5C4JH 1WOCA 4DR7Q 4Y7NI 1I50I 4NBAA 2B29A 4L5TA 4IFDI 4HJAA 1YHQA 2E2HI 3Q87A 3CC2A 1XMQL 1IXRA 4QL5A 2CFMA 4X65Q 3CF5A 1EIYB 3M3YH 3DLLA 4IPCA 3PO2G 2OTLA 4K0KL 4JC0A 2C35B 4DV5Q 1HNXQ 1GM5A 5IP7H 5IP9G 3S1MH 1Q46A 1WJJA 1HR0W 2PK7A 4XX2A 1YVCA 5IP9I 2PQAB 4NB9A 4B3RQ 2NVTI 4DUZL 4JOIC 1K73C 1XMOQ 3CQZH 1PH2A 2PNHA 4GKKQ 4A3JG 2NVXH 1SE8A 1ZB9A 2R92H 4DK3C 3KOJA 2HIXA 1B7YB 2B63H 4HJ9A 3D0FA 1E3PA 4BY1I 3H15A 1SRUA 3D31A 4HJ5A 5JJIA 3HOZH 1PH7A 3RZDH 1VQEA 4LFCQ 4PG3A 3RLOA 5IP7G 1N33L 2WAQE 1YJNA 1E7ZA 1PFSA 5M5XH 2AWOA 4NBGA 2I5LX 4A3FI 2IX1A 1VCIA 4DR2Q 1G291 5M5YH 1X6OA 4O0AA 4LF5L 3HOYH 4AYBG 5IT9c 1PH6A 5ELNA 4JI8L 1E1OA 1UE6A 4DR6L 2D0OA 3PV0A 3RZOI 1O7IA 2HHHQ 4YWMA 4GN4B 4JYAQ 1U5KA 3VMHA 4Y52I 4IJHA 3B6YA 3GTQI 4B3ML 1TWCI 1XPOA 4X6AI 3RN5A 3CCMA 4LF6L 2B63G 1KD1C 1PFTA 5AJ3Q 3E9HA 1A63A 4DR7L 1KAWA 2WFWA 5C3EG 2YTXA 2K5RA 4BBRG 3HOZG 4LF4L 1N32Q 1LUZA 3GTMI 1KRTA 5C3EI 4BBRI 1YNXA 2JQOA 1FVIA 2XTIA 1MJEA 3CD6A 3U58A 1VQAA 1I94L 3ULPA 1HNXL 4PZ6A 4GKJL 1KRSA 2D62A 2MQHA 3S1QI 1W3SA 2NN6I 2RHQB 3AFPA 2UXDQ 3HOYG 3PUWA 1CSPA 3EN2A 3GDEA 4HJ7A 1TFIA 3S15I 1T9HA 1XMOL 4AH6A 1I6HI 5GAEC 1SN8A 3H0GH 3UDIA 2VW9A 4DV1Q 1CUKA 1Q1BA 4LF7L 3JAMc 3JAMi 2NVYH 5JEAG 4J15A 2Z6KA 3CCJA 1X9NA 3I7FA 1K83I 1VQKA 2K50A 3HOVH 3TRZA 4A3LI 4DPGA 1KL9A 1VQ6A 2JEBI 4QIWE 4YWLA 2JA6I 3TS0A 2B3GA 4JI6L 1N8RC 3TQYA 1PH4A 5HY6A 4YHHQ 3M4PA 1N34L 2Z0SA 4P71A 4LFCL 3HOUI 2YU9H 1CKNB 5IYBH 2UUBQ 2K14A 4POGA 3LGJA 2JA9A 4A3BH 1RIPA 2VZAA 2UXBL 2WB1G 3UE1A 4LUOA 1Q12A 1U0LA 3M9BA 2J6AA 2NVQI 1CKNA 2Q2IA 3T1HQ 1NY4A 3S17I 1SFOH 4JI7Q 1UEBA 1Q86C 3CW2C 1FL0A 3KJPA 4JYAL 1ML8A 3S2DI 4C3JH 4GN5A 4YWKA 3HOWH 1X56A 4LF8L 2IHFA 1X3EA 1G6PA 2PI2A 2CCZA 4GOPB 1Q7YC 3AEVA 4H02A 3E0EA 1EOVA 3CPWA 3H3VI 2Y0SG 2F4OA 1CSQA 1N36Q 3GD7A 3PUYA 2CWAA 3S16H 5IYBG 1E22A 4GNXA 1PH5A 4A3BG 1EQQA 2HQLA 4GLAC 1H95A 5CM2M 1A62A 3CP0A 1VQ5A 4X66Q 2BA1A 2JK8A 4ME3A 5IWAQ 4DR3L 1S72A 1WCMI 3I4MI 4OX9L 1MKHA 1QYPA 1HNWQ 4HIKA 1LTLA 4IFDJ 1J5EL 5EAYA 2OCEA 4NXMQ 2BJOA 4YCWA 1TWFH 3GTLH 4A3GI 4NBDA 1UE1A 3D6WA 3ULLA 4BXXI 1UE7A 2K4KA 3ER0A 3I07A 1VQPA 2VQFL 1X3FA 1YI2A 2OQ0A 1R9TH 1W2BA 1WI5A 1XMQQ 2E2JH 3HOXI 5IY0A 2JA5H 3RLNA 4DNIA 4TVAB 2K52A 1L1OC 3PO3H 1TWHI 2Q2HA 4POFA 3ESWA 1USPB 1K8AC 2BH2A 4DK6C 1PYSB 2VUMH 3I2ZA 4JI0L 1TWGI 1BVSA 3VMGA 1HJPA 4DUZQ 4DV3L 3T1HL 2VL6A 3K81C 2RBLA 2CWPA 2K75A 3CCQA 3MXNB 3CPFA 2AWNA 3S14I 1RLYA 4JBWA 2YTVA 3OYYA 2OQKA 3GKQA 5GAHC 3DM3A 4LUVA 3CAMA 1XNRL 1HZCA 1KC8C 1TWAH 4R1JA 5C4XH 1HZ9A 2VQEL 2JA5G 1D8LA 2PI2E 2EQSA 5LMNQ 4A3EH 3TREA 1X3GA 1VQDA 1N33Q 2E2HH 3KF6B 3J80c 3J80i 3NELA 2DUDA 1EIFA 2VUMG 1YIJA 4LF5Q 4A3II 4DAMA 2RCNA 3LUSA 3KF6A 5IWAL 4DR6Q 2N3SA 3KYHC 4FDBA 3SGIA 1IBLL 4LF6Q 1C7YA 3F1ZA 3F2DA 2UXCL 3FKIH 3GTGH 1I3QH 5GAGC 2R7FA 3M4OI 1NJIC 4LF4Q 2F52A 5C4XG 4R4CA 4A3EG 4JG2A 5K36G 2A19A 1I94Q 4JI1L 3BU2A 2R6GA 4GKJQ 3PO2I 4IOCA 2L15A 1KQSA 2ZM6L 2CKZB 2YV5A 3BZKA 1DGSA 3KDFB 2JA7G 3I4NH 5M5WH 4A3CH 2VS1A 2JA7I 4P75A 1YEZA 1QVGA 4XIGS 3F2BA 2UU9L 4LFBL 3KDFA 1HH2P 4NOZA 3AFQA 5C44H 4JOIA 4A76A 1M90C 3TS2A 4A3JI 4LF7Q 4BA1I 3CCRA 1PVOA 3GTOH 3CCSA 4L5QA 2KPIA 3UDFA 4HIMA 3GTJI 4UP7A 2EIFA 1PH1A 2R93H 1EYGA 5C4JI 4PZ8A 3NENA 2GVAA 4JI6Q 1HZBA 2JA8H 1CKMA 3EERA 1N34Q 5LMNL 1ZB8A 3M3YI 3A5ZB 2PMZE 2UXBQ 1VQFA 1Y1VH 1N9WA 3KF8B 5IP7I 1OXXK 3I4NG 1YBYA 1HNZL 3S1MI 2LXKA 2JE6I 3PIOA 5FLMH 1BBWA 4A3KH 4NBHA 3K7AH 4ALPA 2UUCL 2ZJRA
chains in the Genus database with same CATH superfamily
4AYBE 4CHTB 5ELEA 3CCMZ 3CC71 3H3VJ 2IJ0A 3JAMb 1VLAA 1KQSY 2DY8A 3VDYA 5CORA 3CQZI 1PFMA 2DJFC 5C44G 2R92G 1VQL1 4DV4L 1WTWA 2A1AA 3ZYYX 3S15H 4ME5A 1KC81 5ELOA 1SIWA 2VY3A 4DR4L 2BH8A 2WKCA 1ASZA 2NVXI 1VQ8A 4YY3L 4KHPL 1VQOZ 4LF8Q 2R92I 1Q7Y2 1SYEA 2EGTA 1BO0A 5LMUL 1PRTF 2Y0SA 3PO3S 1RJTA 2QEJC 3D4WA 5I9PA 4M1UB 1XNQL 4K6DA 3CC41 1FGBD 3MONA 3A7AB 1QVGY 1SNOA 2B63I 2R93G 4NFRA 4CDDC 1I4QA 3OOCA 2AQ1B 4R9WA 1NAPA 1KDCA 4RVGA 1WCMB 3I4MB 2R7ZB 1VQBA 4A3DH 3I56Z 2B2WC 5I6WA 2Z6BA 4DF7A 1G8ZD 2JA8G 1EWIA 4P74A 3HOZI 3W5OA 3P5JB 3K0YA 2TSSA 4B08A 3RZDI 5K5PA 5CGKA 1VQ71 2QLVB 1M1KC 1OXVA 2E75C 5JJLA 1VQIA 1YHBA 5BN3A 4A3GB 2OWOA 1G51A 5D65A 1YIT1 1BCPC 3GO5A 2K5HA 2V45A 1U4PA 1EY5A 4XQJA 1E2ZA 1ICWA 3J7ZC 2O5JC 3IRBA 4AQYQ 5FLMG 3AQQA 3GTPH 2SEBD 3G4S1 2M6NA 4C3HB 3L7ZC 5GQOA 2TMPA 2L1BA 4DR3Q 4RCNA 3PF4A 4OX9Q 1OXTA 2F0QA 2FHTA 2ICEC 4E2ZA 3HOYI 4A3MH 3V2TA 3HOXB 2ZTEA 4QUCA 2AQ2B 3Q23A 1J5EQ 5CV9A 4JI3Q 3ND9A 1YJWZ 2OTJ1 4C2MB 1P16A 2IW3A 2KEDA 4FXGC 3CCJZ 1TWHB 5CBEE 3GTKH 2ZT9C 4BY7H 3K5LA 1Z03A 3TN2A 2ZJPA 1NJI1 3KJOA 1CKOA 2LSSA 1UWVA 1V8QA 3S2HH 2LS01 3CCVZ 1Q8IA 4RFBA 1I4XA 2Z9HA 2N78A 4DAPA 4OO1H 1H9KA 3ICEA 1HXYD 1TWGB 1AFPA 2A8VA 2B2YA 5EJWA 2VQFQ 1JQYD 4Q5VA 2VPWA 2XNAC 1FDOA 2R6MA 1I5FA 2K5QA 4R4OA 5CYUA 5CV8A 1ASYA 4PMWA 2HT1A 1EIGA 4DV6L 3S14B 2E9HA 1SXTA 1EU4A 2XSCA 4YCUA 1SE2A 4XDXA 1BBXC 3A54A 4KY7A 1U9RA 5C0XJ 1K8A2 4PZ7A 4H44C 1BOSA 3ITPA 5M3FB 2ZJQA 3OHXC 2D2CC 5GROA 3F3PC 4IOAA 4C1NI 5D3DA 1DZ1A 4KY5A 2MO1A 4CKCA 4A93H 1KLUD 1EQRA 1QG7A 2AUJD 1DM0B 4JI0Q 2DGYA 1Q16A 1SE4A 2WB1E 1M901 1VQHA 4BS9A 5CV6A 2QKIC 4N9TA 4DV3Q 3S24A 2K04A 4WJ4A 2O2LD 5M3MB 1VS0A 3HKZG 3CCE1 3PCOB 4A3MG 2F0UA 1YJ9Z 4MZ9A 1UNSA 3H0GG 1F2MA 1PA6A 1QVFA 4HGZA 2QA4Z 2MFIA 1PZKD 1B9NA 2WV6D 4K6LA 1JB3A 2R7ZH 3H0GI 1C0AA 1FYCA 4MNOA 1XTCD 2A5HA 2QEXZ 4NBBA 1IBML 1EUJA 1T5XD 2IZ3A 1WTXA 3G48A 4OO1G 1KC82 3MZ5A 4U68A 3BS1A 5LL6S 2NVYI 3G6E1 3NH5A 1G2SA 4A3IB 4DV2L 5DNFA 1XNRQ 3HOVG 1AN8A 1FGUA 4APVA 3HEJA 5IGEA 2BE5D 4GNXB 3FEWX 2FMMA 3PUZA 3BVZA 1WTOA 1Z6HA 1TY2A 1WD0A 3HOVI 3P7JA 2ZAEB 1J8IA 4P2CB 1EQVA 2VQEQ 2XWJB 1YJN1 1QZHA 2F0KA 2Y0SE 2GN5A 4IO9A 5IT9E 4X64L 1HCZA 1CK1A 2CQOA 3W2DA 1GUOA 4C1NK 5BR8L 5LL6f 2K5VA 4AIMA 1BUVT 1HTLD 3I4OA 3NBIA 1Y8OB 3D4RA 4GOPC 2YU9I 4DR1Q 1K3RA 1EYDA 3TZDA 2E2IH 4A93G 1S3OA 1D2BA 4UP8A 1S72Z 5COYA 4Y7NB 2ZXRA 3O13A 1CQFA 4NKLA 1PHJA 4A3BI 3L2PA 1ESRA 1JOKA 2MJ8A 1SYCA 2J4XA 4TQUS 4AQYL 1IZ6A 3M4YA 1GHJA 2LIYA 4YCVA 3FHWA 1QNUA 1A6XA 3M4OB 4A4IA 2RKSA 4B3TL 1QXFA 1X55A 2K28A 1PTOC 1C8CA 1DONA 2EYHA 4BBSH 4RGMA 2P3YA 1IHZA 2Z4HA 3JC66 1WYDA 1QZGA 2NAPA 2A68C 4JI4Q 4JI3L 4WORA 3OMCA 1SFOI 2I5MX 1JJ2Y 2IPKD 5C0XH 1JORA 1IBLQ 3PO2B 3HOWG 2G9HD 5ELDA 1VQO1 1S4ZA 2JYOA 4C3IB 4OL7A 3KIFA 4OWWB 4FVMA 4HSPA 2UXCQ 1Z9FA 1QOHA 1EEID 1B44D 1FD7D 1LYLA 2A6EC 1W2BZ 4NDXA 1NJI2 3HOWI 3CXCA 4KN4C 2N49A 3GTMS 1B8AA 5M3FH 2KECA 3PUXA 1Y1VS 3VA5A 5I4DA 3PIPA 5J3BA 2DE6A 2JA7B 3K59A 4KHZA 1QVFY 5FLXL 4TKOB 4RVFA 2I3CA 1Y1WH 2EDGA 3I561 3QJYA 2EXDA 2JIMA 1Y14B 3OTOL 1WTPA 2E8GA 3J81f 1EY4A 1IBKL 1P9NA 5E1FA 4DAYB 4L5SA 2Z8LA 3GCFA 3G711 1EYCA 5T67A 2JS4A 3EIVA 1PYBA 3J80b 2F4VL 3M85A 4JI1Q 2L9HA 1D5ZC 4A3JB 1IL2A 3K0XA 4FO2A 1PV4A 2ZM6Q 5IODA 1QJOA 3IKJA 3S16I 2RDHA 2CQAA 1LTRD 1NR4A 1BBUA 2KOLA 1Z7TA 4MH4A 2V8IA 3GTJB 3Q8DA 1L1OA 1SNPA 1KLGD 1AH9A 1RQFA 4NXNL 1X3WA 3JAME 5C4JB 2DE5A 5FLXb 1G91A 2JIRA 3CCUA 2WACA 1PRTD 4X3KA 2ATWA 1MJCA 4O1NA 5DLQE 2M9VA 4HN7A 4BBSG 1M902 4JVZA 1SMXA 2UU9Q 4LFBQ 4TSSA 2F03A 1Q81C 1LABA 1YJW1 1FJGL 4X62Q 4XQNA 2EYFA 3D9XA 3J7A5 3M3YB 1WTVA 2RF4A 2AQ3B 1J6QA 3SK6A 4ZKCB 3CMAZ 2L11A 4NH1C 5DEHA 2A6HD 1EOTA 4NBEA 1AW7A 3W1GA 3ZJYC 3M7GA 1VQ9Z 1HA6A 2AMCB 1TWFI 3CCV1 1NUIA 1AE2A 2KCTA 1KDAA 2EY5A 4N8FA 3SR1A 4RMFA 3S1NH 3GTLI 4EQ5A 1L0XB 1QWYA 4FXDA 1EL0A 1JR0D 1JMCA 3S1RH 2F3IA 1WW9A 3N6RA 2NTTA 4HH4A 5I9OA 1ENFA 2K33A 3NBHB 5I2YA 3BZCA 3P75A 3BDLA 3RUZA 2AHOB 2JN4A 3CC7A 1DYQA 4AYBB 3T53B 3TDQA 4Y7NH 1I50H 1R9TI 4GZYC 3TP5A 1VQLA 3CQZB 1RKNA 4S1TA 1X3PA 2E2JI 1I4GA 1QCBD 1T5EA 1Z47A 3PUVA 2OT2A 4EVOA 1DL6A 3PO3G 4IFDH 2K5WA 2G9DA 1TWCB 2JA5I 4IUQA 3NBHA 2NVXB 4KMUC 3OW7A 5FKAC 1KXLA 2MPMA 3PO3I 3PF5A 2XGTA 1Q861 4DR1L 1R4QB 4E30A 4IUNA 4DNRB 4G4KA 3CC4A 3OW2A 1G6ZA 1HNZQ 3NTKA 3IAYA 3DUZA 1KNEA 2R7DA 4K5WA 3BJUA 2B63B 5G3LF 1MHWC 2VUMI 1NR2A 2UUCQ 1ZXTA 1YJ91 5C3EB 2UUAL 1VQGA 2XRQD 4BBRB 2B2UA 5IP9H 3HOZB 5TSSA 5FLXc 2BDOA 4G57A 2QA41 4DV4Q 4NB8A 5I2XA 3MA2B 1E24A 4JI4L 3RZDB 2RSNA 2NVTH 5AN9F 1VQMZ 1EZ8A 4DR4Q 2F0EA 5LMNW 4YY3Q 4KHPQ 2H1EA 1YITA 1H9MA 3E3XA 2QEX1 1YUAA 1I4HA 5LMUQ 4I7AA 1OXUA 1JJCB 3HZXA 2F0DA 3VR3A 1XNQQ 1EEFD 3CC2Z 4CBVA 3G4SA 5M5XB 2M00A 4R4IA 3G7LA 5JVH3 3C2PA 4IPHA 3IR7A 1SNCA 5M5YB 4KI0A 3HOYB 2GVBA 2IL8A 3DWAA 3RNUA 1HR0Q 4WRDA 1I6HB 5CMDA 1JWHC 4B3SL 1AP0A 1WFQA 2E74C 1PDQA 1M1K2 1VQN1 3E5SA 2OTJA 1PMRA 4EGVA 4BY1H 1AE3A 1LLRD 5EKLA 4EQPA 1TWAI 4MD9A 5C4XI 3BDCA 4OXPA 1Y8NB 4E2YA 4A3EI 1GUSA 3I70A 3GV6A 3MZKB 2A73B 3KLSX 4DK0A 3K5OA 4HCEA 2RSOA 5E4XA 3T4AC 3PMFA 1F9QA 5JPMC 1S721 2OOXB 2FJ2A 1Q1EA 4J6HA 3TSSA 1IYJB 1ET9A 1TKWB 2ZJRA 4DV7L 2YYZA 1LTSD 1AZPA 1H9SA 4I7ZC 2QDBA 5GADC 5FJ8H 4LFAL 2RDGA 1GKHA 1OXSC 3GV3A 5JEAJ 4A3FH 2HDLA 3ULJA 1EFID 2LY7A 2N8NA 2B2VC 3UI2A 3URYA 3S9WA 5ISRA 4LW1A 4P73A 4KJOA 4X62L 3TEHB 2MNAA 2QF7A 4MTNA 4QTUA 3OW2Y 2XWBB 3EQLC 1DOKA 3A74A 3RZOH 1V43A 3R2IA 5ELFA 1F9RA 3A8KE 1UE5A 2LKVA 2FFKB 1X3QA 1JJGA 1GD7A 3FKIG 3CMEA 2VB2X 2ZTDA 4Y52H 3GTQH 2WB1B 1EY8A 1TWCH 4K5VA 2NZHA 4X6AH 2PQAA 3FKII 3GTGI 3AB9A 2EPBA 2E76C 3CCEA 1HZAA 2KQ3A 1I3QI 1SR3A 1JOOA 1RL2A 4GN3B 2PZTA 4DV6Q 2F0MA 4E6IA 4EQOA 2PZUA 1NTGA 5A2Qb 1SSOA 4BY1G 1BCPD 2JEAI 4B9WA 4RGNA 4QGUA 3STBC 1K8GA 3K6OA 4DUYL 1A2UA 3E9IA 4DFAA 4GLXA 3T1YL 3H0GB 2M2LA 1JT8A 4KKTA 5E7NA 3GTMH 2YTYA 4RA8A 2Q2UA 4UPAA 2J7ZA 3BZDB 4XT1B 2OEOA 5C3EH 4FP5D 1NUCA 4BBRH 1RF2D 2NBFA 4K2LA 3G6EA 4JI5L 3HKZA 2NVYB 3HFZB 1TR5A 4KLKA 4A3CG 2WAQG 2OXPA 4JI2Q 3VYSA 1A0IA 1UAPA 2L12A 3QIAA 1ICFB 4EQNA 2QGQA 3I4NI 5DM73 3HOVB 1WD1A 5FJ8G 4A3CI 3UDGA 4OWTB 3U9OA 3NDIA 4OIKA 3ND8A 4A3FG 3S1QH 4DR5Q 2NN6H 3ONAB 4NB3A 1VQ8Z 2X6GA 2Y0SB 2GTIA 4QF4A 4RGTA 2F0SA 2JJQA 4DV0L 4X3TA 2B2TA 3UDXA 1HUMA 3IF8A 1TY0A 4RHRA 2JUBA 2MUYA 3CMA1 5EQ0A 3F2CA 1B53A 1X32A 4J8QA 1Q82C 3T56B 1I6HH 3I90A 1VQ91 4S3SA 5C44I 2YU9B 1IBMQ 1O7LA 3H3VC 1V9PA 2KHJA 1K3BC 4A3BB 2EOTA 3GTOI 1Q8KA 4DV2Q 4L6TB 2NB0A 4IPDA 1K9MC 1V1PA 1VDZA 1VQJA 1GJXA 2VXWA 1NBWA 2E2DC 3WOFA 3J80E 3F8TA 3CD6Z 3I551 3MAQA 1PH9A 5JJZA 3MZLB 1AZQA 1K8MA 3BG3A 2R93I 4K5XA 4LF9L 3I8ZA 1HR0L 1K83H 5IGFA 4FF2A 2E5LL 3HP3A 4O2DA 4DXGA 1JWUD 1Y69U 1GHKA 1HHVA 1B1ZA 4IJLA 4X64Q 4A3LH 3Q24A 1SFOB 1E1TA 5FO8B 5BR8Q 3FRPB 1PH8A 2JA8I 2DE7A 2O4HA 1VQOA 4DNTB 2JA6H 4EWCA 2QRCB 2K5NA 5C3WA 1B50A 1Y1VG 2K5DA 4C3JB 2IT1A 4KY6A 3KLRA 5FLXE 1HTPA 3ERSX 3CKIB 1PZJD 2KBNA 2PYKA 2AKLA 1Y1VI 4WJ3M 3HOUH 4X65L 5KGUA 4LMQD 2BCOA 4A3KG 1II3A 5IGGA 3MTSA 3DWPA 4B3TQ 3I56A 4K14A 1LM0A 2PW7A 2NZOA 3GP7A 1HQMC 5FLMI 4DV5L 3L0OA 2NN6G 4MTKA 3G71A 4A3KI 1B70B 2CW0D 2KHIA 3MHBA 4DAVA 1F2LA 5AFWA 5C5LA 3K7AI 3CCL1 1SLJA 1L0WA 4JBJA 1LT6D 2JNYA 2NUCA 2NVQH 2D9UA 3P20A 4RVHA 2ID0A 1N2FA 3S17H 1VQM1 1LTAD 1PFBA 2P28A 4HGYA 1ZKOA 4B3RL 1MD2D 1TS4A 1D7QA 1VQKZ 3VYTA 2D0PA 1TU2B 2HD3A 1VQ6Z 1YHQ1 3C46A 4F87A 1STNA 3CC21 1X65A 2OF1A 4GS3A 3S2DH 4GKKL 4EX5A 4NBFA 1M4VA 3I72A 2ES2A 2Z6KC 3K57A 4RGOS 2Q2TA 2OTL1 3MEFA 2F0PA 4C56C 4G7ZC 1MIUA 1VQCA 1EWHA 4A3DG 4FYDA 1KDBA 4LNQA 1PXUA 3IFUA 2B2YC 2HCIA 3OTOQ 2RCFA 1IBKQ 2CH4W 1YJWA 4OONA 3SVMA 2ASBA 4A3LG 2HU9A 5G3LD 3NFZA 4A3DI 1CHQD 1LT5D 2F4VQ 4UP9A 3H3VH 3TBIB 4K2KA 2JA6G 1XPRA 3E0JA 2IHEA 1Z02A 3CCVA 3HKSA 1EY9A 1TWFB 3BYYB 2V4DA 5IE8A 1JC7A 3GTLB 1JJ2A 4BA2I 3VTNA 2H4OA 1Y8PB 3OMGA 1PTOD 4JBKA 3TDHB 4DGZA 4OWXB 3HOUG 4NXNQ 1G2TA 5IGBA 3T13A 4DQYB 3J7AF 1JE5A 4JI2L 2A68D 1D6EC 1LV9A 2IZ4A 2JSOA 2ZXPA 4XXEA 2Q8RE 4OIJA 1SJED 2RA4A 1Q812 4QJFA 3NH8A 2R61A 3L9AX 3GTPI 5HGQA 1R9TB 2GA4B 4LUZA 4DR5L 2KCMA 1DCZA 4QTTA 2E2JB 1IKLA 2A6ED 5D3IB 1FJGQ 3HKZE 2B8FA 1VMPA 4R4QA 3BG0B 1JE4A 1XTDA 4A3MI 3CRLC 1FDIA 4BY7G 1CT1D 2JA5B 5FO7B 1XJVA 1WCMH 2IX0A 1Q3LA 2BDNA 1Y8CA 4DR2L 3I4MH 2Q51A 1VF7A 2HIVA 2RHSB 3GTKI 4BY7I 2AKWB 3CPWZ 1PH3A 3LWEA 4ZUIA 4NP5A 2LFNA 3X3NA 3S2HI 3LX0A 2HHHL 3UE0A 1WVLA 4K8IA 1P8LA 1MI2A 5H1SE 2VUMB 3BG1B 1V1OA 4OO1I 4IUTA 4A3GH 1YJ9A 1KIXA 4H13C 3TMEA 1C48A 4QB4A 4BXXH 1RODA 1PYWD 3HRZC 1LQLA 1RCVD 4UHVA 2BA0A 2QA4A 1VQ4A 1L2FA 3TE5B 4IURA 5JJKA 3Q22A 4P72A 4JV5Q 5FK9C 5AJ3L 4TNUA 2LFUA 1VQ5Z 4RAUC 4C3HH 1EFWA 3OPOA 3K7UC 1O78A 1IKMA 4L8JA 2QEXA 1EQTA 1SYDA 2I0QA 4HAEA 3HOXH 1X3ZA 4GNXC 5JOBA 1CHPD 4R4TA 1N32L 3QOLA 1W6KA 4LWCA 1RO4A 4JCVE 4C2MH 2W04A 3KK7A 3NWSA 1TWHH 2F4MA 2F0VA 5DAUA 3MWYW 2PO4A 4A93I 3K80C 4GOPA 3K8AA 4PV1C 2MO0A 5IYDH 2PPBC 1Q821 4RWSC 2JR6A 4QY7A 2UUAQ 1VQNA 3TP8A 3RR5A 3VB9A 1VQ81 1CFMA 3CCM1 2QCPX 1TWAB 1TWGH 5C4XB 4HR7B 1M8AA 3PIO3 1WCMG 1K0RA 1MBYA 5EBDA 3I4MG 4A3EB 3CXCZ 2CHBD 3MVVA 2L4NA 3SHLA 2R7ZG 1SROA 5NUCA 5J22A 2UXDL 1VQPZ 1JB7A 3S14H 2NTSA 3DEPA 1YI2Z 2R7ZI 1A15A 3J81L 5KRUA 5M9OA 3M7NA 1HQRD 4CDFC 1A8VA 3EBEA 1CA5A 5A2QE 3AYHB 4A3GG 2IWHA 5IYCH 1M1K1 5KEEA 2LXJA 4BXXG 3CD61 3A5UA 4DV1L 2PZWA 4B3SQ 4H0LC 4GLVB 3WWVA 1HRJA 1B2TA 1L1OB 2VNUD 2KJXA 3KLWA 4C3HG 1L0YB 1W6JA 3HS0C 3C1EA 3CRKC 3CU7A 1PZID 4XTCS 1ESFA 5M3MH 3OWFA 4LJZC 3HOXG 2N88A 2V1CC 4M8AA 2BOSA 1QVCA 1YZ6A 2XVSA 4NBCA 3J81b 1U4MA 3CCUZ 3TP6A 1A2TA 1KHIA 3RLFA 2KEEA 2FXQA 3MFYA 2WINB 3CCQZ 4NPSA 2E2II 1NMFA 1V1QA 4DV7Q 1WTRA 4K0KQ 3FKIB 3GTGB 1RHPA 2PNRC 5IYDG 4OGQC 3PSIA 2I5HA 3H94A 4YHHL 2ENBA 2MP1A 2KCNA 1OTCA 4LFAQ 4HJ8A 1S7MA 4IPGA 2F0IA 4ZRZA 3Q0AA 2UUBL 1NE3A 1D5MC 5KNCA 1SYFA 4TRDA 4A3IH 1BR9A 4DKAC 1BF4A 5C0XG 2A69D 3CCJ1 4BBSI 4RHSA 1TT2A 1JWSD 1GOZA 3BDOA 1VQK1 3H09A 3VR2A 3KFUA 5C0XI 3J81j 3A0JA 1USPA 1VQ61 1EU3A 3QWNA 4UAIA 1ENCA 3S1MB 1I6VC 5M3FG 4JI7L 2SOBA 2F0NA 3U4ZA 3W1BA 2H85A 1S40A 1NMGA 5IYCG 2EYPA 2F4IA 3I4NB 3RN2A 1C9OA 5E3FA 1YNNC 2ZTCA 4IALA 2MGSA 5M5WB 2WAQB 4UY8C 1Y1WG 4ODGA 1AA6A 1YNJC 4ZLTF 3NEMA 3MXNA 3M4QA 1Y1WI 3PGZA 4DUYQ 4CL1A 1K28A 3T1YQ 2IY5B 1BKBA 3M4OH 3CMAA 4JV5L 5M3MG 3NSWA 4KV6A 1VQ9A 1YIJZ 2WAQA 4RS4A 2N55A 3SDZA 1QB5D 5C44B 2R92B 4KK7A 3VMIA 1YHAA 1GUGA 4JI5Q 1S5BD 4MN3A 2H5XA 3GTOB 2V8KA 4F88A 2WIIB 4HIOA 1N36L 1BQQT 3PO2H 4HIDA 3I55A 3J81c 3U4VA 4C3IH 3J81i 1TIID 1HFNA 2X6LA 1XPUA 2R93B 1A3TA 2CH4A 2DNEA 3I91A 1QUQB 3GQBA 5EPJA 1EIHA 4A3IG 4DA2A 4DV0Q 1Q822 2RQXA 2HF1A 1STAA 1PRTB 2EYMA 2F0LA 2JA8B 3FP9A 1VQ7A 4X66L 3U50C 2JIOA 2JA7H 1TXYA 1SAPA 4ZK9B 3G4SZ 5A35A 1YUKA 4JI8Q 1K9M2 2QDLA 1QUQA 3EA6A 4L5RC 1GVPA 4FF4A 1K0SA 3VR6A 1HNWL 3S1NI 1F9PA 2K05A 4ZCKA 2R3ZA 4A3JH 1RTOA 3STBD 4A75A 2KENA 1E2WA 4NXML 2K03A 4B3MQ 2WP8J 3S1RI 1HFGA 4JBMA 3HG9A 4A3KB 4LF9Q 2ALYB 3GTJH 2E5LQ 1X54A 3CCLA 1KQSZ 1GO3E 5IT9L 1SJHD 3DHQA 1VQMA 4QQBX 1XWEA 4IFDG 4U673 4RG1A 5C4JH 1WOCA 4XT3B 4Y7NI 1I50I 4RCOA 4DR7Q 1VQ51 2DY7A 3Q6SA 4NBAA 1LTTD 3I4LA 2VF1A 2F0FA 2B29A 1H9SB 4L5TA 4IFDI 4ILWA 4HJAA 1YHQA 2JIQA 1OO9B 2E2HI 3Q87A 3CC2A 1S5ED 5IT9f 1PLFA 5EKKA 1XMQL 1TS2A 1IXRA 4QL5A 1ZYRC 2CFMA 4X65Q 2C5CA 3CF5A 1EIYB 3DLLA 3M3YH 1QVGZ 4IPCA 3PO2G 3HGBA 2OTLA 4K0KL 1F2YA 2DJGC 4C3IG 3D2LA 4JC0A 2C35B 4DV5Q 1HNXQ 4O42A 2AUKA 5IP7H 1GM5A 1HUNA 1CA6A 1SMYC 1ZH1A 5IP9G 3IFTA 3S1MH 5IT9b 4A3DB 3MXPA 1Q46A 3CCRZ 1H9RA 1O80A 1WJJA 1HR0W 2PK7A 2PW5A 1ENAA 4XX2A 3CCSZ 1YVCA 5IP9I 3CMEZ 2EYLA 4NB9A 2PQAB 4HMIA 4B3RQ 1KABA 1SYBA 4N9PA 1VQP1 3SEBA 2NVTI 4DUZL 1SBBB 4JOIC 1YI21 1K73C 1XMOQ 3CQZH 1PH2A 2PNHA 4GKKQ 5KNDA 4A3JG 4R8NA 2SNSA 2W03A 4JK1C 2NVXH 1CZGA 1SE8A 3VR5A 1ZB9A 1S5FD 4F8MA 2R92H 4DK3C 3GTPB 2PQEA 3KOJA 4HTHA 2HIXA 1B7YB 5EPKA 4XQQA 3VR4A 3HKZB 2B63H 4A3MB 1KRLA 1UUPA 2V3VA 3W3AA 4E33A 4FF1A 2VUGA 4HJ9A 3D0FA 2PCFB 1E3PA 4KD4A 2F1MA 4N8X1 4E31A 3PIP3 4BY1I 1D1IA 1F77A 4KKUA 3H15A 1SRUA 3GTKB 2FINB 1B3QA 3D8GA 4CJ2C 3D31A 3OWEB 1LT4D 4HJ5A 1HA5A 5JJIA 2F0OA 3AMUA 3HOZH 4XYOA 3S2HB 1STYA 1PH7A 1Q811 3NTIA 4I65A 3CCQ1 3RZDH 2EY2A 1VQEA 3JAML 4IQZA 4LFCQ 3R3OA 2JMOA 2PM9A 4PG3A 2G2KA 1XX8A 3RLOA 5IP7G 1N33L 2WAQE 5D1OB 4KKSA 2NZ1D 1YJNA 1E7ZA 2GTHA 3K58A 1PFSA 1IW7C 5M5XH 4X3SA 2AWOA 3JAMf 4NBGA 1DOLA 2A74C 2I5LX 4A3FI 1V1PB 5IIFA 2IX1A 3EEDA 1VCIA 4DR2Q 1G291 1RTNA 5M5YH 1X6OA 3EVQA 4O0AA 3WOEA 4LF5L 1LTBD 3HOYH 4AYBG 5IT9c 1PH6A 5D1OA 5ELNA 4JI8L 1E1OA 1UE6A 4DR6L 2D0OA 3PV0A 3RZOI 1STBA 3J7A4 1O7IA 2F0GA 2HHHQ 1AEXA 4YWMA 4GN4B 4A93B 4UDUC 5E4WC 4JYAQ 1U5KA 2M48A 3VMHA 2I07B 4OELB 4QUFA 4Y52I 4IJHA 3B6YA 3GTQI 4X3UA 4B3ML 1NSNS 1TWCI 1XPOA 4X6AI 3RN5A 3CCMA 5CV7A 5T6BA 4RKLA 5LHY1 2RPRA 4LF6L 3F3FC 2F0JA 2B63G 3F2UA 5JEAH 1KD1C 1PFTA 5AJ3Q 3E9HA 1A63A 1U4LA 1RDPD 3J81E 4F7XA 1GXDC 2ZXOA 4DR7L 2P5ZX 1A3UA 4B9XA 1KAWA 2B2WA 5EKIA 1YIJ1 1BCPB 2WFWA 5IGCA 5CV4A 5C3EG 2YTXA 2K5RA 1WIIA 2O53A 4BBRG 3HOZG 2RIQA 4LF4L 1N32Q 1J9OA 1LUZA 3HOWB 3GTMI 3EJIA 2F3WA 1KRTA 5C3EI 4DU9A 1FNVA 4BBRI 3G71Z 5J1ZA 4MHEA 4CKBA 1YNXA 2JQOA 1FVIA 5C4ZA 2XTIA 1MJEA 3CD6A 1EZ6A 3U58A 3X3MA 1VQAA 1I94L 3NXWA 3ULPA 5EGTA 4MD7A 2YADA 1HNXL 4PZ6A 4GKJL 1DXMA 1KRSA 2D62A 3MXGA 2VB3X 2MQHA 1GUTA 3S1QI 1W3SA 2NN6I 2RHQB 3AFPA 2EJGC 2EY1A 4H7BA 4PQXA 2UXDQ 3HOYG 4PMBA 3PUWA 1CSPA 3EN2A 3S16B 3GDEA 4HJ7A 1TFIA 4MONA 3S15I 4IUUA 1T9HA 3EROA 1XMOL 4AH6A 1I6HI 5GAEC 2E2IB 2K7VA 1LACA 1SN8A 3H0GH 3RD4A 4LK1C 3UDIA 1JCKB 4RV9A 2VW9A 1STHA 4DV1Q 1NCVA 3TZUA 1CUKA 1S5DD 1RO0A 1Q1BA 1QILA 3JAMc 4LF7L 3JAMi 2NVYH 2L5TA 3L3OC 5JEAG 4ZUJA 4J15A 2QKDA 2XN9C 2Z6KA 3CCJA 1X9NA 2F0HA 5I6YA 4BBSB 3I7FA 1JJ2Z 1K83I 1I4PA 5J39A 2O5IC 1VQKA 2IX3A 2K50A 4IN3A 3R93A 3HOVH 3TRZA 4MXUA 1CZWA 1TS3A 1XYIA 4A3LI 4DPGA 2Z4IA 1KL9A 1VQ6A 1IYVA 1DJRD 2JEBI 3MFGA 4QIWE 3QOJA 4YWLA 2JA6I 3QB3A 3TS0A 3RMHA 2B3GA 4JI6L 3QR8A 1NP6A 2L0CA 1N8RC 3TQYA 1KTKA 4HEDA 1PH4A 5HY6A 1U4RA 4YHHQ 3AU7A 3M4PA 1N34L 2Z0SA 1QVFZ 3DM1A 4P71A 1LT3D 4LFCL 3HOUI 5C5MA 2YU9H 1CKNB 5IYBH 1LO5D 1Q90A 1FNWA 1EY6A 4LAAA 2UUBQ 2K14A 1K731 4POGA 3I3CA 3IFDA 3LGJA 2J0TD 2JA9A 4A3BH 1RIPA 2VZAA 2UXBL 2HCCA 1Y1WB 2WB1G 3UE1A 3CCR1 1KAAA 1RD9D 4LUOA 3CCS1 1Q12A 1U0LA 3M9BA 3CME1 2J6AA 3FPPA 2NVQI 5CBAE 1CKNA 2Q2IA 3T1HQ 3PO3B 4KJNA 1NY4A 3S17I 4HSVA 3VYUA 1SE3A 3T4NB 3ERQA 3EFXD 1SFOH 4JI7Q 1UEBA 3MXUA 2HDMA 1Q86C 3CW2C 3NH4A 1FL0A 3KJPA 5D14A 1VQ4Z 4JYAL 1ML8A 1WZNA 2SNMA 3S2DI 1JOQA 4C3JH 2XIWA 5KIXA 4GN5A 1DD2A 1TS5A 4YWKA 3HOWH 2VPZA 2CW0C 3BYTB 1X56A 2EZVA 4LF8L 3SK5A 1EWCA 3NQTA 2KA7A 3KIHA 2IHFA 5T1GA 1X3EA 1G6PA 1C4QA 2PI2A 2QW7A 4G7OC 5FOBB 2CCZA 3C3LA 4GOPB 2F0WA 1Q7YC 3AEVA 5JVG3 4H02A 3E0EA 1EOVA 3CPWA 3H3VI 2IV2X 2Y0SG 5KYIA 4KHVA 3NHHA 2F4OA 2EYOA 3FVQA 2QREB 1CI3M 2E7ZA 1VQNZ 3S1NB 1CSQA 1N36Q 4CJ1B 3GD7A 1SEBD 3PUYA 1K8OA 5T64A 2RDFA 2CWAA 3A56A 3S1RB 3S16H 2EJFC 1E22A 1PTOB 5IYBG 4GNXA 2K3RA 3D4DA 3NUCA 1RO2A 3DEOA 1PH5A 5IGDA 4A3BG 2LMCB 1KNAA 2HQLA 3FMCA 1EQQA 2B8GA 4GLAC 5JPNC 1H95A 3I73A 5CM2M 1A62A 4NMZA 2OOYB 1ET6A 3CP0A 1VQ5A 2EYJA 1I50B 4E2WA 1K9M1 4X66Q 2WKDA 2DNCA 2BA1A 2QILA 5FO9B 1BCPF 4QCLA 2JK8A 4ME3A 5L37A 3KBGA 4HCSA 3SXHA 5ELBA 4CDEC 1YNND 5IWAQ 2E2HB 1IL8A 2K1BA 3K5MA 4DR3L 3A8JE 3MC0B 3QG1A 1S72A 1WCMI 2Z1CA 3I4MI 4OX9L 1YNJD 1MKHA 1QYPA 3A55A 1KD11 1HNWQ 3A8IE 4CJ0B 4HIKA 1LTLA 4IFDJ 1J5EL 5EAYA 2OCEA 4J1MA 3J80L 4NXMQ 2EJMA 4ZQ3A 2BJOA 4YCWA 1TWFH 4C3JG 1WTHA 3OSOA 3GTLH 2D5DA 5IOCA 3VA7A 1TVXA 2G5DA 4A3GI 4NBDA 3FQMA 1UE1A 3D6WA 3ULLA 4DGLA 4BXXI 1UE7A 2K4KA 2K32A 3ER0A 3J80f 2KHSA 3I07A 4IZ8A 4Z9CB 1VQPA 1E0BA 4ULLA 3KLSA 3BVGA 1VF5C 2VQFL 1X3FA 1H9JA 1YI2A 2NVTB 2RT9A 2OQ0A 1R9TH 1W2BA 1WI5A 2RBMA 1XMQQ 2E2JH 4Q0FA 4MIUA 4DXFA 2RHBA 2AYDA 3HOXI 5IY0A 4FF3A 3KUPA 3U9SA 2JA5H 4JW0A 3RLNA 4DNIA 5BN5A 1QF8A 1ML0D 2BE5C 4TVAB 2K52A 1I3QB 1L1OC 3PO3H 3V96A 1TWHI 5FLXf 4BWGB 2Q2HA 4POFA 3ESWA 1DOMA 1JICA 1USPB 2I46A 1SNMA 1K8AC 2O4XA 4DAYA 4FXKC 1BXTA 3CPWY 3FDTA 3NDJA 2BH2A 4PMCA 2OZKA 4DK6C 3IX0A 1PYSB 1K732 5T1IA 2VUMH 3I2ZA 4JI0L 4BY1B 2EXZA 1TWGI 3PQIA 1BVSA 3VMGA 1E2VA 1Z01A 1HJPA 4DUZQ 4DV3L 3T1HL 2VL6A 3K81C 2RBLA 2CWPA 2K75A 3CCQA 2Q8IB 1STEA 3MXNB 4CDCC 3CPFA 2AWNA 3A7LA 3S14I 1RLYA 3N52A 3CC7Z 4RH6A 2EE1A 4JBWA 5C6AA 1VQLZ 4WFN3 2YTVA 1BDOA 1S5CD 3OYYA 2PMZB 1LTID 2OQKA 3NQIA 3GKQA 4G7HC 4WJWA 2KCCA 4RVDA 2NWGA 3SK4A 2KVMA 1B9MA 1N8R1 3NPPA 5KNBA 3SE0A 5C3XA 4A3FB 5GAHC 3DM3A 1ZYRD 4IUVA 3CC4Z 4LUVA 1SNDA 3OW2Z 3V05A 1PTOH 3CAMA 2Q8TA 1XNRL 4IUPA 1HZCA 1KC8C 1BNZA 3NK9A 2PMZA 5KYLA 3I55Z 5BN4A 3RZOB 3R2TA 1TWAH 4R1JA 5C4XH 1SMYD 3NTHA 1HZ9A 2VQEL 2L55A 3P1HA 2JA5G 1D8LA 4ID6A 2PI2E 2EQSA 1SDFA 5LMNQ 4A3EH 3TREA 3TP7A 1X3GA 3GTQB 2GU2A 1VQDA 1FNUA 4RKBA 1N33Q 5K36H 2K01A 2E2HH 3CXCY 1VQ7Z 3KF6B 4YIJA 1CQVA 3J80c 1HPCA 4AYBA 4JPBW 1YITZ 3J80i 3NELA 2DUDA 3CHBD 4OEMB 1EIFA 1W2BY 2EY6A 5CR3A 2VUMG 2JP1A 1F9SA 1YIJA 2B2UC 2HQEA 5ELCA 4LF5Q 4A3II 3OIPA 4DAMA 4K8JA 2RCNA 1QE6A 3LUSA 1EY7A 3KF6A 1WJ2A 1WTQA 5IWAL 3GTMB 4DR6Q 3OIQA 1CTMA 2N3SA 1F2ZA 3KYHC 1MGSA 1Y1VB 4FDBA 5HURA 2V8JA 1R4PB 1STGA 3SGIA 3CCLZ 2F0TA 1D1KA 1Q7Y1 1VQ41 2OTJZ 1PTOF 3T51B 1KD12 4FNFA 1PRTC 4ZYSA 1MSGA 1IBLL 3KBXA 3H6MA 2VPYA 3NP8A 4LF6Q 2C9OA 3K7AB 2F3VA 2NYZD 1C7YA 3F1ZA 3F2DA 2UXCL 2Q4ZA 1YHQZ 2HUGA 2EVBA 3S1QB 3FKIH 3GTGH 4MRIA 2A69C 3BVMA 4L63B 4ABNA 1I3QH 3NWTA 5GAGC 2MHVA 2R7FA 1SNQA 2A6HC 2OTLZ 3S15B 3M4OI 1NJIC 4LF4Q 1GUWA 2LEXA 2F52A 5C4XG 3SK8A 4ZKBB 3J7AV 3E6ZX 4DK1A 4R4CA 4A3EG 1IW7D 1ZEQX 1ILQA 1SYGA 4HMJA 4JG2A 2CVRA 4KD3A 5K36G 3VYRA 2A19A 1I94Q 4JI1L 1B3AA 2R6GA 1NNXA 3BU2A 5D1PA 5CV5A 1X0TA 4GKJQ 3PO2I 4IOCA 3H91A 2L15A 1KQSA 2ZM6L 2CKZB 2YV5A 3LNNA 3BZKA 2JIPA 1DGSA 1K83B 2ICIA 3KDFB 2JA7G 3I4NH 1ILPA 5M5WH 4A3CH 4KTAA 2VS1A 4QIWB 3DXJC 2JA7I 1FR3A 5JAVA 2JA6B 2B2VA 3CCEZ 1GUNA 1YEZA 2XRSD 4P75A 1QVGA 1A3VA 4QMGA 4XIGS 5A2QL 1B4OA 3J7YW 3F2BA 2UU9L 4LFBL 1EYAA 3KDFA 1HH2P 4NOZA 2QRDB 2VPXA 3AFQA 3HOUB 3DMUA 5C44H 4JOIA 4A76A 4CGYB 1M90C 3TS2A 3R8BA 4A3JI 4LF7Q 3QO2A 1TQOA 3MEHA 2RVLA 3K5NA 4BA1I 3CCRA 2B39A 3GTOH 1PVOA 3G6JB 2KUMA 3CCSA 5A2Qf 1QNKA 1ONLA 4L5QA 4ZAIA 2KI7B 3QWUA 2KPIA 3UDFA 1MSHA 3GTJI 1O7ZA 2DN8A 4HIMA 4E32A 3G6EZ 4UP7A 5CC4A 2EIFA 4E2XA 2K6AA 2NVQB 5DM63 1PH1A 2R93H 1EYGA 1XXGA 3S17B 1N8R2 5C4JI 4BY7B 4PZ8A 3D3RA 3NENA 2X69A 3LWUA 5HGTA 1VMCA 1K8A1 2GVAA 3CCU1 4JI6Q 2QR1B 1LTGD 1HZBA 1UEAB 5LL6X 1YJNZ 5EBCA 4KN7C 4V190 2JA8H 1IYUA 1CKMA 2JXMB 3EERA 1RNIA 1N34Q 2WB1A 5LMNL 3IL8A 4PNYA 3S2DB 5C4HA 4V0BA 1ZB8A 4MD8A 1D5XC 1O7YA 3M3YI 1CM9A 3DWQA 2SDFA 3A5ZB 1I4RA 4XYQA 3C1FA 4CKEA 3FPUB 2PMZE 2UXBQ 1VQFA 1Y1VH 1N9WA 3KF8B 4OHJA 4DN4M 4R8IA 1JWMD 5IP7I 1OXXK 3I4NG 1YBYA 1HNZL 3S1MI 2LXKA 2JE6I 3PIOA 4NW2A 5FLMH 1BBWA 1Q862 1PFNA 3T16A 5F2DA 4A3KH 4NBHA 2B2TC 3WDNA 3K7AH 4ALPA 2FMCA 5EPLA 3NE5B 2UUCL 1EY0A 3FQQA 3D6CA 3KF8A
chains in the Genus database with same CATH topology
4AYBE 3CCMZ 3CC71 3H3VJ 3JAMb 1VLAA 1KQSY 3VDYA 3CQZI 5C44G 2R92G 1VQL1 4DV4L 2A1AA 3S15H 1KC81 5ELOA 2VY3A 4DR4L 2BH8A 1ASZA 1VQ8A 2NVXI 4YY3L 4KHPL 1VQOZ 4LF8Q 2R92I 1Q7Y2 2EGTA 5LMUL 2Y0SA 3PO3S 1XNQL 3CC41 3MONA 1QVGY 2R93G 2B63I 4NFRA 4RVGA 1VQBA 4A3DH 3I56Z 2JA8G 1EWIA 4P74A 3HOZI 3W5OA 3P5JB 3RZDI 1VQ71 2QLVB 1M1KC 1OXVA 5JJLA 1VQIA 1YHBA 2OWOA 1G51A 1YIT1 3GO5A 2K5HA 3J7ZC 3IRBA 4AQYQ 5FLMG 3AQQA 3GTPH 3G4S1 2M6NA 3L7ZC 5GQOA 4DR3Q 3PF4A 4OX9Q 1OXTA 4E2ZA 3HOYI 4A3MH 2ZTEA 1J5EQ 4JI3Q 1YJWZ 2OTJ1 1P16A 3GTKH 3CCJZ 4BY7H 1Z03A 2ZJPA 1NJI1 3KJOA 1CKOA 2LSSA 1UWVA 3S2HH 3CCVZ 2N78A 3ICEA 2A8VA 2VQFQ 2R6MA 1I5FA 4R4OA 1ASYA 4PMWA 2HT1A 4DV6L 2E9HA 4YCUA 5C0XJ 1K8A2 4PZ7A 2ZJQA 5GROA 3F3PC 4IOAA 2MO1A 4A93H 1EQRA 4JI0Q 2DGYA 2WB1E 1M901 1VQHA 4DV3Q 3S24A 4WJ4A 1VS0A 3HKZG 3CCE1 3PCOB 4A3MG 1YJ9Z 4MZ9A 3H0GG 1PA6A 1QVFA 4HGZA 2QA4Z 2MFIA 2R7ZH 3H0GI 1C0AA 4MNOA 2QEXZ 4NBBA 1IBML 1EUJA 2IZ3A 3G48A 4OO1G 1KC82 2NVYI 3G6E1 3NH5A 3HOVG 4DV2L 1XNRQ 1FGUA 4APVA 4GNXB 3PUZA 3HOVI 2ZAEB 2VQEQ 1YJN1 1QZHA 2Y0SE 2GN5A 4IO9A 4X64L 2CQOA 5BR8L 5LL6f 2K5VA 4AIMA 3I4OA 4GOPC 2YU9I 4DR1Q 1K3RA 2E2IH 4A93G 1S3OA 4UP8A 1S72Z 1PHJA 4A3BI 3L2PA 4TQUS 4AQYL 1IZ6A 4YCVA 2LIYA 3FHWA 4A4IA 4B3TL 1X55A 4BBSH 2P3YA 3JC66 1WYDA 1QZGA 4JI4Q 4JI3L 1SFOI 2I5MX 1JJ2Y 1IBLQ 3HOWG 1VQO1 3KIFA 4OWWB 2UXCQ 1Z9FA 1LYLA 1W2BZ 1NJI2 3HOWI 3CXCA 2N49A 3GTMS 1B8AA 5M3FH 3PUXA 1Y1VS 3PIPA 5J3BA 2DE6A 4KHZA 1QVFY 4RVFA 2I3CA 1Y1WH 3I561 2EXDA 1Y14B 3OTOL 2E8GA 3J81f 1IBKL 1P9NA 4DAYB 4L5SA 3GCFA 3G711 5T67A 2JS4A 3EIVA 1PYBA 3J80b 2F4VL 3M85A 4JI1Q 1IL2A 3K0XA 1PV4A 2ZM6Q 3S16I 1BBUA 4MH4A 2V8IA 3Q8DA 1L1OA 1AH9A 1RQFA 4NXNL 1X3WA 2DE5A 5FLXb 3CCUA 2ATWA 1MJCA 5DLQE 4BBSG 1M902 1SMXA 2UU9Q 4LFBQ 1Q81C 1FJGL 1YJW1 4X62Q 3D9XA 3J7A5 2RF4A 1J6QA 3CMAZ 4NH1C 4NBEA 3W1GA 3ZJYC 1VQ9Z 2AMCB 1TWFI 3CCV1 1NUIA 1AE2A 2KCTA 4RMFA 3S1NH 3GTLI 4EQ5A 1JMCA 3S1RH 2F3IA 1WW9A 4HH4A 3NBHB 3BZCA 2AHOB 3CC7A 4Y7NH 1I50H 1R9TI 1VQLA 4S1TA 2E2JI 1Z47A 3PUVA 3PO3G 1DL6A 2JA5I 1KXLA 3PO3I 3PF5A 2XGTA 1Q861 4DR1L 4E30A 3CC4A 3OW2A 1HNZQ 2R7DA 3BJUA 2VUMI 2UUCQ 1YJ91 2UUAL 1VQGA 5IP9H 5FLXc 4DV4Q 2QA41 4NB8A 1E24A 4JI4L 2NVTH 5AN9F 1VQMZ 4DR4Q 5LMNW 4YY3Q 4KHPQ 1YITA 2QEX1 1YUAA 5LMUQ 1OXUA 1JJCB 1XNQQ 3CC2Z 3G4SA 4R4IA 4IPHA 4KI0A 2GVBA 3RNUA 1HR0Q 1JWHC 4B3SL 1WFQA 1M1K2 1VQN1 2OTJA 4BY1H 1AE3A 1TWAI 4MD9A 5C4XI 4OXPA 4E2YA 4A3EI 3MZKB 1S721 2OOXB 1Q1EA 1IYJB 4DV7L 2YYZA 5GADC 5FJ8H 4LFAL 1GKHA 1OXSC 5JEAJ 4A3FH 3ULJA 2N8NA 4LW1A 4P73A 4X62L 3TEHB 2MNAA 4MTNA 4QTUA 3OW2Y 3A74A 3RZOH 1V43A 1UE5A 1JJGA 1GD7A 3FKIG 3CMEA 2ZTDA 4Y52H 3GTQH 1TWCH 2NZHA 4X6AH 2PQAA 3FKII 3GTGI 3CCEA 1HZAA 1I3QI 1SR3A 1RL2A 4GN3B 4DV6Q 1NTGA 5A2Qb 4BY1G 2JEAI 4QGUA 3STBC 1K8GA 4DUYL 3E9IA 4GLXA 3T1YL 1JT8A 5E7NA 3GTMH 2YTYA 2Q2UA 4UPAA 5C3EH 4BBRH 3G6EA 4JI5L 3HKZA 3HFZB 4KLKA 4A3CG 2WAQG 4JI2Q 1A0IA 2QGQA 3I4NI 5FJ8G 4A3CI 3UDGA 4OWTB 3NDIA 4A3FG 3S1QH 4DR5Q 4NB3A 1VQ8Z 2GTIA 4DV0L 2JJQA 3UDXA 3IF8A 2JUBA 3CMA1 3F2CA 1Q82C 1I6HH 1VQ91 5C44I 1IBMQ 1V9PA 2KHJA 3GTOI 1Q8KA 4DV2Q 4IPDA 1K9MC 1VQJA 1NBWA 3F8TA 3CD6Z 3I551 1PH9A 3MZLB 2R93I 4LF9L 1HR0L 1K83H 2E5LL 4O2DA 4IJLA 4X64Q 4A3LH 1E1TA 5BR8Q 1PH8A 2JA8I 2DE7A 2O4HA 1VQOA 2JA6H 4EWCA 2QRCB 2K5NA 1Y1VG 2IT1A 3ERSX 2KBNA 2AKLA 1Y1VI 4WJ3M 3HOUH 4X65L 4A3KG 4B3TQ 3I56A 1LM0A 2NZOA 5FLMI 4DV5L 3L0OA 2NN6G 3G71A 4A3KI 1B70B 2KHIA 3K7AI 3CCL1 1SLJA 1L0WA 4JBJA 2JNYA 2NVQH 4RVHA 2ID0A 1N2FA 3S17H 1VQM1 2P28A 4HGYA 4B3RL 1D7QA 1VQKZ 2D0PA 1VQ6Z 1YHQ1 3CC21 1X65A 4GS3A 3S2DH 4GKKL 4EX5A 4NBFA 2ES2A 2Z6KC 2Q2TA 2OTL1 3MEFA 1MIUA 1VQCA 4A3DG 4LNQA 3IFUA 3OTOQ 1IBKQ 1YJWA 4OONA 2ASBA 4A3LG 2HU9A 3NFZA 4A3DI 2F4VQ 4UP9A 3H3VH 2JA6G 1XPRA 2IHEA 1Z02A 3CCVA 3HKSA 5IE8A 1JJ2A 4BA2I 3VTNA 4JBKA 3TDHB 4OWXB 3HOUG 4NXNQ 4DQYB 1JE5A 4JI2L 2IZ4A 1Q812 4QJFA 3NH8A 3GTPI 5HGQA 4LUZA 4DR5L 2KCMA 4QTTA 1FJGQ 3HKZE 4R4QA 3BG0B 1XTDA 4A3MI 4BY7G 1XJVA 1WCMH 2IX0A 4DR2L 3I4MH 2Q51A 2RHSB 2HIVA 3GTKI 4BY7I 2AKWB 3CPWZ 1PH3A 3S2HI 2HHHL 3UE0A 1P8LA 5H1SE 3BG1B 4OO1I 4A3GH 1YJ9A 1KIXA 4BXXH 1LQLA 2BA0A 2QA4A 1VQ4A 1L2FA 3TE5B 5JJKA 4P72A 4JV5Q 5AJ3L 4TNUA 2LFUA 1VQ5Z 4C3HH 1EFWA 3K7UC 2QEXA 2I0QA 3HOXH 1X3ZA 4GNXC 4R4TA 1N32L 4LWCA 1RO4A 4JCVE 4C2MH 2W04A 1TWHH 2F4MA 3K80C 4A93I 4GOPA 3K8AA 2MO0A 5IYDH 1Q821 2JR6A 4QY7A 2UUAQ 1VQNA 3RR5A 3VB9A 1VQ81 3CCM1 1TWGH 1WCMG 1K0RA 3I4MG 2R7ZG 3CXCZ 1SROA 2UXDL 1VQPZ 1JB7A 3S14H 1YI2Z 2R7ZI 3M7NA 1A8VA 3EBEA 3AYHB 4A3GG 5IYCH 1M1K1 2LXJA 4BXXG 3CD61 3A5UA 4DV1L 4B3SQ 4GLVB 3WWVA 1L1OB 2VNUD 3KLWA 4XTCS 5M3MH 3HOXG 2V1CC 1QVCA 1YZ6A 4NBCA 3J81b 3CCUZ 1KHIA 3RLFA 2FXQA 3CCQZ 4NPSA 2E2II 1NMFA 1V1QA 4DV7Q 4K0KQ 5IYDG 3PSIA 2I5HA 4YHHL 1OTCA 4LFAQ 4HJ8A 1S7MA 4IPGA 2UUBL 1NE3A 4A3IH 4DKAC 5C0XG 3CCJ1 4BBSI 1VQK1 3KFUA 5C0XI 3J81j 3A0JA 1USPA 1VQ61 5M3FG 4JI7L 3U4ZA 3W1BA 2H85A 1S40A 1NMGA 5IYCG 3RN2A 1C9OA 2ZTCA 4UY8C 1Y1WG 3NEMA 3M4QA 1Y1WI 3PGZA 4DUYQ 4CL1A 3T1YQ 2IY5B 1BKBA 3M4OH 3CMAA 4JV5L 5M3MG 1VQ9A 1YIJZ 2WAQA 4RS4A 3VMIA 1YHAA 4JI5Q 2H5XA 2V8KA 4HIOA 1N36L 3PO2H 4HIDA 3I55A 3J81c 3U4VA 4C3IH 3J81i 1XPUA 1QUQB 4A3IG 4DV0Q 1Q822 2HF1A 3FP9A 1VQ7A 4X66L 3U50C 2JA7H 1TXYA 3G4SZ 1YUKA 4JI8Q 1K9M2 1QUQA 4L5RC 1GVPA 1HNWL 3S1NI 4A3JH 3STBD 4A75A 2KENA 4NXML 4B3MQ 2WP8J 3S1RI 4JBMA 4LF9Q 2ALYB 3GTJH 2E5LQ 1X54A 3CCLA 1KQSZ 1GO3E 1VQMA 4QQBX 4IFDG 4RG1A 5C4JH 1WOCA 4DR7Q 4Y7NI 1I50I 1VQ51 4NBAA 2VF1A 2B29A 4L5TA 4IFDI 4HJAA 1YHQA 2E2HI 3Q87A 3CC2A 5IT9f 1XMQL 1IXRA 4QL5A 2CFMA 4X65Q 3CF5A 1EIYB 3M3YH 3DLLA 1QVGZ 4IPCA 3PO2G 2OTLA 4K0KL 4JC0A 2C35B 4DV5Q 1HNXQ 1GM5A 5IP7H 1ZH1A 5IP9G 3S1MH 5IT9b 1Q46A 3CCRZ 1WJJA 1HR0W 2PK7A 4XX2A 3CCSZ 1YVCA 5IP9I 3CMEZ 2PQAB 4NB9A 4B3RQ 1VQP1 2NVTI 4DUZL 4JOIC 1YI21 1K73C 1XMOQ 3CQZH 1PH2A 2PNHA 4GKKQ 4A3JG 2W03A 2NVXH 1SE8A 1ZB9A 2R92H 4DK3C 3KOJA 2HIXA 1B7YB 2B63H 1KRLA 4E33A 2VUGA 4HJ9A 3D0FA 1E3PA 4E31A 4BY1I 3H15A 1SRUA 3D31A 4HJ5A 5JJIA 3HOZH 1PH7A 1Q811 3CCQ1 3RZDH 1VQEA 4LFCQ 2JMOA 2PM9A 4PG3A 2G2KA 3RLOA 5IP7G 1N33L 2WAQE 5D1OB 1YJNA 1E7ZA 2GTHA 1PFSA 5M5XH 2AWOA 3JAMf 4NBGA 2I5LX 4A3FI 2IX1A 3EEDA 1VCIA 4DR2Q 1G291 5M5YH 1X6OA 4O0AA 4LF5L 3HOYH 4AYBG 5IT9c 1PH6A 5D1OA 5ELNA 4JI8L 1E1OA 1UE6A 4DR6L 2D0OA 3PV0A 3RZOI 3J7A4 1O7IA 2HHHQ 4YWMA 4GN4B 4JYAQ 1U5KA 2M48A 3VMHA 4Y52I 4IJHA 3B6YA 3GTQI 4B3ML 1TWCI 1XPOA 4X6AI 3RN5A 3CCMA 5T6BA 2RPRA 4LF6L 3F3FC 2B63G 1KD1C 1PFTA 5AJ3Q 3E9HA 1A63A 4DR7L 1KAWA 1YIJ1 2WFWA 5C3EG 2YTXA 2K5RA 1WIIA 2O53A 4BBRG 3HOZG 2RIQA 4LF4L 1N32Q 1LUZA 3GTMI 1KRTA 5C3EI 4BBRI 3G71Z 1YNXA 2JQOA 1FVIA 2XTIA 1MJEA 3CD6A 3U58A 1VQAA 1I94L 3ULPA 4MD7A 2YADA 1HNXL 4PZ6A 4GKJL 1KRSA 2D62A 2MQHA 3S1QI 1W3SA 2NN6I 2RHQB 3AFPA 2UXDQ 3HOYG 3PUWA 1CSPA 3EN2A 3GDEA 4HJ7A 1TFIA 4MONA 3S15I 1T9HA 1XMOL 4AH6A 1I6HI 5GAEC 1SN8A 3H0GH 3UDIA 4RV9A 2VW9A 4DV1Q 1CUKA 1RO0A 1Q1BA 3JAMc 4LF7L 3JAMi 2NVYH 5JEAG 4J15A 2QKDA 2Z6KA 3CCJA 1X9NA 3I7FA 1JJ2Z 1K83I 1VQKA 2K50A 3HOVH 3TRZA 4MXUA 4A3LI 4DPGA 1KL9A 1VQ6A 2JEBI 4QIWE 4YWLA 2JA6I 3TS0A 2B3GA 4JI6L 1NP6A 1N8RC 3TQYA 1PH4A 5HY6A 4YHHQ 3M4PA 1N34L 2Z0SA 1QVFZ 4P71A 4LFCL 3HOUI 2YU9H 1CKNB 5IYBH 2UUBQ 2K14A 1K731 4POGA 3LGJA 2JA9A 4A3BH 1RIPA 2VZAA 2UXBL 2WB1G 3UE1A 3CCR1 4LUOA 3CCS1 1Q12A 1U0LA 3M9BA 3CME1 2J6AA 2NVQI 1CKNA 2Q2IA 3T1HQ 1NY4A 3S17I 3T4NB 1SFOH 4JI7Q 1UEBA 1Q86C 3CW2C 3NH4A 1FL0A 3KJPA 1VQ4Z 4JYAL 1ML8A 3S2DI 4C3JH 4GN5A 4YWKA 3HOWH 1X56A 4LF8L 3KIHA 2IHFA 1X3EA 1G6PA 2PI2A 2CCZA 4GOPB 1Q7YC 3AEVA 4H02A 3E0EA 1EOVA 3CPWA 3H3VI 2Y0SG 2F4OA 2QREB 1VQNZ 1CSQA 1N36Q 3GD7A 3PUYA 5T64A 2CWAA 3S16H 5IYBG 1E22A 4GNXA 2K3RA 1RO2A 1PH5A 4A3BG 1EQQA 2HQLA 4GLAC 1H95A 5CM2M 1A62A 2OOYB 3CP0A 1VQ5A 4E2WA 1K9M1 4X66Q 2BA1A 2JK8A 4ME3A 5IWAQ 4DR3L 1S72A 1WCMI 3I4MI 4OX9L 1MKHA 1QYPA 1KD11 1HNWQ 4HIKA 1LTLA 4IFDJ 1J5EL 5EAYA 2OCEA 4NXMQ 2BJOA 4YCWA 1TWFH 3GTLH 4A3GI 4NBDA 3FQMA 1UE1A 3D6WA 3ULLA 4DGLA 4BXXI 1UE7A 2K4KA 3ER0A 3J80f 3I07A 1VQPA 2VQFL 1X3FA 1YI2A 2RT9A 2OQ0A 1R9TH 1W2BA 1WI5A 1XMQQ 2E2JH 2RHBA 3HOXI 5IY0A 2JA5H 3RLNA 4DNIA 1QF8A 4TVAB 2K52A 1L1OC 3PO3H 1TWHI 5FLXf 2Q2HA 4POFA 3ESWA 1USPB 1K8AC 3CPWY 3NDJA 2BH2A 2OZKA 4DK6C 3IX0A 1PYSB 1K732 2VUMH 3I2ZA 4JI0L 1TWGI 1BVSA 3VMGA 1Z01A 1HJPA 4DUZQ 4DV3L 3T1HL 2VL6A 3K81C 2RBLA 2CWPA 2K75A 3CCQA 3MXNB 3CPFA 2AWNA 3S14I 1RLYA 3CC7Z 4JBWA 1VQLZ 2YTVA 3OYYA 2OQKA 3GKQA 4RVDA 1N8R1 5GAHC 3DM3A 3CC4Z 4LUVA 3OW2Z 3CAMA 1XNRL 1HZCA 1KC8C 2PMZA 3I55Z 1TWAH 4R1JA 5C4XH 1HZ9A 2VQEL 2JA5G 1D8LA 2PI2E 2EQSA 5LMNQ 4A3EH 3TREA 1X3GA 2GU2A 1VQDA 1N33Q 2E2HH 3CXCY 1VQ7Z 3KF6B 3J80c 4AYBA 3J80i 1YITZ 3NELA 2DUDA 1EIFA 1W2BY 2VUMG 1YIJA 4LF5Q 4A3II 4DAMA 2RCNA 3LUSA 3KF6A 5IWAL 4DR6Q 2N3SA 3KYHC 4FDBA 2V8JA 3SGIA 3CCLZ 1Q7Y1 1VQ41 2OTJZ 1KD12 1IBLL 4LF6Q 1C7YA 3F1ZA 3F2DA 2UXCL 2Q4ZA 1YHQZ 3FKIH 3GTGH 4MRIA 1I3QH 5GAGC 2R7FA 2OTLZ 3M4OI 1NJIC 4LF4Q 2F52A 5C4XG 4DK1A 4R4CA 4A3EG 4JG2A 5K36G 2A19A 1I94Q 4JI1L 3BU2A 2R6GA 5D1PA 1X0TA 4GKJQ 3PO2I 4IOCA 2L15A 1KQSA 2ZM6L 2CKZB 2YV5A 3BZKA 1DGSA 3KDFB 2JA7G 3I4NH 5M5WH 4A3CH 2VS1A 2JA7I 3CCEZ 4P75A 1YEZA 1QVGA 4XIGS 3F2BA 2UU9L 4LFBL 3KDFA 1HH2P 4NOZA 2QRDB 3AFQA 5C44H 4JOIA 4A76A 1M90C 3TS2A 4A3JI 4LF7Q 4BA1I 3CCRA 1PVOA 3GTOH 3CCSA 5A2Qf 4L5QA 2KI7B 3QWUA 2KPIA 3UDFA 4HIMA 3GTJI 4E32A 3G6EZ 4UP7A 2EIFA 4E2XA 1PH1A 2R93H 1EYGA 1N8R2 5C4JI 4PZ8A 3NENA 1K8A1 2GVAA 3CCU1 4JI6Q 2QR1B 1HZBA 1YJNZ 2JA8H 1CKMA 3EERA 1RNIA 1N34Q 2WB1A 5LMNL 1ZB8A 4MD8A 3M3YI 3A5ZB 2PMZE 2UXBQ 1VQFA 1Y1VH 1N9WA 3KF8B 5IP7I 1OXXK 3I4NG 1YBYA 1HNZL 3S1MI 2LXKA 2JE6I 3PIOA 5FLMH 1BBWA 1Q862 4A3KH 4NBHA 3K7AH 4ALPA 2UUCL 2ZJRA 3FQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AYB E;  3H3V J;  1VLA A;  3VDY A;  3CQZ I;  5C44 G;  2R92 G;  4DV4 L;  2A1A A;  3S15 H;  5ELO A;  2VY3 A;  4DR4 L;  2BH8 A;  1ASZ A;  1VQ8 A;  2NVX I;  4YY3 L;  4KHP L;  4LF8 Q;  2R92 I;  5LMU L;  3PO3 S;  1XNQ L;  2R93 G;  2B63 I;  1VQB A;  4A3D H;  2JA8 G;  1EWI A;  4P74 A;  3HOZ I;  3W5O A;  3RZD I;  1M1K C;  1OXV A;  5JJL A;  1VQI A;  1YHB A;  2OWO A;  1G51 A;  3GO5 A;  2K5H A;  3J7Z C;  3IRB A;  4AQY Q;  5FLM G;  3AQQ A;  3GTP H;  3L7Z C;  5GQO A;  4DR3 Q;  3PF4 A;  4OX9 Q;  1OXT A;  3HOY I;  4A3M H;  2ZTE A;  1J5E Q;  4JI3 Q;  1P16 A;  3GTK H;  4BY7 H;  2ZJP A;  3KJO A;  1CKO A;  2LSS A;  1UWV A;  3S2H H;  2N78 A;  3ICE A;  2A8V A;  2VQF Q;  1I5F A;  4R4O A;  1ASY A;  4PMW A;  2HT1 A;  4DV6 L;  4YCU A;  5C0X J;  4PZ7 A;  2ZJQ A;  5GRO A;  4IOA A;  2MO1 A;  4A93 H;  1EQR A;  4JI0 Q;  2DGY A;  2WB1 E;  1VQH A;  4DV3 Q;  3S24 A;  4WJ4 A;  1VS0 A;  3HKZ G;  3PCO B;  4A3M G;  4MZ9 A;  3H0G G;  1PA6 A;  1QVF A;  2MFI A;  2R7Z H;  3H0G I;  1C0A A;  4MNO A;  4NBB A;  1IBM L;  1EUJ A;  3G48 A;  4OO1 G;  2NVY I;  3HOV G;  4DV2 L;  1XNR Q;  1FGU A;  4APV A;  4GNX B;  3PUZ A;  3HOV I;  2VQE Q;  1QZH A;  2Y0S E;  2GN5 A;  4IO9 A;  4X64 L;  2CQO A;  5BR8 L;  2K5V A;  4AIM A;  3I4O A;  4GOP C;  2YU9 I;  4A93 G;  1K3R A;  4DR1 Q;  2E2I H;  1S3O A;  4UP8 A;  1PHJ A;  4A3B I;  3L2P A;  4TQU S;  4AQY L;  1IZ6 A;  4YCV A;  3FHW A;  4A4I A;  4B3T L;  1X55 A;  4BBS H;  2P3Y A;  3JC6 6;  1WYD A;  1QZG A;  4JI4 Q;  4JI3 L;  1SFO I;  2I5M X;  1IBL Q;  3HOW G;  4OWW B;  2UXC Q;  1Z9F A;  1LYL A;  3HOW I;  3CXC A;  2N49 A;  3GTM S;  1B8A A;  5M3F H;  3PUX A;  1Y1V S;  3PIP A;  5J3B A;  2DE6 A;  4KHZ A;  1Y1W H;  2EXD A;  1Y14 B;  3OTO L;  2E8G A;  1IBK L;  4DAY B;  4L5S A;  3GCF A;  2JS4 A;  3EIV A;  1PYB A;  2F4V L;  3M85 A;  4JI1 Q;  1IL2 A;  3K0X A;  1PV4 A;  2ZM6 Q;  3S16 I;  1BBU A;  4MH4 A;  3Q8D A;  1L1O A;  1AH9 A;  4NXN L;  1X3W A;  2DE5 A;  3CCU A;  2ATW A;  1MJC A;  5DLQ E;  4BBS G;  1SMX A;  2UU9 Q;  4LFB Q;  1Q81 C;  1FJG L;  4X62 Q;  3J7A 5;  2RF4 A;  1J6Q A;  4NBE A;  3W1G A;  3ZJY C;  2AMC B;  1TWF I;  2KCT A;  1NUI A;  1AE2 A;  4RMF A;  3S1N H;  3GTL I;  4EQ5 A;  1JMC A;  3S1R H;  2F3I A;  1WW9 A;  3NBH B;  3BZC A;  2AHO B;  3CC7 A;  4Y7N H;  1I50 H;  1R9T I;  1VQL A;  2E2J I;  1Z47 A;  3PUV A;  3PO3 G;  1DL6 A;  2JA5 I;  1KXL A;  3PO3 I;  3PF5 A;  2XGT A;  4DR1 L;  3CC4 A;  3OW2 A;  1HNZ Q;  2R7D A;  3BJU A;  2VUM I;  2UUC Q;  2UUA L;  1VQG A;  5IP9 H;  5FLX c;  4DV4 Q;  4NB8 A;  1E24 A;  4JI4 L;  2NVT H;  4DR4 Q;  5LMN W;  4YY3 Q;  4KHP Q;  1YIT A;  1YUA A;  5LMU Q;  1OXU A;  1JJC B;  1XNQ Q;  3G4S A;  4R4I A;  4IPH A;  4KI0 A;  2GVB A;  3RNU A;  1HR0 Q;  4B3S L;  1WFQ A;  2OTJ A;  4BY1 H;  1AE3 A;  1TWA I;  5C4X I;  4OXP A;  4A3E I;  1Q1E A;  1IYJ B;  4DV7 L;  2YYZ A;  5GAD C;  5FJ8 H;  4LFA L;  1GKH A;  1OXS C;  5JEA J;  4A3F H;  3ULJ A;  2N8N A;  4LW1 A;  4P73 A;  4X62 L;  3TEH B;  2MNA A;  4MTN A;  4QTU A;  3A74 A;  3RZO H;  1V43 A;  1UE5 A;  1JJG A;  1GD7 A;  3FKI G;  3CME A;  2ZTD A;  4Y52 H;  3GTQ H;  1TWC H;  2NZH A;  4X6A H;  2PQA A;  3FKI I;  3GTG I;  3CCE A;  1HZA A;  1I3Q I;  1SR3 A;  1RL2 A;  4GN3 B;  4DV6 Q;  1NTG A;  4BY1 G;  2JEA I;  4QGU A;  3STB C;  1K8G A;  4DUY L;  3E9I A;  4GLX A;  3T1Y L;  1JT8 A;  5E7N A;  3GTM H;  2YTY A;  2Q2U A;  4UPA A;  5C3E H;  4BBR H;  3G6E A;  4JI5 L;  3HFZ B;  4KLK A;  4A3C G;  2WAQ G;  4JI2 Q;  1A0I A;  2QGQ A;  3I4N I;  5FJ8 G;  4A3C I;  3UDG A;  4OWT B;  4A3F G;  3S1Q H;  4DR5 Q;  4NB3 A;  4DV0 L;  2JJQ A;  3UDX A;  3F2C A;  1Q82 C;  1I6H H;  5C44 I;  1IBM Q;  1V9P A;  2KHJ A;  3GTO I;  1Q8K A;  4DV2 Q;  4IPD A;  1K9M C;  1VQJ A;  1NBW A;  3F8T A;  1PH9 A;  2R93 I;  4LF9 L;  1HR0 L;  1K83 H;  2E5L L;  4O2D A;  4IJL A;  4X64 Q;  4A3L H;  1E1T A;  5BR8 Q;  1PH8 A;  2JA8 I;  2DE7 A;  1VQO A;  2JA6 H;  2K5N A;  1Y1V G;  2IT1 A;  3ERS X;  2KBN A;  2AKL A;  1Y1V I;  4WJ3 M;  3HOU H;  4X65 L;  4A3K G;  4B3T Q;  3I56 A;  1LM0 A;  2NZO A;  5FLM I;  4DV5 L;  3L0O A;  2NN6 G;  3G71 A;  4A3K I;  1B70 B;  2KHI A;  3K7A I;  1SLJ A;  1L0W A;  4JBJ A;  2JNY A;  2NVQ H;  2ID0 A;  1N2F A;  3S17 H;  4B3R L;  1D7Q A;  2D0P A;  1X65 A;  4GS3 A;  3S2D H;  4GKK L;  4EX5 A;  4NBF A;  2ES2 A;  2Z6K C;  2Q2T A;  3MEF A;  1MIU A;  1VQC A;  4A3D G;  4LNQ A;  3OTO Q;  1IBK Q;  1YJW A;  4OON A;  2ASB A;  4A3L G;  4A3D I;  2F4V Q;  4UP9 A;  3H3V H;  2JA6 G;  1XPR A;  2IHE A;  3CCV A;  3HKS A;  5IE8 A;  1JJ2 A;  4BA2 I;  4JBK A;  3HOU G;  4OWX B;  4NXN Q;  1JE5 A;  4JI2 L;  4QJF A;  3GTP I;  5HGQ A;  4LUZ A;  4DR5 L;  2KCM A;  4QTT A;  1FJG Q;  3HKZ E;  4R4Q A;  1XTD A;  4A3M I;  4BY7 G;  1XJV A;  1WCM H;  2IX0 A;  4DR2 L;  3I4M H;  2RHS B;  2HIV A;  3GTK I;  4BY7 I;  2AKW B;  1PH3 A;  3S2H I;  2HHH L;  3UE0 A;  1P8L A;  5H1S E;  4OO1 I;  4A3G H;  1YJ9 A;  1KIX A;  4BXX H;  1LQL A;  2BA0 A;  2QA4 A;  1VQ4 A;  1L2F A;  5JJK A;  4P72 A;  4JV5 Q;  5AJ3 L;  4C3H H;  1EFW A;  3K7U C;  2QEX A;  2I0Q A;  3HOX H;  1X3Z A;  4GNX C;  4R4T A;  1N32 L;  4LWC A;  1RO4 A;  4JCV E;  4C2M H;  1TWH H;  2F4M A;  3K80 C;  4A93 I;  4GOP A;  3K8A A;  2MO0 A;  5IYD H;  2JR6 A;  4QY7 A;  2UUA Q;  1VQN A;  3RR5 A;  3VB9 A;  1TWG H;  1WCM G;  1K0R A;  3I4M G;  2R7Z G;  1SRO A;  2UXD L;  1JB7 A;  3S14 H;  2R7Z I;  3M7N A;  1A8V A;  3EBE A;  3AYH B;  4A3G G;  5IYC H;  2LXJ A;  4BXX G;  3A5U A;  4DV1 L;  4B3S Q;  4GLV B;  3WWV A;  1L1O B;  2VNU D;  3KLW A;  4XTC S;  5M3M H;  3HOX G;  2V1C C;  1QVC A;  1YZ6 A;  4NBC A;  1KHI A;  3RLF A;  2FXQ A;  4NPS A;  2E2I I;  1NMF A;  1V1Q A;  4DV7 Q;  4K0K Q;  5IYD G;  3PSI A;  2I5H A;  4YHH L;  1OTC A;  4LFA Q;  4HJ8 A;  4IPG A;  2UUB L;  1NE3 A;  4A3I H;  4DKA C;  5C0X G;  4BBS I;  3KFU A;  5C0X I;  3J81 j;  3A0J A;  1USP A;  5M3F G;  4JI7 L;  3U4Z A;  3W1B A;  1S40 A;  1NMG A;  5IYC G;  3RN2 A;  1C9O A;  2ZTC A;  4UY8 C;  1Y1W G;  3NEM A;  3M4Q A;  1Y1W I;  3PGZ A;  4DUY Q;  3T1Y Q;  2IY5 B;  1BKB A;  3M4O H;  3CMA A;  4JV5 L;  5M3M G;  1VQ9 A;  3VMI A;  1YHA A;  4JI5 Q;  2H5X A;  4HIO A;  1N36 L;  3PO2 H;  4HID A;  3I55 A;  3J81 c;  3U4V A;  4C3I H;  3J81 i;  1XPU A;  1QUQ B;  4A3I G;  4DV0 Q;  2HF1 A;  3FP9 A;  1VQ7 A;  4X66 L;  3U50 C;  2JA7 H;  1TXY A;  4JI8 Q;  1QUQ A;  4L5R C;  1GVP A;  1HNW L;  3S1N I;  4A3J H;  3STB D;  4A75 A;  2KEN A;  4NXM L;  4B3M Q;  2WP8 J;  3S1R I;  4JBM A;  4LF9 Q;  2ALY B;  3GTJ H;  2E5L Q;  1X54 A;  3CCL A;  1GO3 E;  1VQM A;  4QQB X;  4IFD G;  4RG1 A;  5C4J H;  1WOC A;  4DR7 Q;  4Y7N I;  1I50 I;  4NBA A;  2B29 A;  4L5T A;  4IFD I;  4HJA A;  1YHQ A;  2E2H I;  3Q87 A;  3CC2 A;  1XMQ L;  1IXR A;  4QL5 A;  2CFM A;  4X65 Q;  3CF5 A;  1EIY B;  3M3Y H;  3DLL A;  4IPC A;  3PO2 G;  2OTL A;  4K0K L;  4JC0 A;  2C35 B;  4DV5 Q;  1HNX Q;  1GM5 A;  5IP7 H;  5IP9 G;  3S1M H;  1Q46 A;  1WJJ A;  1HR0 W;  2PK7 A;  4XX2 A;  1YVC A;  5IP9 I;  2PQA B;  4NB9 A;  4B3R Q;  2NVT I;  4DUZ L;  4JOI C;  1K73 C;  1XMO Q;  3CQZ H;  1PH2 A;  2PNH A;  4GKK Q;  4A3J G;  2NVX H;  1SE8 A;  1ZB9 A;  2R92 H;  4DK3 C;  3KOJ A;  2HIX A;  1B7Y B;  2B63 H;  4HJ9 A;  3D0F A;  1E3P A;  4BY1 I;  3H15 A;  1SRU A;  3D31 A;  4HJ5 A;  5JJI A;  3HOZ H;  1PH7 A;  3RZD H;  1VQE A;  4LFC Q;  4PG3 A;  3RLO A;  5IP7 G;  1N33 L;  2WAQ E;  1YJN A;  1E7Z A;  1PFS A;  5M5X H;  2AWO A;  4NBG A;  2I5L X;  4A3F I;  2IX1 A;  1VCI A;  4DR2 Q;  1G29 1;  5M5Y H;  1X6O A;  4O0A A;  4LF5 L;  3HOY H;  4AYB G;  5IT9 c;  1PH6 A;  5ELN A;  4JI8 L;  1E1O A;  1UE6 A;  4DR6 L;  2D0O A;  3PV0 A;  3RZO I;  1O7I A;  2HHH Q;  4YWM A;  4GN4 B;  4JYA Q;  1U5K A;  3VMH A;  4Y52 I;  4IJH A;  3B6Y A;  3GTQ I;  4B3M L;  1TWC I;  1XPO A;  4X6A I;  3RN5 A;  3CCM A;  4LF6 L;  2B63 G;  1KD1 C;  1PFT A;  5AJ3 Q;  3E9H A;  1A63 A;  4DR7 L;  1KAW A;  2WFW A;  5C3E G;  2YTX A;  2K5R A;  4BBR G;  3HOZ G;  4LF4 L;  1N32 Q;  1LUZ A;  3GTM I;  1KRT A;  5C3E I;  4BBR I;  1YNX A;  2JQO A;  1FVI A;  2XTI A;  1MJE A;  3CD6 A;  3U58 A;  1VQA A;  1I94 L;  3ULP A;  1HNX L;  4PZ6 A;  4GKJ L;  1KRS A;  2D62 A;  2MQH A;  3S1Q I;  1W3S A;  2NN6 I;  2RHQ B;  3AFP A;  2UXD Q;  3HOY G;  3PUW A;  1CSP A;  3EN2 A;  3GDE A;  4HJ7 A;  1TFI A;  3S15 I;  1T9H A;  1XMO L;  4AH6 A;  1I6H I;  5GAE C;  1SN8 A;  3H0G H;  3UDI A;  2VW9 A;  4DV1 Q;  1CUK A;  1Q1B A;  4LF7 L;  3JAM c;  3JAM i;  2NVY H;  5JEA G;  4J15 A;  2Z6K A;  3CCJ A;  1X9N A;  3I7F A;  1K83 I;  1VQK A;  2K50 A;  3HOV H;  3TRZ A;  4A3L I;  4DPG A;  1KL9 A;  1VQ6 A;  2JEB I;  4QIW E;  4YWL A;  2JA6 I;  3TS0 A;  2B3G A;  4JI6 L;  1N8R C;  3TQY A;  1PH4 A;  5HY6 A;  4YHH Q;  3M4P A;  1N34 L;  2Z0S A;  4P71 A;  4LFC L;  3HOU I;  2YU9 H;  1CKN B;  5IYB H;  2UUB Q;  2K14 A;  4POG A;  3LGJ A;  2JA9 A;  4A3B H;  1RIP A;  2VZA A;  2UXB L;  2WB1 G;  3UE1 A;  4LUO A;  1Q12 A;  1U0L A;  3M9B A;  2J6A A;  2NVQ I;  1CKN A;  2Q2I A;  3T1H Q;  1NY4 A;  3S17 I;  1SFO H;  4JI7 Q;  1UEB A;  1Q86 C;  3CW2 C;  1FL0 A;  3KJP A;  4JYA L;  1ML8 A;  3S2D I;  4C3J H;  4GN5 A;  4YWK A;  3HOW H;  1X56 A;  4LF8 L;  2IHF A;  1X3E A;  1G6P A;  2PI2 A;  2CCZ A;  4GOP B;  1Q7Y C;  3AEV A;  4H02 A;  3E0E A;  1EOV A;  3CPW A;  3H3V I;  2Y0S G;  2F4O A;  1CSQ A;  1N36 Q;  3GD7 A;  3PUY A;  2CWA A;  3S16 H;  5IYB G;  1E22 A;  4GNX A;  1PH5 A;  4A3B G;  1EQQ A;  2HQL A;  4GLA C;  1H95 A;  5CM2 M;  1A62 A;  3CP0 A;  1VQ5 A;  4X66 Q;  2BA1 A;  2JK8 A;  4ME3 A;  5IWA Q;  4DR3 L;  1S72 A;  1WCM I;  3I4M I;  4OX9 L;  1MKH A;  1QYP A;  1HNW Q;  4HIK A;  1LTL A;  4IFD J;  1J5E L;  5EAY A;  2OCE A;  4NXM Q;  2BJO A;  4YCW A;  1TWF H;  3GTL H;  4A3G I;  4NBD A;  1UE1 A;  3D6W A;  3ULL A;  4BXX I;  1UE7 A;  2K4K A;  3ER0 A;  3I07 A;  1VQP A;  2VQF L;  1X3F A;  1YI2 A;  2OQ0 A;  1R9T H;  1W2B A;  1WI5 A;  1XMQ Q;  2E2J H;  3HOX I;  5IY0 A;  2JA5 H;  3RLN A;  4DNI A;  4TVA B;  2K52 A;  1L1O C;  3PO3 H;  1TWH I;  2Q2H A;  4POF A;  3ESW A;  1USP B;  1K8A C;  2BH2 A;  4DK6 C;  1PYS B;  2VUM H;  3I2Z A;  4JI0 L;  1TWG I;  1BVS A;  3VMG A;  1HJP A;  4DUZ Q;  4DV3 L;  3T1H L;  2VL6 A;  3K81 C;  2RBL A;  2CWP A;  2K75 A;  3CCQ A;  3MXN B;  3CPF A;  2AWN A;  3S14 I;  1RLY A;  4JBW A;  2YTV A;  3OYY A;  2OQK A;  3GKQ A;  5GAH C;  3DM3 A;  4LUV A;  3CAM A;  1XNR L;  1HZC A;  1KC8 C;  1TWA H;  4R1J A;  5C4X H;  1HZ9 A;  2VQE L;  2JA5 G;  1D8L A;  2PI2 E;  2EQS A;  5LMN Q;  4A3E H;  3TRE A;  1X3G A;  1VQD A;  1N33 Q;  2E2H H;  3KF6 B;  3J80 c;  3J80 i;  3NEL A;  2DUD A;  1EIF A;  2VUM G;  1YIJ A;  4LF5 Q;  4A3I I;  4DAM A;  2RCN A;  3LUS A;  3KF6 A;  5IWA L;  4DR6 Q;  2N3S A;  3KYH C;  4FDB A;  3SGI A;  1IBL L;  4LF6 Q;  1C7Y A;  3F1Z A;  3F2D A;  2UXC L;  3FKI H;  3GTG H;  1I3Q H;  5GAG C;  2R7F A;  3M4O I;  1NJI C;  4LF4 Q;  2F52 A;  5C4X G;  4R4C A;  4A3E G;  4JG2 A;  5K36 G;  2A19 A;  1I94 Q;  4JI1 L;  3BU2 A;  2R6G A;  4GKJ Q;  3PO2 I;  4IOC A;  2L15 A;  1KQS A;  2ZM6 L;  2CKZ B;  2YV5 A;  3BZK A;  1DGS A;  3KDF B;  2JA7 G;  3I4N H;  5M5W H;  4A3C H;  2VS1 A;  2JA7 I;  4P75 A;  1YEZ A;  1QVG A;  4XIG S;  3F2B A;  2UU9 L;  4LFB L;  3KDF A;  1HH2 P;  4NOZ A;  3AFQ A;  5C44 H;  4JOI A;  4A76 A;  1M90 C;  3TS2 A;  4A3J I;  4LF7 Q;  4BA1 I;  3CCR A;  1PVO A;  3GTO H;  3CCS A;  4L5Q A;  2KPI A;  3UDF A;  4HIM A;  3GTJ I;  4UP7 A;  2EIF A;  1PH1 A;  2R93 H;  1EYG A;  5C4J I;  4PZ8 A;  3NEN A;  2GVA A;  4JI6 Q;  1HZB A;  2JA8 H;  1CKM A;  3EER A;  1N34 Q;  5LMN L;  1ZB8 A;  3M3Y I;  3A5Z B;  2PMZ E;  2UXB Q;  1VQF A;  1Y1V H;  1N9W A;  3KF8 B;  5IP7 I;  1OXX K;  3I4N G;  1YBY A;  1HNZ L;  3S1M I;  2LXK A;  2JE6 I;  3PIO A;  5FLM H;  1BBW A;  4A3K H;  4NBH A;  3K7A H;  4ALP A;  2UUC L;  2ZJR A; 
#chains in the Genus database with same CATH topology
 4AYB E;  4CHT B;  5ELE A;  3CCM Z;  3CC7 1;  3H3V J;  2IJ0 A;  3JAM b;  1VLA A;  1KQS Y;  2DY8 A;  3VDY A;  5COR A;  3CQZ I;  1PFM A;  2DJF C;  5C44 G;  2R92 G;  1VQL 1;  4DV4 L;  1WTW A;  2A1A A;  3ZYY X;  3S15 H;  4ME5 A;  1KC8 1;  5ELO A;  1SIW A;  2VY3 A;  4DR4 L;  2BH8 A;  2WKC A;  1ASZ A;  2NVX I;  1VQ8 A;  4YY3 L;  4KHP L;  1VQO Z;  4LF8 Q;  2R92 I;  1Q7Y 2;  1SYE A;  2EGT A;  1BO0 A;  5LMU L;  1PRT F;  2Y0S A;  3PO3 S;  1RJT A;  2QEJ C;  3D4W A;  5I9P A;  4M1U B;  1XNQ L;  4K6D A;  3CC4 1;  1FGB D;  3MON A;  3A7A B;  1QVG Y;  1SNO A;  2B63 I;  2R93 G;  4NFR A;  4CDD C;  1I4Q A;  3OOC A;  2AQ1 B;  4R9W A;  1NAP A;  1KDC A;  4RVG A;  1WCM B;  3I4M B;  2R7Z B;  1VQB A;  4A3D H;  3I56 Z;  2B2W C;  5I6W A;  2Z6B A;  4DF7 A;  1G8Z D;  2JA8 G;  1EWI A;  4P74 A;  3HOZ I;  3W5O A;  3P5J B;  3K0Y A;  2TSS A;  4B08 A;  3RZD I;  5K5P A;  5CGK A;  1VQ7 1;  2QLV B;  1M1K C;  1OXV A;  2E75 C;  5JJL A;  1VQI A;  1YHB A;  5BN3 A;  4A3G B;  2OWO A;  1G51 A;  5D65 A;  1YIT 1;  1BCP C;  3GO5 A;  2K5H A;  2V45 A;  1U4P A;  1EY5 A;  4XQJ A;  1E2Z A;  1ICW A;  3J7Z C;  2O5J C;  3IRB A;  4AQY Q;  5FLM G;  3AQQ A;  3GTP H;  2SEB D;  3G4S 1;  2M6N A;  4C3H B;  3L7Z C;  5GQO A;  2TMP A;  2L1B A;  4DR3 Q;  4RCN A;  3PF4 A;  4OX9 Q;  1OXT A;  2F0Q A;  2FHT A;  2ICE C;  4E2Z A;  3HOY I;  4A3M H;  3V2T A;  3HOX B;  2ZTE A;  4QUC A;  2AQ2 B;  3Q23 A;  1J5E Q;  5CV9 A;  4JI3 Q;  3ND9 A;  1YJW Z;  2OTJ 1;  4C2M B;  1P16 A;  2IW3 A;  2KED A;  4FXG C;  3CCJ Z;  1TWH B;  5CBE E;  3GTK H;  2ZT9 C;  4BY7 H;  3K5L A;  1Z03 A;  3TN2 A;  2ZJP A;  1NJI 1;  3KJO A;  1CKO A;  2LSS A;  1UWV A;  1V8Q A;  3S2H H;  2LS0 1;  3CCV Z;  1Q8I A;  4RFB A;  1I4X A;  2Z9H A;  2N78 A;  4DAP A;  4OO1 H;  1H9K A;  3ICE A;  1HXY D;  1TWG B;  1AFP A;  2A8V A;  2B2Y A;  5EJW A;  2VQF Q;  1JQY D;  4Q5V A;  2VPW A;  2XNA C;  1FDO A;  2R6M A;  1I5F A;  2K5Q A;  4R4O A;  5CYU A;  5CV8 A;  1ASY A;  4PMW A;  2HT1 A;  1EIG A;  4DV6 L;  3S14 B;  2E9H A;  1SXT A;  1EU4 A;  2XSC A;  4YCU A;  1SE2 A;  4XDX A;  1BBX C;  3A54 A;  4KY7 A;  1U9R A;  5C0X J;  1K8A 2;  4PZ7 A;  4H44 C;  1BOS A;  3ITP A;  5M3F B;  2ZJQ A;  3OHX C;  2D2C C;  5GRO A;  3F3P C;  4IOA A;  4C1N I;  5D3D A;  1DZ1 A;  4KY5 A;  2MO1 A;  4CKC A;  4A93 H;  1KLU D;  1EQR A;  1QG7 A;  2AUJ D;  1DM0 B;  4JI0 Q;  2DGY A;  1Q16 A;  1SE4 A;  2WB1 E;  1M90 1;  1VQH A;  4BS9 A;  5CV6 A;  2QKI C;  4N9T A;  4DV3 Q;  3S24 A;  2K04 A;  4WJ4 A;  2O2L D;  5M3M B;  1VS0 A;  3HKZ G;  3CCE 1;  3PCO B;  4A3M G;  2F0U A;  1YJ9 Z;  4MZ9 A;  1UNS A;  3H0G G;  1F2M A;  1PA6 A;  1QVF A;  4HGZ A;  2QA4 Z;  2MFI A;  1PZK D;  1B9N A;  2WV6 D;  4K6L A;  1JB3 A;  2R7Z H;  3H0G I;  1C0A A;  1FYC A;  4MNO A;  1XTC D;  2A5H A;  2QEX Z;  4NBB A;  1IBM L;  1EUJ A;  1T5X D;  2IZ3 A;  1WTX A;  3G48 A;  4OO1 G;  1KC8 2;  3MZ5 A;  4U68 A;  3BS1 A;  5LL6 S;  2NVY I;  3G6E 1;  3NH5 A;  1G2S A;  4A3I B;  4DV2 L;  5DNF A;  1XNR Q;  3HOV G;  1AN8 A;  1FGU A;  4APV A;  3HEJ A;  5IGE A;  2BE5 D;  4GNX B;  3FEW X;  2FMM A;  3PUZ A;  3BVZ A;  1WTO A;  1Z6H A;  1TY2 A;  1WD0 A;  3HOV I;  3P7J A;  2ZAE B;  1J8I A;  4P2C B;  1EQV A;  2VQE Q;  2XWJ B;  1YJN 1;  1QZH A;  2F0K A;  2Y0S E;  2GN5 A;  4IO9 A;  5IT9 E;  4X64 L;  1HCZ A;  1CK1 A;  2CQO A;  3W2D A;  1GUO A;  4C1N K;  5BR8 L;  5LL6 f;  2K5V A;  4AIM A;  1BUV T;  1HTL D;  3I4O A;  3NBI A;  1Y8O B;  3D4R A;  4GOP C;  2YU9 I;  4DR1 Q;  1K3R A;  1EYD A;  3TZD A;  2E2I H;  4A93 G;  1S3O A;  1D2B A;  4UP8 A;  1S72 Z;  5COY A;  4Y7N B;  2ZXR A;  3O13 A;  1CQF A;  4NKL A;  1PHJ A;  4A3B I;  3L2P A;  1ESR A;  1JOK A;  2MJ8 A;  1SYC A;  2J4X A;  4TQU S;  4AQY L;  1IZ6 A;  3M4Y A;  1GHJ A;  2LIY A;  4YCV A;  3FHW A;  1QNU A;  1A6X A;  3M4O B;  4A4I A;  2RKS A;  4B3T L;  1QXF A;  1X55 A;  2K28 A;  1PTO C;  1C8C A;  1DON A;  2EYH A;  4BBS H;  4RGM A;  2P3Y A;  1IHZ A;  2Z4H A;  3JC6 6;  1WYD A;  1QZG A;  2NAP A;  2A68 C;  4JI4 Q;  4JI3 L;  4WOR A;  3OMC A;  1SFO I;  2I5M X;  1JJ2 Y;  2IPK D;  5C0X H;  1JOR A;  1IBL Q;  3PO2 B;  3HOW G;  2G9H D;  5ELD A;  1VQO 1;  1S4Z A;  2JYO A;  4C3I B;  4OL7 A;  3KIF A;  4OWW B;  4FVM A;  4HSP A;  2UXC Q;  1Z9F A;  1QOH A;  1EEI D;  1B44 D;  1FD7 D;  1LYL A;  2A6E C;  1W2B Z;  4NDX A;  1NJI 2;  3HOW I;  3CXC A;  4KN4 C;  2N49 A;  3GTM S;  1B8A A;  5M3F H;  2KEC A;  3PUX A;  1Y1V S;  3VA5 A;  5I4D A;  3PIP A;  5J3B A;  2DE6 A;  2JA7 B;  3K59 A;  4KHZ A;  1QVF Y;  5FLX L;  4TKO B;  4RVF A;  2I3C A;  1Y1W H;  2EDG A;  3I56 1;  3QJY A;  2EXD A;  2JIM A;  1Y14 B;  3OTO L;  1WTP A;  2E8G A;  3J81 f;  1EY4 A;  1IBK L;  1P9N A;  5E1F A;  4DAY B;  4L5S A;  2Z8L A;  3GCF A;  3G71 1;  1EYC A;  5T67 A;  2JS4 A;  3EIV A;  1PYB A;  3J80 b;  2F4V L;  3M85 A;  4JI1 Q;  2L9H A;  1D5Z C;  4A3J B;  1IL2 A;  3K0X A;  4FO2 A;  1PV4 A;  2ZM6 Q;  5IOD A;  1QJO A;  3IKJ A;  3S16 I;  2RDH A;  2CQA A;  1LTR D;  1NR4 A;  1BBU A;  2KOL A;  1Z7T A;  4MH4 A;  2V8I A;  3GTJ B;  3Q8D A;  1L1O A;  1SNP A;  1KLG D;  1AH9 A;  1RQF A;  4NXN L;  1X3W A;  3JAM E;  5C4J B;  2DE5 A;  5FLX b;  1G91 A;  2JIR A;  3CCU A;  2WAC A;  1PRT D;  4X3K A;  2ATW A;  1MJC A;  4O1N A;  5DLQ E;  2M9V A;  4HN7 A;  4BBS G;  1M90 2;  4JVZ A;  1SMX A;  2UU9 Q;  4LFB Q;  4TSS A;  2F03 A;  1Q81 C;  1LAB A;  1YJW 1;  1FJG L;  4X62 Q;  4XQN A;  2EYF A;  3D9X A;  3J7A 5;  3M3Y B;  1WTV A;  2RF4 A;  2AQ3 B;  1J6Q A;  3SK6 A;  4ZKC B;  3CMA Z;  2L11 A;  4NH1 C;  5DEH A;  2A6H D;  1EOT A;  4NBE A;  1AW7 A;  3W1G A;  3ZJY C;  3M7G A;  1VQ9 Z;  1HA6 A;  2AMC B;  1TWF I;  3CCV 1;  1NUI A;  1AE2 A;  2KCT A;  1KDA A;  2EY5 A;  4N8F A;  3SR1 A;  4RMF A;  3S1N H;  3GTL I;  4EQ5 A;  1L0X B;  1QWY A;  4FXD A;  1EL0 A;  1JR0 D;  1JMC A;  3S1R H;  2F3I A;  1WW9 A;  3N6R A;  2NTT A;  4HH4 A;  5I9O A;  1ENF A;  2K33 A;  3NBH B;  5I2Y A;  3BZC A;  3P75 A;  3BDL A;  3RUZ A;  2AHO B;  2JN4 A;  3CC7 A;  1DYQ A;  4AYB B;  3T53 B;  3TDQ A;  4Y7N H;  1I50 H;  1R9T I;  4GZY C;  3TP5 A;  1VQL A;  3CQZ B;  1RKN A;  4S1T A;  1X3P A;  2E2J I;  1I4G A;  1QCB D;  1T5E A;  1Z47 A;  3PUV A;  2OT2 A;  4EVO A;  1DL6 A;  3PO3 G;  4IFD H;  2K5W A;  2G9D A;  1TWC B;  2JA5 I;  4IUQ A;  3NBH A;  2NVX B;  4KMU C;  3OW7 A;  5FKA C;  1KXL A;  2MPM A;  3PO3 I;  3PF5 A;  2XGT A;  1Q86 1;  4DR1 L;  1R4Q B;  4E30 A;  4IUN A;  4DNR B;  4G4K A;  3CC4 A;  3OW2 A;  1G6Z A;  1HNZ Q;  3NTK A;  3IAY A;  3DUZ A;  1KNE A;  2R7D A;  4K5W A;  3BJU A;  2B63 B;  5G3L F;  1MHW C;  2VUM I;  1NR2 A;  2UUC Q;  1ZXT A;  1YJ9 1;  5C3E B;  2UUA L;  1VQG A;  2XRQ D;  4BBR B;  2B2U A;  5IP9 H;  3HOZ B;  5TSS A;  5FLX c;  2BDO A;  4G57 A;  2QA4 1;  4DV4 Q;  4NB8 A;  5I2X A;  3MA2 B;  1E24 A;  4JI4 L;  3RZD B;  2RSN A;  2NVT H;  5AN9 F;  1VQM Z;  1EZ8 A;  4DR4 Q;  2F0E A;  5LMN W;  4YY3 Q;  4KHP Q;  2H1E A;  1YIT A;  1H9M A;  3E3X A;  2QEX 1;  1YUA A;  1I4H A;  5LMU Q;  4I7A A;  1OXU A;  1JJC B;  3HZX A;  2F0D A;  3VR3 A;  1XNQ Q;  1EEF D;  3CC2 Z;  4CBV A;  3G4S A;  5M5X B;  2M00 A;  4R4I A;  3G7L A;  5JVH 3;  3C2P A;  4IPH A;  3IR7 A;  1SNC A;  5M5Y B;  4KI0 A;  3HOY B;  2GVB A;  2IL8 A;  3DWA A;  3RNU A;  1HR0 Q;  4WRD A;  1I6H B;  5CMD A;  1JWH C;  4B3S L;  1AP0 A;  1WFQ A;  2E74 C;  1PDQ A;  1M1K 2;  1VQN 1;  3E5S A;  2OTJ A;  1PMR A;  4EGV A;  4BY1 H;  1AE3 A;  1LLR D;  5EKL A;  4EQP A;  1TWA I;  4MD9 A;  5C4X I;  3BDC A;  4OXP A;  1Y8N B;  4E2Y A;  4A3E I;  1GUS A;  3I70 A;  3GV6 A;  3MZK B;  2A73 B;  3KLS X;  4DK0 A;  3K5O A;  4HCE A;  2RSO A;  5E4X A;  3T4A C;  3PMF A;  1F9Q A;  5JPM C;  1S72 1;  2OOX B;  2FJ2 A;  1Q1E A;  4J6H A;  3TSS A;  1IYJ B;  1ET9 A;  1TKW B;  2ZJR A;  4DV7 L;  2YYZ A;  1LTS D;  1AZP A;  1H9S A;  4I7Z C;  2QDB A;  5GAD C;  5FJ8 H;  4LFA L;  2RDG A;  1GKH A;  1OXS C;  3GV3 A;  5JEA J;  4A3F H;  2HDL A;  3ULJ A;  1EFI D;  2LY7 A;  2N8N A;  2B2V C;  3UI2 A;  3URY A;  3S9W A;  5ISR A;  4LW1 A;  4P73 A;  4KJO A;  4X62 L;  3TEH B;  2MNA A;  2QF7 A;  4MTN A;  4QTU A;  3OW2 Y;  2XWB B;  3EQL C;  1DOK A;  3A74 A;  3RZO H;  1V43 A;  3R2I A;  5ELF A;  1F9R A;  3A8K E;  1UE5 A;  2LKV A;  2FFK B;  1X3Q A;  1JJG A;  1GD7 A;  3FKI G;  3CME A;  2VB2 X;  2ZTD A;  4Y52 H;  3GTQ H;  2WB1 B;  1EY8 A;  1TWC H;  4K5V A;  2NZH A;  4X6A H;  2PQA A;  3FKI I;  3GTG I;  3AB9 A;  2EPB A;  2E76 C;  3CCE A;  1HZA A;  2KQ3 A;  1I3Q I;  1SR3 A;  1JOO A;  1RL2 A;  4GN3 B;  2PZT A;  4DV6 Q;  2F0M A;  4E6I A;  4EQO A;  2PZU A;  1NTG A;  5A2Q b;  1SSO A;  4BY1 G;  1BCP D;  2JEA I;  4B9W A;  4RGN A;  4QGU A;  3STB C;  1K8G A;  3K6O A;  4DUY L;  1A2U A;  3E9I A;  4DFA A;  4GLX A;  3T1Y L;  3H0G B;  2M2L A;  1JT8 A;  4KKT A;  5E7N A;  3GTM H;  2YTY A;  4RA8 A;  2Q2U A;  4UPA A;  2J7Z A;  3BZD B;  4XT1 B;  2OEO A;  5C3E H;  4FP5 D;  1NUC A;  4BBR H;  1RF2 D;  2NBF A;  4K2L A;  3G6E A;  4JI5 L;  3HKZ A;  2NVY B;  3HFZ B;  1TR5 A;  4KLK A;  4A3C G;  2WAQ G;  2OXP A;  4JI2 Q;  3VYS A;  1A0I A;  1UAP A;  2L12 A;  3QIA A;  1ICF B;  4EQN A;  2QGQ A;  3I4N I;  5DM7 3;  3HOV B;  1WD1 A;  5FJ8 G;  4A3C I;  3UDG A;  4OWT B;  3U9O A;  3NDI A;  4OIK A;  3ND8 A;  4A3F G;  3S1Q H;  4DR5 Q;  2NN6 H;  3ONA B;  4NB3 A;  1VQ8 Z;  2X6G A;  2Y0S B;  2GTI A;  4QF4 A;  4RGT A;  2F0S A;  2JJQ A;  4DV0 L;  4X3T A;  2B2T A;  3UDX A;  1HUM A;  3IF8 A;  1TY0 A;  4RHR A;  2JUB A;  2MUY A;  3CMA 1;  5EQ0 A;  3F2C A;  1B53 A;  1X32 A;  4J8Q A;  1Q82 C;  3T56 B;  1I6H H;  3I90 A;  1VQ9 1;  4S3S A;  5C44 I;  2YU9 B;  1IBM Q;  1O7L A;  3H3V C;  1V9P A;  2KHJ A;  1K3B C;  4A3B B;  2EOT A;  3GTO I;  1Q8K A;  4DV2 Q;  4L6T B;  2NB0 A;  4IPD A;  1K9M C;  1V1P A;  1VDZ A;  1VQJ A;  1GJX A;  2VXW A;  1NBW A;  2E2D C;  3WOF A;  3J80 E;  3F8T A;  3CD6 Z;  3I55 1;  3MAQ A;  1PH9 A;  5JJZ A;  3MZL B;  1AZQ A;  1K8M A;  3BG3 A;  2R93 I;  4K5X A;  4LF9 L;  3I8Z A;  1HR0 L;  1K83 H;  5IGF A;  4FF2 A;  2E5L L;  3HP3 A;  4O2D A;  4DXG A;  1JWU D;  1Y69 U;  1GHK A;  1HHV A;  1B1Z A;  4IJL A;  4X64 Q;  4A3L H;  3Q24 A;  1SFO B;  1E1T A;  5FO8 B;  5BR8 Q;  3FRP B;  1PH8 A;  2JA8 I;  2DE7 A;  2O4H A;  1VQO A;  4DNT B;  2JA6 H;  4EWC A;  2QRC B;  2K5N A;  5C3W A;  1B50 A;  1Y1V G;  2K5D A;  4C3J B;  2IT1 A;  4KY6 A;  3KLR A;  5FLX E;  1HTP A;  3ERS X;  3CKI B;  1PZJ D;  2KBN A;  2PYK A;  2AKL A;  1Y1V I;  4WJ3 M;  3HOU H;  4X65 L;  5KGU A;  4LMQ D;  2BCO A;  4A3K G;  1II3 A;  5IGG A;  3MTS A;  3DWP A;  4B3T Q;  3I56 A;  4K14 A;  1LM0 A;  2PW7 A;  2NZO A;  3GP7 A;  1HQM C;  5FLM I;  4DV5 L;  3L0O A;  2NN6 G;  4MTK A;  3G71 A;  4A3K I;  1B70 B;  2CW0 D;  2KHI A;  3MHB A;  4DAV A;  1F2L A;  5AFW A;  5C5L A;  3K7A I;  3CCL 1;  1SLJ A;  1L0W A;  4JBJ A;  1LT6 D;  2JNY A;  2NUC A;  2NVQ H;  2D9U A;  3P20 A;  4RVH A;  2ID0 A;  1N2F A;  3S17 H;  1VQM 1;  1LTA D;  1PFB A;  2P28 A;  4HGY A;  1ZKO A;  4B3R L;  1MD2 D;  1TS4 A;  1D7Q A;  1VQK Z;  3VYT A;  2D0P A;  1TU2 B;  2HD3 A;  1VQ6 Z;  1YHQ 1;  3C46 A;  4F87 A;  1STN A;  3CC2 1;  1X65 A;  2OF1 A;  4GS3 A;  3S2D H;  4GKK L;  4EX5 A;  4NBF A;  1M4V A;  3I72 A;  2ES2 A;  2Z6K C;  3K57 A;  4RGO S;  2Q2T A;  2OTL 1;  3MEF A;  2F0P A;  4C56 C;  4G7Z C;  1MIU A;  1VQC A;  1EWH A;  4A3D G;  4FYD A;  1KDB A;  4LNQ A;  1PXU A;  3IFU A;  2B2Y C;  2HCI A;  3OTO Q;  2RCF A;  1IBK Q;  2CH4 W;  1YJW A;  4OON A;  3SVM A;  2ASB A;  4A3L G;  2HU9 A;  5G3L D;  3NFZ A;  4A3D I;  1CHQ D;  1LT5 D;  2F4V Q;  4UP9 A;  3H3V H;  3TBI B;  4K2K A;  2JA6 G;  1XPR A;  3E0J A;  2IHE A;  1Z02 A;  3CCV A;  3HKS A;  1EY9 A;  1TWF B;  3BYY B;  2V4D A;  5IE8 A;  1JC7 A;  3GTL B;  1JJ2 A;  4BA2 I;  3VTN A;  2H4O A;  1Y8P B;  3OMG A;  1PTO D;  4JBK A;  3TDH B;  4DGZ A;  4OWX B;  3HOU G;  4NXN Q;  1G2T A;  5IGB A;  3T13 A;  4DQY B;  3J7A F;  1JE5 A;  4JI2 L;  2A68 D;  1D6E C;  1LV9 A;  2IZ4 A;  2JSO A;  2ZXP A;  4XXE A;  2Q8R E;  4OIJ A;  1SJE D;  2RA4 A;  1Q81 2;  4QJF A;  3NH8 A;  2R61 A;  3L9A X;  3GTP I;  5HGQ A;  1R9T B;  2GA4 B;  4LUZ A;  4DR5 L;  2KCM A;  1DCZ A;  4QTT A;  2E2J B;  1IKL A;  2A6E D;  5D3I B;  1FJG Q;  3HKZ E;  2B8F A;  1VMP A;  4R4Q A;  3BG0 B;  1JE4 A;  1XTD A;  4A3M I;  3CRL C;  1FDI A;  4BY7 G;  1CT1 D;  2JA5 B;  5FO7 B;  1XJV A;  1WCM H;  2IX0 A;  1Q3L A;  2BDN A;  1Y8C A;  4DR2 L;  3I4M H;  2Q51 A;  1VF7 A;  2HIV A;  2RHS B;  3GTK I;  4BY7 I;  2AKW B;  3CPW Z;  1PH3 A;  3LWE A;  4ZUI A;  4NP5 A;  2LFN A;  3X3N A;  3S2H I;  3LX0 A;  2HHH L;  3UE0 A;  1WVL A;  4K8I A;  1P8L A;  1MI2 A;  5H1S E;  2VUM B;  3BG1 B;  1V1O A;  4OO1 I;  4IUT A;  4A3G H;  1YJ9 A;  1KIX A;  4H13 C;  3TME A;  1C48 A;  4QB4 A;  4BXX H;  1ROD A;  1PYW D;  3HRZ C;  1LQL A;  1RCV D;  4UHV A;  2BA0 A;  2QA4 A;  1VQ4 A;  1L2F A;  3TE5 B;  4IUR A;  5JJK A;  3Q22 A;  4P72 A;  4JV5 Q;  5FK9 C;  5AJ3 L;  4TNU A;  2LFU A;  1VQ5 Z;  4RAU C;  4C3H H;  1EFW A;  3OPO A;  3K7U C;  1O78 A;  1IKM A;  4L8J A;  2QEX A;  1EQT A;  1SYD A;  2I0Q A;  4HAE A;  3HOX H;  1X3Z A;  4GNX C;  5JOB A;  1CHP D;  4R4T A;  1N32 L;  3QOL A;  1W6K A;  4LWC A;  1RO4 A;  4JCV E;  4C2M H;  2W04 A;  3KK7 A;  3NWS A;  1TWH H;  2F4M A;  2F0V A;  5DAU A;  3MWY W;  2PO4 A;  4A93 I;  3K80 C;  4GOP A;  3K8A A;  4PV1 C;  2MO0 A;  5IYD H;  2PPB C;  1Q82 1;  4RWS C;  2JR6 A;  4QY7 A;  2UUA Q;  1VQN A;  3TP8 A;  3RR5 A;  3VB9 A;  1VQ8 1;  1CFM A;  3CCM 1;  2QCP X;  1TWA B;  1TWG H;  5C4X B;  4HR7 B;  1M8A A;  3PIO 3;  1WCM G;  1K0R A;  1MBY A;  5EBD A;  3I4M G;  4A3E B;  3CXC Z;  2CHB D;  3MVV A;  2L4N A;  3SHL A;  2R7Z G;  1SRO A;  5NUC A;  5J22 A;  2UXD L;  1VQP Z;  1JB7 A;  3S14 H;  2NTS A;  3DEP A;  1YI2 Z;  2R7Z I;  1A15 A;  3J81 L;  5KRU A;  5M9O A;  3M7N A;  1HQR D;  4CDF C;  1A8V A;  3EBE A;  1CA5 A;  5A2Q E;  3AYH B;  4A3G G;  2IWH A;  5IYC H;  1M1K 1;  5KEE A;  2LXJ A;  4BXX G;  3CD6 1;  3A5U A;  4DV1 L;  2PZW A;  4B3S Q;  4H0L C;  4GLV B;  3WWV A;  1HRJ A;  1B2T A;  1L1O B;  2VNU D;  2KJX A;  3KLW A;  4C3H G;  1L0Y B;  1W6J A;  3HS0 C;  3C1E A;  3CRK C;  3CU7 A;  1PZI D;  4XTC S;  1ESF A;  5M3M H;  3OWF A;  4LJZ C;  3HOX G;  2N88 A;  2V1C C;  4M8A A;  2BOS A;  1QVC A;  1YZ6 A;  2XVS A;  4NBC A;  3J81 b;  1U4M A;  3CCU Z;  3TP6 A;  1A2T A;  1KHI A;  3RLF A;  2KEE A;  2FXQ A;  3MFY A;  2WIN B;  3CCQ Z;  4NPS A;  2E2I I;  1NMF A;  1V1Q A;  4DV7 Q;  1WTR A;  4K0K Q;  3FKI B;  3GTG B;  1RHP A;  2PNR C;  5IYD G;  4OGQ C;  3PSI A;  2I5H A;  3H94 A;  4YHH L;  2ENB A;  2MP1 A;  2KCN A;  1OTC A;  4LFA Q;  4HJ8 A;  1S7M A;  4IPG A;  2F0I A;  4ZRZ A;  3Q0A A;  2UUB L;  1NE3 A;  1D5M C;  5KNC A;  1SYF A;  4TRD A;  4A3I H;  1BR9 A;  4DKA C;  1BF4 A;  5C0X G;  2A69 D;  3CCJ 1;  4BBS I;  4RHS A;  1TT2 A;  1JWS D;  1GOZ A;  3BDO A;  1VQK 1;  3H09 A;  3VR2 A;  3KFU A;  5C0X I;  3J81 j;  3A0J A;  1USP A;  1VQ6 1;  1EU3 A;  3QWN A;  4UAI A;  1ENC A;  3S1M B;  1I6V C;  5M3F G;  4JI7 L;  2SOB A;  2F0N A;  3U4Z A;  3W1B A;  2H85 A;  1S40 A;  1NMG A;  5IYC G;  2EYP A;  2F4I A;  3I4N B;  3RN2 A;  1C9O A;  5E3F A;  1YNN C;  2ZTC A;  4IAL A;  2MGS A;  5M5W B;  2WAQ B;  4UY8 C;  1Y1W G;  4ODG A;  1AA6 A;  1YNJ C;  4ZLT F;  3NEM A;  3MXN A;  3M4Q A;  1Y1W I;  3PGZ A;  4DUY Q;  4CL1 A;  1K28 A;  3T1Y Q;  2IY5 B;  1BKB A;  3M4O H;  3CMA A;  4JV5 L;  5M3M G;  3NSW A;  4KV6 A;  1VQ9 A;  1YIJ Z;  2WAQ A;  4RS4 A;  2N55 A;  3SDZ A;  1QB5 D;  5C44 B;  2R92 B;  4KK7 A;  3VMI A;  1YHA A;  1GUG A;  4JI5 Q;  1S5B D;  4MN3 A;  2H5X A;  3GTO B;  2V8K A;  4F88 A;  2WII B;  4HIO A;  1N36 L;  1BQQ T;  3PO2 H;  4HID A;  3I55 A;  3J81 c;  3U4V A;  4C3I H;  3J81 i;  1TII D;  1HFN A;  2X6L A;  1XPU A;  2R93 B;  1A3T A;  2CH4 A;  2DNE A;  3I91 A;  1QUQ B;  3GQB A;  5EPJ A;  1EIH A;  4A3I G;  4DA2 A;  4DV0 Q;  1Q82 2;  2RQX A;  2HF1 A;  1STA A;  1PRT B;  2EYM A;  2F0L A;  2JA8 B;  3FP9 A;  1VQ7 A;  4X66 L;  3U50 C;  2JIO A;  2JA7 H;  1TXY A;  1SAP A;  4ZK9 B;  3G4S Z;  5A35 A;  1YUK A;  4JI8 Q;  1K9M 2;  2QDL A;  1QUQ A;  3EA6 A;  4L5R C;  1GVP A;  4FF4 A;  1K0S A;  3VR6 A;  1HNW L;  3S1N I;  1F9P A;  2K05 A;  4ZCK A;  2R3Z A;  4A3J H;  1RTO A;  3STB D;  4A75 A;  2KEN A;  1E2W A;  4NXM L;  2K03 A;  4B3M Q;  2WP8 J;  3S1R I;  1HFG A;  4JBM A;  3HG9 A;  4A3K B;  4LF9 Q;  2ALY B;  3GTJ H;  2E5L Q;  1X54 A;  3CCL A;  1KQS Z;  1GO3 E;  5IT9 L;  1SJH D;  3DHQ A;  1VQM A;  4QQB X;  1XWE A;  4IFD G;  4U67 3;  4RG1 A;  5C4J H;  1WOC A;  4XT3 B;  4Y7N I;  1I50 I;  4RCO A;  4DR7 Q;  1VQ5 1;  2DY7 A;  3Q6S A;  4NBA A;  1LTT D;  3I4L A;  2VF1 A;  2F0F A;  2B29 A;  1H9S B;  4L5T A;  4IFD I;  4ILW A;  4HJA A;  1YHQ A;  2JIQ A;  1OO9 B;  2E2H I;  3Q87 A;  3CC2 A;  1S5E D;  5IT9 f;  1PLF A;  5EKK A;  1XMQ L;  1TS2 A;  1IXR A;  4QL5 A;  1ZYR C;  2CFM A;  4X65 Q;  2C5C A;  3CF5 A;  1EIY B;  3DLL A;  3M3Y H;  1QVG Z;  4IPC A;  3PO2 G;  3HGB A;  2OTL A;  4K0K L;  1F2Y A;  2DJG C;  4C3I G;  3D2L A;  4JC0 A;  2C35 B;  4DV5 Q;  1HNX Q;  4O42 A;  2AUK A;  5IP7 H;  1GM5 A;  1HUN A;  1CA6 A;  1SMY C;  1ZH1 A;  5IP9 G;  3IFT A;  3S1M H;  5IT9 b;  4A3D B;  3MXP A;  1Q46 A;  3CCR Z;  1H9R A;  1O80 A;  1WJJ A;  1HR0 W;  2PK7 A;  2PW5 A;  1ENA A;  4XX2 A;  3CCS Z;  1YVC A;  5IP9 I;  3CME Z;  2EYL A;  4NB9 A;  2PQA B;  4HMI A;  4B3R Q;  1KAB A;  1SYB A;  4N9P A;  1VQP 1;  3SEB A;  2NVT I;  4DUZ L;  1SBB B;  4JOI C;  1YI2 1;  1K73 C;  1XMO Q;  3CQZ H;  1PH2 A;  2PNH A;  4GKK Q;  5KND A;  4A3J G;  4R8N A;  2SNS A;  2W03 A;  4JK1 C;  2NVX H;  1CZG A;  1SE8 A;  3VR5 A;  1ZB9 A;  1S5F D;  4F8M A;  2R92 H;  4DK3 C;  3GTP B;  2PQE A;  3KOJ A;  4HTH A;  2HIX A;  1B7Y B;  5EPK A;  4XQQ A;  3VR4 A;  3HKZ B;  2B63 H;  4A3M B;  1KRL A;  1UUP A;  2V3V A;  3W3A A;  4E33 A;  4FF1 A;  2VUG A;  4HJ9 A;  3D0F A;  2PCF B;  1E3P A;  4KD4 A;  2F1M A;  4N8X 1;  4E31 A;  3PIP 3;  4BY1 I;  1D1I A;  1F77 A;  4KKU A;  3H15 A;  1SRU A;  3GTK B;  2FIN B;  1B3Q A;  3D8G A;  4CJ2 C;  3D31 A;  3OWE B;  1LT4 D;  4HJ5 A;  1HA5 A;  5JJI A;  2F0O A;  3AMU A;  3HOZ H;  4XYO A;  3S2H B;  1STY A;  1PH7 A;  1Q81 1;  3NTI A;  4I65 A;  3CCQ 1;  3RZD H;  2EY2 A;  1VQE A;  3JAM L;  4IQZ A;  4LFC Q;  3R3O A;  2JMO A;  2PM9 A;  4PG3 A;  2G2K A;  1XX8 A;  3RLO A;  5IP7 G;  1N33 L;  2WAQ E;  5D1O B;  4KKS A;  2NZ1 D;  1YJN A;  1E7Z A;  2GTH A;  3K58 A;  1PFS A;  1IW7 C;  5M5X H;  4X3S A;  2AWO A;  3JAM f;  4NBG A;  1DOL A;  2A74 C;  2I5L X;  4A3F I;  1V1P B;  5IIF A;  2IX1 A;  3EED A;  1VCI A;  4DR2 Q;  1G29 1;  1RTN A;  5M5Y H;  1X6O A;  3EVQ A;  4O0A A;  3WOE A;  4LF5 L;  1LTB D;  3HOY H;  4AYB G;  5IT9 c;  1PH6 A;  5D1O A;  5ELN A;  4JI8 L;  1E1O A;  1UE6 A;  4DR6 L;  2D0O A;  3PV0 A;  3RZO I;  1STB A;  3J7A 4;  1O7I A;  2F0G A;  2HHH Q;  1AEX A;  4YWM A;  4GN4 B;  4A93 B;  4UDU C;  5E4W C;  4JYA Q;  1U5K A;  2M48 A;  3VMH A;  2I07 B;  4OEL B;  4QUF A;  4Y52 I;  4IJH A;  3B6Y A;  3GTQ I;  4X3U A;  4B3M L;  1NSN S;  1TWC I;  1XPO A;  4X6A I;  3RN5 A;  3CCM A;  5CV7 A;  5T6B A;  4RKL A;  5LHY 1;  2RPR A;  4LF6 L;  3F3F C;  2F0J A;  2B63 G;  3F2U A;  5JEA H;  1KD1 C;  1PFT A;  5AJ3 Q;  3E9H A;  1A63 A;  1U4L A;  1RDP D;  3J81 E;  4F7X A;  1GXD C;  2ZXO A;  4DR7 L;  2P5Z X;  1A3U A;  4B9X A;  1KAW A;  2B2W A;  5EKI A;  1YIJ 1;  1BCP B;  2WFW A;  5IGC A;  5CV4 A;  5C3E G;  2YTX A;  2K5R A;  1WII A;  2O53 A;  4BBR G;  3HOZ G;  2RIQ A;  4LF4 L;  1N32 Q;  1J9O A;  1LUZ A;  3HOW B;  3GTM I;  3EJI A;  2F3W A;  1KRT A;  5C3E I;  4DU9 A;  1FNV A;  4BBR I;  3G71 Z;  5J1Z A;  4MHE A;  4CKB A;  1YNX A;  2JQO A;  1FVI A;  5C4Z A;  2XTI A;  1MJE A;  3CD6 A;  1EZ6 A;  3U58 A;  3X3M A;  1VQA A;  1I94 L;  3NXW A;  3ULP A;  5EGT A;  4MD7 A;  2YAD A;  1HNX L;  4PZ6 A;  4GKJ L;  1DXM A;  1KRS A;  2D62 A;  3MXG A;  2VB3 X;  2MQH A;  1GUT A;  3S1Q I;  1W3S A;  2NN6 I;  2RHQ B;  3AFP A;  2EJG C;  2EY1 A;  4H7B A;  4PQX A;  2UXD Q;  3HOY G;  4PMB A;  3PUW A;  1CSP A;  3EN2 A;  3S16 B;  3GDE A;  4HJ7 A;  1TFI A;  4MON A;  3S15 I;  4IUU A;  1T9H A;  3ERO A;  1XMO L;  4AH6 A;  1I6H I;  5GAE C;  2E2I B;  2K7V A;  1LAC A;  1SN8 A;  3H0G H;  3RD4 A;  4LK1 C;  3UDI A;  1JCK B;  4RV9 A;  2VW9 A;  1STH A;  4DV1 Q;  1NCV A;  3TZU A;  1CUK A;  1S5D D;  1RO0 A;  1Q1B A;  1QIL A;  3JAM c;  4LF7 L;  3JAM i;  2NVY H;  2L5T A;  3L3O C;  5JEA G;  4ZUJ A;  4J15 A;  2QKD A;  2XN9 C;  2Z6K A;  3CCJ A;  1X9N A;  2F0H A;  5I6Y A;  4BBS B;  3I7F A;  1JJ2 Z;  1K83 I;  1I4P A;  5J39 A;  2O5I C;  1VQK A;  2IX3 A;  2K50 A;  4IN3 A;  3R93 A;  3HOV H;  3TRZ A;  4MXU A;  1CZW A;  1TS3 A;  1XYI A;  4A3L I;  4DPG A;  2Z4I A;  1KL9 A;  1VQ6 A;  1IYV A;  1DJR D;  2JEB I;  3MFG A;  4QIW E;  3QOJ A;  4YWL A;  2JA6 I;  3QB3 A;  3TS0 A;  3RMH A;  2B3G A;  4JI6 L;  3QR8 A;  1NP6 A;  2L0C A;  1N8R C;  3TQY A;  1KTK A;  4HED A;  1PH4 A;  5HY6 A;  1U4R A;  4YHH Q;  3AU7 A;  3M4P A;  1N34 L;  2Z0S A;  1QVF Z;  3DM1 A;  4P71 A;  1LT3 D;  4LFC L;  3HOU I;  5C5M A;  2YU9 H;  1CKN B;  5IYB H;  1LO5 D;  1Q90 A;  1FNW A;  1EY6 A;  4LAA A;  2UUB Q;  2K14 A;  1K73 1;  4POG A;  3I3C A;  3IFD A;  3LGJ A;  2J0T D;  2JA9 A;  4A3B H;  1RIP A;  2VZA A;  2UXB L;  2HCC A;  1Y1W B;  2WB1 G;  3UE1 A;  3CCR 1;  1KAA A;  1RD9 D;  4LUO A;  3CCS 1;  1Q12 A;  1U0L A;  3M9B A;  3CME 1;  2J6A A;  3FPP A;  2NVQ I;  5CBA E;  1CKN A;  2Q2I A;  3T1H Q;  3PO3 B;  4KJN A;  1NY4 A;  3S17 I;  4HSV A;  3VYU A;  1SE3 A;  3T4N B;  3ERQ A;  3EFX D;  1SFO H;  4JI7 Q;  1UEB A;  3MXU A;  2HDM A;  1Q86 C;  3CW2 C;  3NH4 A;  1FL0 A;  3KJP A;  5D14 A;  1VQ4 Z;  4JYA L;  1ML8 A;  1WZN A;  2SNM A;  3S2D I;  1JOQ A;  4C3J H;  2XIW A;  5KIX A;  4GN5 A;  1DD2 A;  1TS5 A;  4YWK A;  3HOW H;  2VPZ A;  2CW0 C;  3BYT B;  1X56 A;  2EZV A;  4LF8 L;  3SK5 A;  1EWC A;  3NQT A;  2KA7 A;  3KIH A;  2IHF A;  5T1G A;  1X3E A;  1G6P A;  1C4Q A;  2PI2 A;  2QW7 A;  4G7O C;  5FOB B;  2CCZ A;  3C3L A;  4GOP B;  2F0W A;  1Q7Y C;  3AEV A;  5JVG 3;  4H02 A;  3E0E A;  1EOV A;  3CPW A;  3H3V I;  2IV2 X;  2Y0S G;  5KYI A;  4KHV A;  3NHH A;  2F4O A;  2EYO A;  3FVQ A;  2QRE B;  1CI3 M;  2E7Z A;  1VQN Z;  3S1N B;  1CSQ A;  1N36 Q;  4CJ1 B;  3GD7 A;  1SEB D;  3PUY A;  1K8O A;  5T64 A;  2RDF A;  2CWA A;  3A56 A;  3S1R B;  3S16 H;  2EJF C;  1E22 A;  1PTO B;  5IYB G;  4GNX A;  2K3R A;  3D4D A;  3NUC A;  1RO2 A;  3DEO A;  1PH5 A;  5IGD A;  4A3B G;  2LMC B;  1KNA A;  2HQL A;  3FMC A;  1EQQ A;  2B8G A;  4GLA C;  5JPN C;  1H95 A;  3I73 A;  5CM2 M;  1A62 A;  4NMZ A;  2OOY B;  1ET6 A;  3CP0 A;  1VQ5 A;  2EYJ A;  1I50 B;  4E2W A;  1K9M 1;  4X66 Q;  2WKD A;  2DNC A;  2BA1 A;  2QIL A;  5FO9 B;  1BCP F;  4QCL A;  2JK8 A;  4ME3 A;  5L37 A;  3KBG A;  4HCS A;  3SXH A;  5ELB A;  4CDE C;  1YNN D;  5IWA Q;  2E2H B;  1IL8 A;  2K1B A;  3K5M A;  4DR3 L;  3A8J E;  3MC0 B;  3QG1 A;  1S72 A;  1WCM I;  2Z1C A;  3I4M I;  4OX9 L;  1YNJ D;  1MKH A;  1QYP A;  3A55 A;  1KD1 1;  1HNW Q;  3A8I E;  4CJ0 B;  4HIK A;  1LTL A;  4IFD J;  1J5E L;  5EAY A;  2OCE A;  4J1M A;  3J80 L;  4NXM Q;  2EJM A;  4ZQ3 A;  2BJO A;  4YCW A;  1TWF H;  4C3J G;  1WTH A;  3OSO A;  3GTL H;  2D5D A;  5IOC A;  3VA7 A;  1TVX A;  2G5D A;  4A3G I;  4NBD A;  3FQM A;  1UE1 A;  3D6W A;  3ULL A;  4DGL A;  4BXX I;  1UE7 A;  2K4K A;  2K32 A;  3ER0 A;  3J80 f;  2KHS A;  3I07 A;  4IZ8 A;  4Z9C B;  1VQP A;  1E0B A;  4ULL A;  3KLS A;  3BVG A;  1VF5 C;  2VQF L;  1X3F A;  1H9J A;  1YI2 A;  2NVT B;  2RT9 A;  2OQ0 A;  1R9T H;  1W2B A;  1WI5 A;  2RBM A;  1XMQ Q;  2E2J H;  4Q0F A;  4MIU A;  4DXF A;  2RHB A;  2AYD A;  3HOX I;  5IY0 A;  4FF3 A;  3KUP A;  3U9S A;  2JA5 H;  4JW0 A;  3RLN A;  4DNI A;  5BN5 A;  1QF8 A;  1ML0 D;  2BE5 C;  4TVA B;  2K52 A;  1I3Q B;  1L1O C;  3PO3 H;  3V96 A;  1TWH I;  5FLX f;  4BWG B;  2Q2H A;  4POF A;  3ESW A;  1DOM A;  1JIC A;  1USP B;  2I46 A;  1SNM A;  1K8A C;  2O4X A;  4DAY A;  4FXK C;  1BXT A;  3CPW Y;  3FDT A;  3NDJ A;  2BH2 A;  4PMC A;  2OZK A;  4DK6 C;  3IX0 A;  1PYS B;  1K73 2;  5T1I A;  2VUM H;  3I2Z A;  4JI0 L;  4BY1 B;  2EXZ A;  1TWG I;  3PQI A;  1BVS A;  3VMG A;  1E2V A;  1Z01 A;  1HJP A;  4DUZ Q;  4DV3 L;  3T1H L;  2VL6 A;  3K81 C;  2RBL A;  2CWP A;  2K75 A;  3CCQ A;  2Q8I B;  1STE A;  3MXN B;  4CDC C;  3CPF A;  2AWN A;  3A7L A;  3S14 I;  1RLY A;  3N52 A;  3CC7 Z;  4RH6 A;  2EE1 A;  4JBW A;  5C6A A;  1VQL Z;  4WFN 3;  2YTV A;  1BDO A;  1S5C D;  3OYY A;  2PMZ B;  1LTI D;  2OQK A;  3NQI A;  3GKQ A;  4G7H C;  4WJW A;  2KCC A;  4RVD A;  2NWG A;  3SK4 A;  2KVM A;  1B9M A;  1N8R 1;  3NPP A;  5KNB A;  3SE0 A;  5C3X A;  4A3F B;  5GAH C;  3DM3 A;  1ZYR D;  4IUV A;  3CC4 Z;  4LUV A;  1SND A;  3OW2 Z;  3V05 A;  1PTO H;  3CAM A;  2Q8T A;  1XNR L;  4IUP A;  1HZC A;  1KC8 C;  1BNZ A;  3NK9 A;  2PMZ A;  5KYL A;  3I55 Z;  5BN4 A;  3RZO B;  3R2T A;  1TWA H;  4R1J A;  5C4X H;  1SMY D;  3NTH A;  1HZ9 A;  2VQE L;  2L55 A;  3P1H A;  2JA5 G;  1D8L A;  4ID6 A;  2PI2 E;  2EQS A;  1SDF A;  5LMN Q;  4A3E H;  3TRE A;  3TP7 A;  1X3G A;  3GTQ B;  2GU2 A;  1VQD A;  1FNU A;  4RKB A;  1N33 Q;  5K36 H;  2K01 A;  2E2H H;  3CXC Y;  1VQ7 Z;  3KF6 B;  4YIJ A;  1CQV A;  3J80 c;  1HPC A;  4AYB A;  4JPB W;  1YIT Z;  3J80 i;  3NEL A;  2DUD A;  3CHB D;  4OEM B;  1EIF A;  1W2B Y;  2EY6 A;  5CR3 A;  2VUM G;  2JP1 A;  1F9S A;  1YIJ A;  2B2U C;  2HQE A;  5ELC A;  4LF5 Q;  4A3I I;  3OIP A;  4DAM A;  4K8J A;  2RCN A;  1QE6 A;  3LUS A;  1EY7 A;  3KF6 A;  1WJ2 A;  1WTQ A;  5IWA L;  3GTM B;  4DR6 Q;  3OIQ A;  1CTM A;  2N3S A;  1F2Z A;  3KYH C;  1MGS A;  1Y1V B;  4FDB A;  5HUR A;  2V8J A;  1R4P B;  1STG A;  3SGI A;  3CCL Z;  2F0T A;  1D1K A;  1Q7Y 1;  1VQ4 1;  2OTJ Z;  1PTO F;  3T51 B;  1KD1 2;  4FNF A;  1PRT C;  4ZYS A;  1MSG A;  1IBL L;  3KBX A;  3H6M A;  2VPY A;  3NP8 A;  4LF6 Q;  2C9O A;  3K7A B;  2F3V A;  2NYZ D;  1C7Y A;  3F1Z A;  3F2D A;  2UXC L;  2Q4Z A;  1YHQ Z;  2HUG A;  2EVB A;  3S1Q B;  3FKI H;  3GTG H;  4MRI A;  2A69 C;  3BVM A;  4L63 B;  4ABN A;  1I3Q H;  3NWT A;  5GAG C;  2MHV A;  2R7F A;  1SNQ A;  2A6H C;  2OTL Z;  3S15 B;  3M4O I;  1NJI C;  4LF4 Q;  1GUW A;  2LEX A;  2F52 A;  5C4X G;  3SK8 A;  4ZKB B;  3J7A V;  3E6Z X;  4DK1 A;  4R4C A;  4A3E G;  1IW7 D;  1ZEQ X;  1ILQ A;  1SYG A;  4HMJ A;  4JG2 A;  2CVR A;  4KD3 A;  5K36 G;  3VYR A;  2A19 A;  1I94 Q;  4JI1 L;  1B3A A;  2R6G A;  1NNX A;  3BU2 A;  5D1P A;  5CV5 A;  1X0T A;  4GKJ Q;  3PO2 I;  4IOC A;  3H91 A;  2L15 A;  1KQS A;  2ZM6 L;  2CKZ B;  2YV5 A;  3LNN A;  3BZK A;  2JIP A;  1DGS A;  1K83 B;  2ICI A;  3KDF B;  2JA7 G;  3I4N H;  1ILP A;  5M5W H;  4A3C H;  4KTA A;  2VS1 A;  4QIW B;  3DXJ C;  2JA7 I;  1FR3 A;  5JAV A;  2JA6 B;  2B2V A;  3CCE Z;  1GUN A;  1YEZ A;  2XRS D;  4P75 A;  1QVG A;  1A3V A;  4QMG A;  4XIG S;  5A2Q L;  1B4O A;  3J7Y W;  3F2B A;  2UU9 L;  4LFB L;  1EYA A;  3KDF A;  1HH2 P;  4NOZ A;  2QRD B;  2VPX A;  3AFQ A;  3HOU B;  3DMU A;  5C44 H;  4JOI A;  4A76 A;  4CGY B;  1M90 C;  3TS2 A;  3R8B A;  4A3J I;  4LF7 Q;  3QO2 A;  1TQO A;  3MEH A;  2RVL A;  3K5N A;  4BA1 I;  3CCR A;  2B39 A;  3GTO H;  1PVO A;  3G6J B;  2KUM A;  3CCS A;  5A2Q f;  1QNK A;  1ONL A;  4L5Q A;  4ZAI A;  2KI7 B;  3QWU A;  2KPI A;  3UDF A;  1MSH A;  3GTJ I;  1O7Z A;  2DN8 A;  4HIM A;  4E32 A;  3G6E Z;  4UP7 A;  5CC4 A;  2EIF A;  4E2X A;  2K6A A;  2NVQ B;  5DM6 3;  1PH1 A;  2R93 H;  1EYG A;  1XXG A;  3S17 B;  1N8R 2;  5C4J I;  4BY7 B;  4PZ8 A;  3D3R A;  3NEN A;  2X69 A;  3LWU A;  5HGT A;  1VMC A;  1K8A 1;  2GVA A;  3CCU 1;  4JI6 Q;  2QR1 B;  1LTG D;  1HZB A;  1UEA B;  5LL6 X;  1YJN Z;  5EBC A;  4KN7 C;  4V19 0;  2JA8 H;  1IYU A;  1CKM A;  2JXM B;  3EER A;  1RNI A;  1N34 Q;  2WB1 A;  5LMN L;  3IL8 A;  4PNY A;  3S2D B;  5C4H A;  4V0B A;  1ZB8 A;  4MD8 A;  1D5X C;  1O7Y A;  3M3Y I;  1CM9 A;  3DWQ A;  2SDF A;  3A5Z B;  1I4R A;  4XYQ A;  3C1F A;  4CKE A;  3FPU B;  2PMZ E;  2UXB Q;  1VQF A;  1Y1V H;  1N9W A;  3KF8 B;  4OHJ A;  4DN4 M;  4R8I A;  1JWM D;  5IP7 I;  1OXX K;  3I4N G;  1YBY A;  1HNZ L;  3S1M I;  2LXK A;  2JE6 I;  3PIO A;  4NW2 A;  5FLM H;  1BBW A;  1Q86 2;  1PFN A;  3T16 A;  5F2D A;  4A3K H;  4NBH A;  2B2T C;  3WDN A;  3K7A H;  4ALP A;  2FMC A;  5EPL A;  3NE5 B;  2UUC L;  1EY0 A;  3FQQ A;  3D6C A;  3KF8 A; 
#chains in the Genus database with same CATH homology
 4AYB E;  3CCM Z;  3CC7 1;  3H3V J;  3JAM b;  1VLA A;  1KQS Y;  3VDY A;  3CQZ I;  5C44 G;  2R92 G;  1VQL 1;  4DV4 L;  2A1A A;  3S15 H;  1KC8 1;  5ELO A;  2VY3 A;  4DR4 L;  2BH8 A;  1ASZ A;  1VQ8 A;  2NVX I;  4YY3 L;  4KHP L;  1VQO Z;  4LF8 Q;  2R92 I;  1Q7Y 2;  2EGT A;  5LMU L;  2Y0S A;  3PO3 S;  1XNQ L;  3CC4 1;  3MON A;  1QVG Y;  2R93 G;  2B63 I;  4NFR A;  4RVG A;  1VQB A;  4A3D H;  3I56 Z;  2JA8 G;  1EWI A;  4P74 A;  3HOZ I;  3W5O A;  3P5J B;  3RZD I;  1VQ7 1;  2QLV B;  1M1K C;  1OXV A;  5JJL A;  1VQI A;  1YHB A;  2OWO A;  1G51 A;  1YIT 1;  3GO5 A;  2K5H A;  3J7Z C;  3IRB A;  4AQY Q;  5FLM G;  3AQQ A;  3GTP H;  3G4S 1;  2M6N A;  3L7Z C;  5GQO A;  4DR3 Q;  3PF4 A;  4OX9 Q;  1OXT A;  4E2Z A;  3HOY I;  4A3M H;  2ZTE A;  1J5E Q;  4JI3 Q;  1YJW Z;  2OTJ 1;  1P16 A;  3GTK H;  3CCJ Z;  4BY7 H;  1Z03 A;  2ZJP A;  1NJI 1;  3KJO A;  1CKO A;  2LSS A;  1UWV A;  3S2H H;  3CCV Z;  2N78 A;  3ICE A;  2A8V A;  2VQF Q;  2R6M A;  1I5F A;  4R4O A;  1ASY A;  4PMW A;  2HT1 A;  4DV6 L;  2E9H A;  4YCU A;  5C0X J;  1K8A 2;  4PZ7 A;  2ZJQ A;  5GRO A;  3F3P C;  4IOA A;  2MO1 A;  4A93 H;  1EQR A;  4JI0 Q;  2DGY A;  2WB1 E;  1M90 1;  1VQH A;  4DV3 Q;  3S24 A;  4WJ4 A;  1VS0 A;  3HKZ G;  3CCE 1;  3PCO B;  4A3M G;  1YJ9 Z;  4MZ9 A;  3H0G G;  1PA6 A;  1QVF A;  4HGZ A;  2QA4 Z;  2MFI A;  2R7Z H;  3H0G I;  1C0A A;  4MNO A;  2QEX Z;  4NBB A;  1IBM L;  1EUJ A;  2IZ3 A;  3G48 A;  4OO1 G;  1KC8 2;  2NVY I;  3G6E 1;  3NH5 A;  3HOV G;  4DV2 L;  1XNR Q;  1FGU A;  4APV A;  4GNX B;  3PUZ A;  3HOV I;  2ZAE B;  2VQE Q;  1YJN 1;  1QZH A;  2Y0S E;  2GN5 A;  4IO9 A;  4X64 L;  2CQO A;  5BR8 L;  5LL6 f;  2K5V A;  4AIM A;  3I4O A;  4GOP C;  2YU9 I;  4DR1 Q;  1K3R A;  2E2I H;  4A93 G;  1S3O A;  4UP8 A;  1S72 Z;  1PHJ A;  4A3B I;  3L2P A;  4TQU S;  4AQY L;  1IZ6 A;  4YCV A;  2LIY A;  3FHW A;  4A4I A;  4B3T L;  1X55 A;  4BBS H;  2P3Y A;  3JC6 6;  1WYD A;  1QZG A;  4JI4 Q;  4JI3 L;  1SFO I;  2I5M X;  1JJ2 Y;  1IBL Q;  3HOW G;  1VQO 1;  3KIF A;  4OWW B;  2UXC Q;  1Z9F A;  1LYL A;  1W2B Z;  1NJI 2;  3HOW I;  3CXC A;  2N49 A;  3GTM S;  1B8A A;  5M3F H;  3PUX A;  1Y1V S;  3PIP A;  5J3B A;  2DE6 A;  4KHZ A;  1QVF Y;  4RVF A;  2I3C A;  1Y1W H;  3I56 1;  2EXD A;  1Y14 B;  3OTO L;  2E8G A;  3J81 f;  1IBK L;  1P9N A;  4DAY B;  4L5S A;  3GCF A;  3G71 1;  5T67 A;  2JS4 A;  3EIV A;  1PYB A;  3J80 b;  2F4V L;  3M85 A;  4JI1 Q;  1IL2 A;  3K0X A;  1PV4 A;  2ZM6 Q;  3S16 I;  1BBU A;  4MH4 A;  2V8I A;  3Q8D A;  1L1O A;  1AH9 A;  1RQF A;  4NXN L;  1X3W A;  2DE5 A;  5FLX b;  3CCU A;  2ATW A;  1MJC A;  5DLQ E;  4BBS G;  1M90 2;  1SMX A;  2UU9 Q;  4LFB Q;  1Q81 C;  1FJG L;  1YJW 1;  4X62 Q;  3D9X A;  3J7A 5;  2RF4 A;  1J6Q A;  3CMA Z;  4NH1 C;  4NBE A;  3W1G A;  3ZJY C;  1VQ9 Z;  2AMC B;  1TWF I;  3CCV 1;  1NUI A;  1AE2 A;  2KCT A;  4RMF A;  3S1N H;  3GTL I;  4EQ5 A;  1JMC A;  3S1R H;  2F3I A;  1WW9 A;  4HH4 A;  3NBH B;  3BZC A;  2AHO B;  3CC7 A;  4Y7N H;  1I50 H;  1R9T I;  1VQL A;  4S1T A;  2E2J I;  1Z47 A;  3PUV A;  3PO3 G;  1DL6 A;  2JA5 I;  1KXL A;  3PO3 I;  3PF5 A;  2XGT A;  1Q86 1;  4DR1 L;  4E30 A;  3CC4 A;  3OW2 A;  1HNZ Q;  2R7D A;  3BJU A;  2VUM I;  2UUC Q;  1YJ9 1;  2UUA L;  1VQG A;  5IP9 H;  5FLX c;  4DV4 Q;  2QA4 1;  4NB8 A;  1E24 A;  4JI4 L;  2NVT H;  5AN9 F;  1VQM Z;  4DR4 Q;  5LMN W;  4YY3 Q;  4KHP Q;  1YIT A;  2QEX 1;  1YUA A;  5LMU Q;  1OXU A;  1JJC B;  1XNQ Q;  3CC2 Z;  3G4S A;  4R4I A;  4IPH A;  4KI0 A;  2GVB A;  3RNU A;  1HR0 Q;  1JWH C;  4B3S L;  1WFQ A;  1M1K 2;  1VQN 1;  2OTJ A;  4BY1 H;  1AE3 A;  1TWA I;  4MD9 A;  5C4X I;  4OXP A;  4E2Y A;  4A3E I;  3MZK B;  1S72 1;  2OOX B;  1Q1E A;  1IYJ B;  4DV7 L;  2YYZ A;  5GAD C;  5FJ8 H;  4LFA L;  1GKH A;  1OXS C;  5JEA J;  4A3F H;  3ULJ A;  2N8N A;  4LW1 A;  4P73 A;  4X62 L;  3TEH B;  2MNA A;  4MTN A;  4QTU A;  3OW2 Y;  3A74 A;  3RZO H;  1V43 A;  1UE5 A;  1JJG A;  1GD7 A;  3FKI G;  3CME A;  2ZTD A;  4Y52 H;  3GTQ H;  1TWC H;  2NZH A;  4X6A H;  2PQA A;  3FKI I;  3GTG I;  3CCE A;  1HZA A;  1I3Q I;  1SR3 A;  1RL2 A;  4GN3 B;  4DV6 Q;  1NTG A;  5A2Q b;  4BY1 G;  2JEA I;  4QGU A;  3STB C;  1K8G A;  4DUY L;  3E9I A;  4GLX A;  3T1Y L;  1JT8 A;  5E7N A;  3GTM H;  2YTY A;  2Q2U A;  4UPA A;  5C3E H;  4BBR H;  3G6E A;  4JI5 L;  3HKZ A;  3HFZ B;  4KLK A;  4A3C G;  2WAQ G;  4JI2 Q;  1A0I A;  2QGQ A;  3I4N I;  5FJ8 G;  4A3C I;  3UDG A;  4OWT B;  3NDI A;  4A3F G;  3S1Q H;  4DR5 Q;  4NB3 A;  1VQ8 Z;  2GTI A;  4DV0 L;  2JJQ A;  3UDX A;  3IF8 A;  2JUB A;  3CMA 1;  3F2C A;  1Q82 C;  1I6H H;  1VQ9 1;  5C44 I;  1IBM Q;  1V9P A;  2KHJ A;  3GTO I;  1Q8K A;  4DV2 Q;  4IPD A;  1K9M C;  1VQJ A;  1NBW A;  3F8T A;  3CD6 Z;  3I55 1;  1PH9 A;  3MZL B;  2R93 I;  4LF9 L;  1HR0 L;  1K83 H;  2E5L L;  4O2D A;  4IJL A;  4X64 Q;  4A3L H;  1E1T A;  5BR8 Q;  1PH8 A;  2JA8 I;  2DE7 A;  2O4H A;  1VQO A;  2JA6 H;  4EWC A;  2QRC B;  2K5N A;  1Y1V G;  2IT1 A;  3ERS X;  2KBN A;  2AKL A;  1Y1V I;  4WJ3 M;  3HOU H;  4X65 L;  4A3K G;  4B3T Q;  3I56 A;  1LM0 A;  2NZO A;  5FLM I;  4DV5 L;  3L0O A;  2NN6 G;  3G71 A;  4A3K I;  1B70 B;  2KHI A;  3K7A I;  3CCL 1;  1SLJ A;  1L0W A;  4JBJ A;  2JNY A;  2NVQ H;  4RVH A;  2ID0 A;  1N2F A;  3S17 H;  1VQM 1;  2P28 A;  4HGY A;  4B3R L;  1D7Q A;  1VQK Z;  2D0P A;  1VQ6 Z;  1YHQ 1;  3CC2 1;  1X65 A;  4GS3 A;  3S2D H;  4GKK L;  4EX5 A;  4NBF A;  2ES2 A;  2Z6K C;  2Q2T A;  2OTL 1;  3MEF A;  1MIU A;  1VQC A;  4A3D G;  4LNQ A;  3IFU A;  3OTO Q;  1IBK Q;  1YJW A;  4OON A;  2ASB A;  4A3L G;  2HU9 A;  3NFZ A;  4A3D I;  2F4V Q;  4UP9 A;  3H3V H;  2JA6 G;  1XPR A;  2IHE A;  1Z02 A;  3CCV A;  3HKS A;  5IE8 A;  1JJ2 A;  4BA2 I;  3VTN A;  4JBK A;  3TDH B;  4OWX B;  3HOU G;  4NXN Q;  4DQY B;  1JE5 A;  4JI2 L;  2IZ4 A;  1Q81 2;  4QJF A;  3NH8 A;  3GTP I;  5HGQ A;  4LUZ A;  4DR5 L;  2KCM A;  4QTT A;  1FJG Q;  3HKZ E;  4R4Q A;  3BG0 B;  1XTD A;  4A3M I;  4BY7 G;  1XJV A;  1WCM H;  2IX0 A;  4DR2 L;  3I4M H;  2Q51 A;  2RHS B;  2HIV A;  3GTK I;  4BY7 I;  2AKW B;  3CPW Z;  1PH3 A;  3S2H I;  2HHH L;  3UE0 A;  1P8L A;  5H1S E;  3BG1 B;  4OO1 I;  4A3G H;  1YJ9 A;  1KIX A;  4BXX H;  1LQL A;  2BA0 A;  2QA4 A;  1VQ4 A;  1L2F A;  3TE5 B;  5JJK A;  4P72 A;  4JV5 Q;  5AJ3 L;  4TNU A;  2LFU A;  1VQ5 Z;  4C3H H;  1EFW A;  3K7U C;  2QEX A;  2I0Q A;  3HOX H;  1X3Z A;  4GNX C;  4R4T A;  1N32 L;  4LWC A;  1RO4 A;  4JCV E;  4C2M H;  2W04 A;  1TWH H;  2F4M A;  3K80 C;  4A93 I;  4GOP A;  3K8A A;  2MO0 A;  5IYD H;  1Q82 1;  2JR6 A;  4QY7 A;  2UUA Q;  1VQN A;  3RR5 A;  3VB9 A;  1VQ8 1;  3CCM 1;  1TWG H;  1WCM G;  1K0R A;  3I4M G;  2R7Z G;  3CXC Z;  1SRO A;  2UXD L;  1VQP Z;  1JB7 A;  3S14 H;  1YI2 Z;  2R7Z I;  3M7N A;  1A8V A;  3EBE A;  3AYH B;  4A3G G;  5IYC H;  1M1K 1;  2LXJ A;  4BXX G;  3CD6 1;  3A5U A;  4DV1 L;  4B3S Q;  4GLV B;  3WWV A;  1L1O B;  2VNU D;  3KLW A;  4XTC S;  5M3M H;  3HOX G;  2V1C C;  1QVC A;  1YZ6 A;  4NBC A;  3J81 b;  3CCU Z;  1KHI A;  3RLF A;  2FXQ A;  3CCQ Z;  4NPS A;  2E2I I;  1NMF A;  1V1Q A;  4DV7 Q;  4K0K Q;  5IYD G;  3PSI A;  2I5H A;  4YHH L;  1OTC A;  4LFA Q;  4HJ8 A;  1S7M A;  4IPG A;  2UUB L;  1NE3 A;  4A3I H;  4DKA C;  5C0X G;  3CCJ 1;  4BBS I;  1VQK 1;  3KFU A;  5C0X I;  3J81 j;  3A0J A;  1USP A;  1VQ6 1;  5M3F G;  4JI7 L;  3U4Z A;  3W1B A;  2H85 A;  1S40 A;  1NMG A;  5IYC G;  3RN2 A;  1C9O A;  2ZTC A;  4UY8 C;  1Y1W G;  3NEM A;  3M4Q A;  1Y1W I;  3PGZ A;  4DUY Q;  4CL1 A;  3T1Y Q;  2IY5 B;  1BKB A;  3M4O H;  3CMA A;  4JV5 L;  5M3M G;  1VQ9 A;  1YIJ Z;  2WAQ A;  4RS4 A;  3VMI A;  1YHA A;  4JI5 Q;  2H5X A;  2V8K A;  4HIO A;  1N36 L;  3PO2 H;  4HID A;  3I55 A;  3J81 c;  3U4V A;  4C3I H;  3J81 i;  1XPU A;  1QUQ B;  4A3I G;  4DV0 Q;  1Q82 2;  2HF1 A;  3FP9 A;  1VQ7 A;  4X66 L;  3U50 C;  2JA7 H;  1TXY A;  3G4S Z;  1YUK A;  4JI8 Q;  1K9M 2;  1QUQ A;  4L5R C;  1GVP A;  1HNW L;  3S1N I;  4A3J H;  3STB D;  4A75 A;  2KEN A;  4NXM L;  4B3M Q;  2WP8 J;  3S1R I;  4JBM A;  4LF9 Q;  2ALY B;  3GTJ H;  2E5L Q;  1X54 A;  3CCL A;  1KQS Z;  1GO3 E;  1VQM A;  4QQB X;  4IFD G;  4RG1 A;  5C4J H;  1WOC A;  4DR7 Q;  4Y7N I;  1I50 I;  1VQ5 1;  4NBA A;  2VF1 A;  2B29 A;  4L5T A;  4IFD I;  4HJA A;  1YHQ A;  2E2H I;  3Q87 A;  3CC2 A;  5IT9 f;  1XMQ L;  1IXR A;  4QL5 A;  2CFM A;  4X65 Q;  3CF5 A;  1EIY B;  3M3Y H;  3DLL A;  1QVG Z;  4IPC A;  3PO2 G;  2OTL A;  4K0K L;  4JC0 A;  2C35 B;  4DV5 Q;  1HNX Q;  1GM5 A;  5IP7 H;  1ZH1 A;  5IP9 G;  3S1M H;  5IT9 b;  1Q46 A;  3CCR Z;  1WJJ A;  1HR0 W;  2PK7 A;  4XX2 A;  3CCS Z;  1YVC A;  5IP9 I;  3CME Z;  2PQA B;  4NB9 A;  4B3R Q;  1VQP 1;  2NVT I;  4DUZ L;  4JOI C;  1YI2 1;  1K73 C;  1XMO Q;  3CQZ H;  1PH2 A;  2PNH A;  4GKK Q;  4A3J G;  2W03 A;  2NVX H;  1SE8 A;  1ZB9 A;  2R92 H;  4DK3 C;  3KOJ A;  2HIX A;  1B7Y B;  2B63 H;  1KRL A;  4E33 A;  2VUG A;  4HJ9 A;  3D0F A;  1E3P A;  4E31 A;  4BY1 I;  3H15 A;  1SRU A;  3D31 A;  4HJ5 A;  5JJI A;  3HOZ H;  1PH7 A;  1Q81 1;  3CCQ 1;  3RZD H;  1VQE A;  4LFC Q;  2JMO A;  2PM9 A;  4PG3 A;  2G2K A;  3RLO A;  5IP7 G;  1N33 L;  2WAQ E;  5D1O B;  1YJN A;  1E7Z A;  2GTH A;  1PFS A;  5M5X H;  2AWO A;  3JAM f;  4NBG A;  2I5L X;  4A3F I;  2IX1 A;  3EED A;  1VCI A;  4DR2 Q;  1G29 1;  5M5Y H;  1X6O A;  4O0A A;  4LF5 L;  3HOY H;  4AYB G;  5IT9 c;  1PH6 A;  5D1O A;  5ELN A;  4JI8 L;  1E1O A;  1UE6 A;  4DR6 L;  2D0O A;  3PV0 A;  3RZO I;  3J7A 4;  1O7I A;  2HHH Q;  4YWM A;  4GN4 B;  4JYA Q;  1U5K A;  2M48 A;  3VMH A;  4Y52 I;  4IJH A;  3B6Y A;  3GTQ I;  4B3M L;  1TWC I;  1XPO A;  4X6A I;  3RN5 A;  3CCM A;  5T6B A;  2RPR A;  4LF6 L;  3F3F C;  2B63 G;  1KD1 C;  1PFT A;  5AJ3 Q;  3E9H A;  1A63 A;  4DR7 L;  1KAW A;  1YIJ 1;  2WFW A;  5C3E G;  2YTX A;  2K5R A;  1WII A;  2O53 A;  4BBR G;  3HOZ G;  2RIQ A;  4LF4 L;  1N32 Q;  1LUZ A;  3GTM I;  1KRT A;  5C3E I;  4BBR I;  3G71 Z;  1YNX A;  2JQO A;  1FVI A;  2XTI A;  1MJE A;  3CD6 A;  3U58 A;  1VQA A;  1I94 L;  3ULP A;  4MD7 A;  2YAD A;  1HNX L;  4PZ6 A;  4GKJ L;  1KRS A;  2D62 A;  2MQH A;  3S1Q I;  1W3S A;  2NN6 I;  2RHQ B;  3AFP A;  2UXD Q;  3HOY G;  3PUW A;  1CSP A;  3EN2 A;  3GDE A;  4HJ7 A;  1TFI A;  4MON A;  3S15 I;  1T9H A;  1XMO L;  4AH6 A;  1I6H I;  5GAE C;  1SN8 A;  3H0G H;  3UDI A;  4RV9 A;  2VW9 A;  4DV1 Q;  1CUK A;  1RO0 A;  1Q1B A;  3JAM c;  4LF7 L;  3JAM i;  2NVY H;  5JEA G;  4J15 A;  2QKD A;  2Z6K A;  3CCJ A;  1X9N A;  3I7F A;  1JJ2 Z;  1K83 I;  1VQK A;  2K50 A;  3HOV H;  3TRZ A;  4MXU A;  4A3L I;  4DPG A;  1KL9 A;  1VQ6 A;  2JEB I;  4QIW E;  4YWL A;  2JA6 I;  3TS0 A;  2B3G A;  4JI6 L;  1NP6 A;  1N8R C;  3TQY A;  1PH4 A;  5HY6 A;  4YHH Q;  3M4P A;  1N34 L;  2Z0S A;  1QVF Z;  4P71 A;  4LFC L;  3HOU I;  2YU9 H;  1CKN B;  5IYB H;  2UUB Q;  2K14 A;  1K73 1;  4POG A;  3LGJ A;  2JA9 A;  4A3B H;  1RIP A;  2VZA A;  2UXB L;  2WB1 G;  3UE1 A;  3CCR 1;  4LUO A;  3CCS 1;  1Q12 A;  1U0L A;  3M9B A;  3CME 1;  2J6A A;  2NVQ I;  1CKN A;  2Q2I A;  3T1H Q;  1NY4 A;  3S17 I;  3T4N B;  1SFO H;  4JI7 Q;  1UEB A;  1Q86 C;  3CW2 C;  3NH4 A;  1FL0 A;  3KJP A;  1VQ4 Z;  4JYA L;  1ML8 A;  3S2D I;  4C3J H;  4GN5 A;  4YWK A;  3HOW H;  1X56 A;  4LF8 L;  3KIH A;  2IHF A;  1X3E A;  1G6P A;  2PI2 A;  2CCZ A;  4GOP B;  1Q7Y C;  3AEV A;  4H02 A;  3E0E A;  1EOV A;  3CPW A;  3H3V I;  2Y0S G;  2F4O A;  2QRE B;  1VQN Z;  1CSQ A;  1N36 Q;  3GD7 A;  3PUY A;  5T64 A;  2CWA A;  3S16 H;  5IYB G;  1E22 A;  4GNX A;  2K3R A;  1RO2 A;  1PH5 A;  4A3B G;  1EQQ A;  2HQL A;  4GLA C;  1H95 A;  5CM2 M;  1A62 A;  2OOY B;  3CP0 A;  1VQ5 A;  4E2W A;  1K9M 1;  4X66 Q;  2BA1 A;  2JK8 A;  4ME3 A;  5IWA Q;  4DR3 L;  1S72 A;  1WCM I;  3I4M I;  4OX9 L;  1MKH A;  1QYP A;  1KD1 1;  1HNW Q;  4HIK A;  1LTL A;  4IFD J;  1J5E L;  5EAY A;  2OCE A;  4NXM Q;  2BJO A;  4YCW A;  1TWF H;  3GTL H;  4A3G I;  4NBD A;  3FQM A;  1UE1 A;  3D6W A;  3ULL A;  4DGL A;  4BXX I;  1UE7 A;  2K4K A;  3ER0 A;  3J80 f;  3I07 A;  1VQP A;  2VQF L;  1X3F A;  1YI2 A;  2RT9 A;  2OQ0 A;  1R9T H;  1W2B A;  1WI5 A;  1XMQ Q;  2E2J H;  2RHB A;  3HOX I;  5IY0 A;  2JA5 H;  3RLN A;  4DNI A;  1QF8 A;  4TVA B;  2K52 A;  1L1O C;  3PO3 H;  1TWH I;  5FLX f;  2Q2H A;  4POF A;  3ESW A;  1USP B;  1K8A C;  3CPW Y;  3NDJ A;  2BH2 A;  2OZK A;  4DK6 C;  3IX0 A;  1PYS B;  1K73 2;  2VUM H;  3I2Z A;  4JI0 L;  1TWG I;  1BVS A;  3VMG A;  1Z01 A;  1HJP A;  4DUZ Q;  4DV3 L;  3T1H L;  2VL6 A;  3K81 C;  2RBL A;  2CWP A;  2K75 A;  3CCQ A;  3MXN B;  3CPF A;  2AWN A;  3S14 I;  1RLY A;  3CC7 Z;  4JBW A;  1VQL Z;  2YTV A;  3OYY A;  2OQK A;  3GKQ A;  4RVD A;  1N8R 1;  5GAH C;  3DM3 A;  3CC4 Z;  4LUV A;  3OW2 Z;  3CAM A;  1XNR L;  1HZC A;  1KC8 C;  2PMZ A;  3I55 Z;  1TWA H;  4R1J A;  5C4X H;  1HZ9 A;  2VQE L;  2JA5 G;  1D8L A;  2PI2 E;  2EQS A;  5LMN Q;  4A3E H;  3TRE A;  1X3G A;  2GU2 A;  1VQD A;  1N33 Q;  2E2H H;  3CXC Y;  1VQ7 Z;  3KF6 B;  3J80 c;  4AYB A;  3J80 i;  1YIT Z;  3NEL A;  2DUD A;  1EIF A;  1W2B Y;  2VUM G;  1YIJ A;  4LF5 Q;  4A3I I;  4DAM A;  2RCN A;  3LUS A;  3KF6 A;  5IWA L;  4DR6 Q;  2N3S A;  3KYH C;  4FDB A;  2V8J A;  3SGI A;  3CCL Z;  1Q7Y 1;  1VQ4 1;  2OTJ Z;  1KD1 2;  1IBL L;  4LF6 Q;  1C7Y A;  3F1Z A;  3F2D A;  2UXC L;  2Q4Z A;  1YHQ Z;  3FKI H;  3GTG H;  4MRI A;  1I3Q H;  5GAG C;  2R7F A;  2OTL Z;  3M4O I;  1NJI C;  4LF4 Q;  2F52 A;  5C4X G;  4DK1 A;  4R4C A;  4A3E G;  4JG2 A;  5K36 G;  2A19 A;  1I94 Q;  4JI1 L;  3BU2 A;  2R6G A;  5D1P A;  1X0T A;  4GKJ Q;  3PO2 I;  4IOC A;  2L15 A;  1KQS A;  2ZM6 L;  2CKZ B;  2YV5 A;  3BZK A;  1DGS A;  3KDF B;  2JA7 G;  3I4N H;  5M5W H;  4A3C H;  2VS1 A;  2JA7 I;  3CCE Z;  4P75 A;  1YEZ A;  1QVG A;  4XIG S;  3F2B A;  2UU9 L;  4LFB L;  3KDF A;  1HH2 P;  4NOZ A;  2QRD B;  3AFQ A;  5C44 H;  4JOI A;  4A76 A;  1M90 C;  3TS2 A;  4A3J I;  4LF7 Q;  4BA1 I;  3CCR A;  1PVO A;  3GTO H;  3CCS A;  5A2Q f;  4L5Q A;  2KI7 B;  3QWU A;  2KPI A;  3UDF A;  4HIM A;  3GTJ I;  4E32 A;  3G6E Z;  4UP7 A;  2EIF A;  4E2X A;  1PH1 A;  2R93 H;  1EYG A;  1N8R 2;  5C4J I;  4PZ8 A;  3NEN A;  1K8A 1;  2GVA A;  3CCU 1;  4JI6 Q;  2QR1 B;  1HZB A;  1YJN Z;  2JA8 H;  1CKM A;  3EER A;  1RNI A;  1N34 Q;  2WB1 A;  5LMN L;  1ZB8 A;  4MD8 A;  3M3Y I;  3A5Z B;  2PMZ E;  2UXB Q;  1VQF A;  1Y1V H;  1N9W A;  3KF8 B;  5IP7 I;  1OXX K;  3I4N G;  1YBY A;  1HNZ L;  3S1M I;  2LXK A;  2JE6 I;  3PIO A;  5FLM H;  1BBW A;  1Q86 2;  4A3K H;  4NBH A;  3K7A H;  4ALP A;  2UUC L;  2ZJR A;  3FQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...