1L1OC

Structure of the human replication protein a (rpa) trimerization core
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
178
structure length
173
Chain Sequence
NTNWKTLYEVKSENLGQGDKPDYFSSVATVVYLRKENCMYQACPTQDCNKKVIDQQNGLYRCEKCDTEFPNFKYRMILSVNIADFQENQWVTCFQESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFRSFIFRVRVKVETYIKATVMDVKPVDYREYGRRLVMSIRRSALM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the RPA trimerization core and its role in the multistep DNA-binding mechanism of RPA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Replication protein A 14 kDa subunit
total genus 39
structure length 173
sequence length 178
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08646 Rep_fac-A_C Replication factor-A C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1l1oC02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1l1oC01
4OONA 1SE8A 2KBNA 4AQYQ 2E2IH 3TRZA 2UUAQ 2K75A 2OQ0A 2DE5A 1X3ZA 2A19A 4B3TL 1N33L 2NVQI 2A1AA 3IRBA 4BY7G 2JA5G 1BBWA 1OXUA 3GTMI 2ZTEA 3H3VI 4JI2L 2R7DA 2VY3A 3PO3H 4DUZL 4NBDA 1TWAH 2H5XA 4A3EG 1V43A 3CC2A 4NBAA 2C35B 3S1NH 2HIXA 4B3SL 3HOWI 5FLMH 3HOUH 2F52A 1N2FA 3GTGH 5ELOA 1QZHA 1JJ2A 2PQAA 4JBMA 3S1QH 4GNXB 2E2JH 3AEVA 3GTQI 1VQOA 3S16I 1GVPA 2PI2A 1PH2A 1V1QA 3CPFA 2EQSA 2I0QA 1YZ6A 1XPOA 1PH3A 5IYBG 1C7YA 4B3SQ 3HOZH 3RLOA 1JT8A 1VQ4A 1KXLA 3H0GH 2VQFL 3PUWA 4IPCA 3HOUG 4DUZQ 1HNXQ 2YTVA 1HJPA 4AIMA 3M3YH 2Q2TA 5C3EI 5C4JI 1I6HI 1Y1WG 3D0FA 5ELNA 2UXDL 3ESWA 1X3WA 5IP7I 2K14A 5CM2M 5HGQA 1PH8A 4B3TQ 4POGA 3H15A 1I50H 2AWNA 1WCMI 3CCSA 1NMFA 1W3SA 1EQQA 3GTPI 3J81i 3LUSA 4H02A 4Y7NH 1KAWA 3I4NH 4BY1G 5JJIA 3S24A 1KQSA 1XMQL 3HOYG 3KFUA 3RLNA 1WYDA 3EBEA 2XTIA 2R7FA 3UE1A 4GNXC 1Q82C 1YJNA 1HZBA 3G71A 2BJOA 4X66Q 3S1RH 1P16A 2UU9L 4LF9Q 4QIWE 4A3FG 4X65Q 2A8VA 4DV6Q 4JI3Q 3RZDH 1XPRA 2JQOA 3DLLA 1SMXA 3S2HI 4MTNA 5C44I 2JA6H 2JA7I 1VCIA 4YWKA 4Y52I 1PVOA 2B29A 1XTDA 2CQOA 1VQ7A 5JJLA 4LFAQ 4DR6Q 2YU9H 3S14H 4BBSH 5FLMG 2P3YA 4L5TA 4GS3A 4GN4B 1A0IA 1S40A 1Y1VH 1OXSC 3MEFA 4JV5Q 3U58A 3S17H 1YJ9A 4LF4L 1S3OA 2GVAA 4OXPA 4DV6L 2HF1A 2FXQA 3EN2A 4A3MG 3CMAA 4A3DH 1GM5A 4BBSG 4A3II 2UU9Q 4X64Q 4X66L 2CWAA 3CXCA 3CC7A 2ATWA 2KENA 4HJ5A 4A3BG 3RZOH 1Q1EA 2PQAB 2QGQA 3KJPA 4MNOA 1DL6A 1K3RA 1XMQQ 1RL2A 2B63H 5IP9H 3GTGI 5FJ8H 2E8GA 2BH2A 3GTMH 1X6OA 2BH8A 3K8AA 2BA1A 2PNHA 3W1GA 4C3HH 3U50C 3K7AI 4DNIA 3GTQH 2NVYI 1NUIA 4IPHA 5LMUL 3GDEA 4LUVA 2EIFA 5E7NA 3I4MH 2D0OA 4APVA 3HOZI 1VQAA 2HQLA 1AH9A 2JA5H 1WOCA 2VUMI 4BBRI 3UDGA 1VQLA 3S15I 3CCEA 4UY8C 2VQEQ 2UXDQ 3Q8DA 2ZTCA 4A3EH 1HNXL 3TS0A 2EXDA 1O7IA 3AFPA 2VQFQ 1Y1VS 2AWOA 4NB8A 3S2DI 1IZ6A 1K0RA 4JBJA 4A4IA 2MNAA 2CCZA 4UP8A 4UPAA 1EIYB 1VQMA 2IHEA 4LFBL 3TREA 1VQPA 1TWHI 1CKNB 4A3CG 4QTTA 1A8VA 3F2CA 2R93G 4IPGA 3CMEA 3H3VJ 1E1TA 2Y0SG 3BZCA 4A3KI 3CQZH 2F4VL 2JA6G 4QQBX 3G48A 4JI2Q 1Q86C 3AQQA 1UE7A 2NVTI 3J80i 2NVQH 4DR4Q 2AMCB 3ERSX 1K9MC 3PV0A 4A93I 4B3MQ 1U5KA 1N33Q 4GLAC 4X6AI 4LUOA 4YWMA 3H3VH 1Y1VG 2UUAL 4IOCA 1B70B 4AQYL 4JI6Q 3U4VA 1YHAA 3CP0A 1FJGL 3PF4A 2IHFA 3CD6A 3GD7A 4DR3Q 2B3GA 2D0PA 1RIPA 4BXXH 4A3MH 4A3GI 3HOYH 1PFTA 3VDYA 4JI7Q 4LF7Q 3S1MI 1WFQA 3T1HL 1PHJA 4LNQA 4A3LG 3CCQA 2F4OA 5JJKA 2B63G 3T1YL 3RLFA 4QJFA 4HJ7A 3K81C 4O2DA 1EOVA 4GKJQ 2DGYA 3OTOQ 3RN5A 1XNRQ 2UXBQ 1Z9FA 3E0EA 5IP9G 3PO3G 1HNZL 3FKII 4B3RQ 4BA1I 5C3EH 5LMNW 4P74A 2AHOB 1WCMH 5LMNQ 1PA6A 3GKQA 4QL5A 5AJ3L 1Q7YC 1X65A 1PH9A 2HHHQ 5GADC 4DR7Q 2JR6A 2AKLA 1PH7A 1L0WA 4DR5L 2IX0A 3NBHB 5IYBH 1G6PA 1EWIA 3VB9A 2RBLA 3M7NA 4IJHA 3VMHA 4A3CH 3A0JA 1AE2A 1X3GA 2K52A 4DV4Q 3L7ZC 2D62A 5M5XH 3ULPA 2XGTA 1A63A 4IPDA 3F1ZA 1PH5A 2ES2A 3DM3A 1UE5A 3M85A 4C3IH 1NBWA 4A3JI 2JJQA 5HY6A 4IO9A 2NN6G 1N36L 1R9TH 3PIOA 4BY7I 3KOJA 2LXJA 4R4OA 1MKHA 1OXTA 4GNXA 1I94Q 1EIFA 3S2DH 4R4IA 1MIUA 4MH4A 1SROA 2ALYB 4YCUA 4JI8Q 3GTJH 1H95A 2I5LX 1YHBA 3LGJA 4JI5L 5H1SE 2K5HA 3FHWA 4GOPA 3BJUA 3HOWG 2K4KA 4NBFA 2YYZA 3A74A 2JK8A 3W5OA 1TXYA 5M5WH 3W1BA 1SFOI 1IBLQ 3E9HA 4AH6A 4JYAQ 1XMOQ 4RG1A 4A3LH 3CCUA 2MO0A 4OWTB 3A5ZB 4DR2Q 3I56A 3S1NI 1I5FA 4BXXG 4QY7A 2UXCL 4HJ8A 1FVIA 1MJEA 4DV3Q 4A3IH 4PMWA 2R7ZH 3HOUI 2OTJA 1XPUA 3A5UA 1A62A 4HIMA 4DR1Q 5C3EG 2F4MA 4XTCS 4AYBE 5IE8A 4JOIA 5IP7G 3OYYA 2N8NA 5GAHC 2UUBL 1ASYA 4IOAA 1N34L 4OWXB 1X3EA 4UP9A 4R4TA 3RR5A 1P8LA 4BY1I 4POFA 4LF5L 3M3YI 1NY4A 3J80c 1YI2A 3PF5A 5C0XJ 2R93H 5IP7H 3GTOH 2Y0SE 3HOXG 3GTKH 3TQYA 1QUQB 3CAMA 1PYSB 4A3BH 4X62Q 4P72A 1J5EQ 3I55A 2J6AA 2ZM6Q 3GTPH 3VMGA 4A3FI 1ZB9A 1LQLA 4BA2I 1Q81C 2R6GA 1YNXA 4DV1Q 4NBGA 2E2II 2ZTDA 5GAEC 2HIVA 4JI0L 4KHPQ 4DV7L 1HNWL 2DE6A 1B8AA 3JC66 4KI0A 2K5RA 2JS4A 1Y1WH 1L2FA 1YHQA 3KF6A 4JI4L 1JJGA 3G6EA 3M4OI 1FL0A 1XJVA 1E1OA 1ASZA 3B6YA 1RLYA 2PI2E 4NBCA 3PSIA 1IBKQ 2NVTH 4L5RC 2R92I 2F3IA 4YCWA 2GVBA 1VQBA 5GQOA 2QEXA 4DV7Q 1U0LA 4DV2L 1N32L 2CWPA 4X6AH 3MXNB 1YUAA 2YU9I 3S14I 4BBSI 1J6QA 2KCMA 3UDIA 1T9HA 4IFDG 4GOPC 1XNQQ 2LXKA 4LUZA 2UUCL 2RF4A 4DV0Q 4GKKQ 2Z6KC 2WAQE 2VNUD 2E2HI 2VL6A 3HOVH 4TVAB 1WW9A 1EQRA 2KHJA 4NOZA 4NXNL 2E5LL 1TWGH 5IT9c 2V1CC 3AFQA 4KLKA 4C3JH 1IXRA 1GO3E 1QVCA 5C4XI 4PZ7A 3AYHB 4YY3Q 1USPA 4YHHQ 5BR8Q 4R4QA 4PG3A 2OQKA 3HOXH 1L1OC 1QVGA 1HR0L 2E5LQ 4Y7NI 1CKNA 1TWAI 4YWLA 4DUYQ 4JBWA 2CFMA 1UEBA 4OX9L 4GKKL 1S72A 4DV5L 3I4MI 3NELA 4HJAA 4EQ5A 4QGUA 5J3BA 4A3DG 1Y14B 2ZJQA 5C0XG 1ZB8A 4LF8Q 2GN5A 4A3CI 1VQIA 5IWAQ 1QUQA 5IY0A 4OO1I 1K83H 1M90C 4DV2Q 4YCVA 3PO2G 1N32Q 1KL9A 2R93I 1L1OB 3S2HH 4NBHA 2KHIA 1IBKL 3H0GI 2ZJPA 2JA6I 2R7ZG 3GTKI 1D7QA 1KRSA 4A3KG 3I4NG 3STBC 1KHIA 3KDFA 1YJWA 5C4JH 3GTLI 1OXXK 4MZ9A 3PO3S 2AKWB 5M3FG 1PH4A 4LF6Q 2NVXI 5FLXc 1IBMQ 1I50I 3HFZB 1Y1VI 3PUZA 3KLWA 4L5QA 3F2DA 1YIJA 4DV1L 2Q2UA 4KHPL 2WP8J 1KC8C 4HIDA 4GN3B 3I4OA 3S17I 4LFCQ 1KRTA 2ZJRA 1VQEA 4P75A 1OTCA 4JI1Q 4A75A 4A3GG 1WJJA 3HKSA 1BBUA 2DUDA 4LW1A 4R4CA 4A3LI 1VQDA 5M3MG 4NXML 3ULJA 4K0KL 2WAQG 1JJCB 3UE0A 3I2ZA 4NBBA 3K0XA 4K0KQ 3S1RI 3TEHB 1SLJA 4DPGA 1KD1C 1IYJB 1JE5A 4JBKA 4NXMQ 1VQCA 1BKBA 1HZAA 2R92H 3HOVG 4LF5Q 4JI1L 5IP9I 3PO3I 3PUVA 4R1JA 1NMGA 3F8TA 4TQUS 3JAMi 2L15A 4LFCL 5JEAJ 1TWFI 1E24A 1X56A 3K7AH 1PH1A 2PK7A 3STBD 3CCMA 1N34Q 3PGZA 2UUBQ 2Q2HA 1Q1BA 3E9IA 1IBML 1TWCH 3KF8B 2JA5I 1E3PA 4XIGS 4BBRH 1K8GA 3J81c 1HR0Q 4DR1L 4LF6L 1CUKA 3S16H 4A3EI 2YTXA 4HJ9A 2CKZB 4GN5A 4DV3L 2YTYA 1JMCA 1QYPA 3ICEA 4DR2L 4IJLA 5IWAL 4KHZA 5FJ8G 4L5SA 1XMOL 4LF8L 3I7FA 4XX2A 1IBLL 4A3FH 4GOPB 2LSSA 3K80C 2HT1A 4A3JG 4DV5Q 3RZOI 2NN6I 1I3QI 3U4ZA 4OX9Q 5M3FH 4DUYL 4WJ3M 3D31A 2OCEA 1ML8A 1C9OA 3CF5A 2WB1G 3RNUA 2KPIA 3BZKA 4A3KH 1NJIC 1I94L 4JC0A 1Y1WI 1L1OA 5BR8L 3NEMA 4YHHL 3CCLA 3UDXA 1AE3A 1B7YB 3M9BA 4C2MH 3CPWA 4YY3L 1VQ8A 4A93H 1N36Q 1WCMG 1VQ9A 1UE1A 1E22A 1VS0A 1R9TI 5M3MH 2VUMH 5DLQE 1X3FA 1EUJA 1X54A 4BXXI 5GROA 2N78A 4NXNQ 2ID0A 2IY5B 3HOYI 2JA8H 3S1MH 3VMIA 1HZ9A 4DV0L 5C44H 2JNYA 1HZCA 2UUCQ 1VQ6A 1XNQL 5EAYA 4IFDJ 4NB3A 1N8RC 1YEZA 1SFOH 2HHHL 3NENA 1NE3A 5AJ3Q 2WB1E 4WJ4A 2E2HH 4JG2A 3F2BA 1PH6A 1TWHH 3M4QA 1X55A 2IX1A 4GLVB 1TFIA 3EERA 1VQJA 2JE6I 2RCNA 4JCVE 1YBYA 5C44G 3CQZI 1Z47A 1HR0W 4OWWB 2JA7G 4B3RL 1CSQA 1VQNA 1XNRL 4DAYB 3OTOL 3PO2H 1IL2A 2UXBL 1M1KC 5JEAG 4LWCA 4JI4Q 5IYCG 2ASBA 4GKJL 3HOXI 5FLMI 3FP9A 3BU2A 1EYGA 5GAGC 3OW2A 3CCJA 3HOWH 1QVFA 3I07A 3Q87A 2PMZE 4UP7A 4JI0Q 1HNWQ 1TWFH 2E2JI 1Q8KA 3WWVA 4P73A 3KF6B 3PUXA 2QA4A 4A76A 4JI7L 4LF7L 3HKZE 2NZOA 1OXVA 4A3MI 3GCFA 1TWCI 4DR3L 2Z0SA 2ZM6L 4A3IG 5K36G 4JI6L 1FJGQ 1J5EL 1FGUA 4X62L 3GO5A 1UWVA 4A3BI 2DE7A 1K73C 4B3ML 1I6HH 4BY7H 1CKMA 2MQHA 4DR4L 4QTUA 1BVSA 3J81j 1QZGA 3S15H 2NZHA 3GTJI 1HH2P 3ER0A 1MJCA 2F4VQ 1G291 5M5YH 3GTLH 1VQGA 2R92G 1Q46A 1WI5A 1G51A 2IT1A 3L2PA 1GKHA 4HIKA 4LFBQ 3ULLA 1I3QH 1VQFA 2N49A 1LUZA 3HOZG 3TS2A 2K50A 2VUMG 3HKZG 4BBRG 3CCRA 2RHSB 3M4OH 4IFDI 5IYDH 4NBEA 1YVCA 2JEBI 3GTMS 1KIXA 3UDFA 1CKOA 1USPB 4DK3C 1PFSA 3PIPA 1YITA 1RO4A 1E7ZA 3CC4A 2VQEL 2UXCQ 4DAMA 4JYAL 4NPSA 2JEAI 3K7UC 4PZ8A 2MFIA 4Y52H 1NTGA 4P71A 2BA0A 2K5NA 4PZ6A 4JOIC 3PCOB 1SR3A 4DK6C 3S1QI 5LMUQ 5C4XG 4ALPA 1D8LA 4JI5Q 4JI8L 2I5HA 1TWGI 1EFWA 1GD7A 4A3GH 1N9WA 4NB9A 4AYBG 2WFWA 4A93G 1JB7A 3SGIA 1K8AC 3I4MG 2VW9A 5C4XH 1VLAA 3KDFB 4X64L 2OWOA 4A3DI 3ZJYC 5C0XI 1LYLA 2JA9A 1DGSA 4DV4L 2YV5A 4OO1G 2KCTA 4O0AA 3FKIH 2VS1A 3PO2I 4J15A 4LF4Q 3JAMc 1V9PA 2MO1A 3L0OA 4GLXA 4JV5L 2R7ZI 3H0GG 1LM0A 4DR5Q 2B63I 4DKAC 3I4NI 4EX5A 2VZAA 1CSPA 4DR7L 1VQHA 2NVYH 4LFAL 4DR6L 1C0AA 2Q2IA 5LMNL 1K83I 3FKIG 3M4PA 1LTLA 3G4SA 1W2BA 1VQ5A 3D6WA 4RMFA 1Q12A 3RN2A 2N3SA 3EIVA 4JI3L 1HNZQ 1SRUA 4BY1H 3RZDI 4X65L 4LF9L 1PYBA 2NVXH 3GTOI 2Z6KA 3PUYA 2JA7H 5IYDG 2RHQB 3T1YQ 2JA8G 2JA8I 1UE6A 2K5VA 3T1HQ 3KJOA 5IYCH 4A3JH 3J7A5 3HOVI 1SN8A 4HIOA 3CCVA 1X9NA 2OTLA 3CW2C 1PV4A 2I5MX 3J7ZC 3KYHC 4ME3A 1VQKA 4FDBA
chains in the Genus database with same CATH superfamily
4OONA 4AQYQ 3TRZA 2K75A 2OQ0A 2A19A 1A3UA 1YJWZ 2NVQI 2Q8IB 4B3TL 4XQNA 1PTOC 4JI2L 5EKKA 1S5CD 4DUZL 3CC2A 2EJMA 1CZGA 3D4DA 5C3EB 3GTGH 1QB5D 3J81L 2OEOA 3S1QH 4HAEA 1VQOA 3S16I 1BBXC 1PH2A 4OIKA 1XPOA 4DA2A 3H0GH 2VQFL 2EY1A 5C4JI 5HGQA 5CM2M 4B3TQ 4POGA 3K5OA 3BDLA 4CDFC 3C3LA 1TIID 2AWNA 3CCSA 4FXDA 1W3SA 1ML0D 1Q811 4ZQ3A 5JAVA 2FJ2A 5EGTA 1W2BZ 1U4MA 1XMQL 3HOYG 1JICA 4JVZA 4PV1C 2R7FA 2ZXPA 1STNA 3CC41 3KBGA 3O13A 3S1RH 3JAML 4QIWE 4DV6Q 4JI3Q 3RZDH 2R93B 1HRJA 3FDTA 1WD1A 3Q6SA 5D3DA 4YWKA 1K732 2CQOA 5JJLA 4DGZA 2A69C 2YU9H 3P7JA 2JA5B 2P3YA 4L5TA 1HA6A 2NBFA 4FO2A 1VQM1 3U58A 1TS4A 3HP3A 3I73A 3S17H 4LF4L 3H6MA 3KIHA 4LK1C 2JIOA 2EDGA 1RF2D 3SHLA 4BBSG 1K8OA 3DM1A 4QCLA 1EOTA 2F0DA 2ATWA 1B9MA 3NSWA 1DL6A 4KY5A 3A8KE 1K3RA 1XMQQ 1RL2A 2F0OA 3GTGI 5IP9H 1TWGB 3W1GA 3U50C 1YNNC 4DNIA 1B53A 3I4MH 3GTOB 3VA7A 3NBHA 1VQAA 2B8GA 2HQLA 1AH9A 1KABA 3UDGA 3JAMf 1VQLA 2ZTCA 4KD4A 3TS0A 2EXDA 4PMCA 4UHVA 1PTOH 3HOYB 1IZ6A 1D5ZC 4HN7A 3NUCA 4JBJA 3NWSA 2VB3X 2NVTB 1AA6A 1ZYRD 3FVQA 1JOQA 3T4AC 3TREA 4A3CG 4LFBL 1BO0A 3RZOB 1KC82 4DAVA 4RVHA 1A8VA 2KQ3A 3F2CA 2R93G 1E2VA 4IPGA 3QO2A 3CQZH 4ULLA 3CQZB 3G48A 1Q86C 3L9AX 3J80i 5A2QE 3PV0A 4HMIA 2AYDA 1U5KA 2QA41 1Y1VG 2QREB 4AQYL 2JA8B 1VQ91 3NP8A 4K8JA 1AN8A 4V0BA 5KGUA 1PFTA 3CC2Z 3VDYA 4LF7Q 4I7AA 1JOOA 5LHY1 1PHJA 3CCQA 2NAPA 4A93B 4O2DA 4GKJQ 3OTOQ 5K36H 3E0JA 2LS01 1SDFA 2PQEA 3TE5B 5C3EH 5LMNW 1DOLA 2A6HC 4WORA 4P74A 1WCMH 4QL5A 1TS2A 1Q7YC 2B39A 3CPWZ 2AKLA 1UEAB 2IX0A 3CMAZ 1EWIA 5FK9C 4QUFA 3S17B 4G7ZC 4O1NA 4A3CH 2JIRA 3A0JA 1Q862 4HR7B 5C4JB 3ULPA 1YI21 2QW7A 2L11A 1ZEQX 2JJQA 2NN6G 5I6WA 4C56C 1BR9A 1EIFA 1MIUA 5J39A 2ALYB 2NZ1D 2BE5D 1YHBA 2PMZB 2QDBA 4F8MA 2G9HD 2K4KA 3CME1 1STBA 4NBFA 4ILWA 2JK8A 3CCU1 1TXYA 3CRKC 3W1BA 3E9HA 1A15A 4CJ2C 1XMOQ 1LV9A 4RG1A 4JYAQ 3HZXA 4OWTB 3TP5A 1W2BY 3A5ZB 3I91A 2UXCL 1MJEA 2XNAC 2O53A 1F2MA 3HOUI 1DONA 5F2DA 3J7A4 2K03A 4DK0A 3QWNA 2F4MA 4AYBE 2NYZD 1FNUA 1LTRD 5IP7G 2H85A 3MXPA 4NKLA 1NR4A 5GAHC 3BVMA 4IOAA 1F9RA 3MHBA 5KNDA 4UP9A 3RR5A 1VQ4Z 4BY1I 5JVH3 1NY4A 1H9JA 3SVMA 3LWUA 3VR6A 1QUQB 5HGTA 1ZB9A 4K14A 3GV3A 2ZTDA 2HIVA 1IL8A 3EJIA 2JIPA 1B8AA 5M3FB 1YHQA 2JS4A 3G6EA 1FL0A 2C5CA 1RLYA 3SE0A 1NUCA 2NVTH 4YCWA 5GQOA 1TY2A 2NUCA 4C3JG 1VQ51 3UDIA 4IFDG 3S16B 3TN2A 1XNQQ 2UUCL 1CZWA 2Z6KC 4KN4C 2WAQE 1SBBB 1QXFA 4TVAB 1K28A 4NOZA 1SYGA 1F2ZA 1TWGH 2V1CC 1KRLA 2R3ZA 1IXRA 4AYBB 4QF4A 1BCPD 1HTPA 3RMHA 3AYHB 5ELCA 4MRIA 4CBVA 1QVGA 1XTCD 1STHA 2KOLA 1C8CA 2CFMA 1UEBA 4OX9L 1QG7A 1S72A 3GTLB 5M5YB 4A3DG 1Y14B 1ZB8A 4LF8Q 4N9PA 1VQIA 5IWAQ 5IY0A 1N32Q 1F9PA 4DV2Q 1L1OB 2A68C 1NCVA 1D7QA 4A3KG 1GHKA 3I55Z 2CVRA 4MN3A 3KDFA 1PH4A 4XDXA 3F3PC 1V1PB 1WTVA 2NVXI 4N9TA 2K05A 1I50I 3F2DA 3S1RB 2Q2UA 3KLWA 1YJ91 3DUZA 5LL6X 1QILA 4GN3B 3S17I 1YITZ 4JI1Q 1SJED 3FPPA 3HKSA 2DUDA 5EBCA 3K5NA 4A3LI 1VQDA 3K57A 4TNUA 3D9XA 1C4QA 3I2ZA 4K0KQ 1S7MA 1SLJA 2GTHA 2QKIC 4RCOA 5DNFA 1BKBA 4LF5Q 4JI1L 5IP9I 3PO3I 4R1JA 3FPUB 2B2VC 3MFYA 2SOBA 2JA7B 1LTGD 2Q2HA 4ABNA 4IUVA 5JOBA 1I4QA 1E3PA 4NP5A 1K8GA 3BYTB 4DR1L 3CKIB 3S1QB 2L1BA 4HJ9A 2Y0SB 5CV8A 2F0EA 2YADA 5AN9F 1TWFB 4DR2L 4KK7A 4A3FH 4GOPB 3K80C 2OXPA 2HT1A 2NWGA 2RDGA 3HGBA 3G6E1 4IUQA 3RZOI 4DV5Q 4A3JG 4OX9Q 3M4OB 1WD0A 1JWSD 3D31A 1YJ9Z 2OCEA 2KPIA 1A3VA 4DF7A 3D2LA 5BR8L 4LJZC 4C2MH 2YU9B 1TU2B 1UE1A 1E22A 1VS0A 1R9TI 2FHTA 3EQLC 5M3MH 1S72Z 1RHPA 1VQL1 2A6HD 3VR2A 2JA8H 4DV0L 3RZDB 1YNND 3TP6A 4NB3A 1N8RC 3CCE1 1SFOH 1Q90A 4CJ0B 1TT2A 3R2TA 3M4QA 1B44D 5G3LF 4GLVB 1EFID 3RUZA 4EGVA 2RCNA 1Z47A 3NPPA 3PO2H 2UXBL 5JEAG 4LWCA 2ASBA 1VQN1 3NWTA 1IW7C 3TZDA 1X3QA 1HNWQ 1QVFA 1SMYC 3MXUA 2QA4A 4P73A 3A55A 4JI7L 5EQ0A 2VPWA 3EROA 2RBMA 3P5JB 3H0GB 4DR3L 5FLXL 4HTHA 5IGEA 4JI6L 1FGUA 2Q51A 4B3ML 2M6NA 2L55A 5CV7A 1CQVA 3QOLA 4KMUC 1QZGA 1PYWD 3S15H 2F4VQ 4EWCA 4I7ZC 5M5YH 3GTLH 1VQGA 1A6XA 1G51A 2QDLA 3Q0AA 2IW3A 4HIKA 4LFBQ 4H0LC 3HOZG 2K50A 1VQ6Z 3NBIA 4XYOA 3CCRA 3HKZA 2D5DA 2JEBI 3GTPB 3GTMS 1USPB 1Z6HA 2RDHA 3QG1A 3ZYYX 1KTKA 2B8FA 3NQIA 3GP7A 4JYAL 1U4RA 3K7UC 2QRCB 4FF2A 1NTGA 1SR3A 4DK6C 3SR1A 1D8LA 1QCBD 1MSGA 4JI8L 3OHXC 1GD7A 4ZLTF 1VQO1 1N9WA 4RAUC 2WFWA 4K2KA 3A8JE 4S3SA 2VW9A 4X3KA 3MC0B 1S5DD 3FKIH 2VS1A 3PO2I 5FO8B 4GLXA 4WFN3 1LM0A 4EX5A 1EYAA 4DFAA 1CQFA 1VQHA 4L8JA 4LFAL 4A3EB 1W2BA 5KNCA 1S4ZA 4RMFA 1M901 4U673 1E0BA 1HNZQ 4X65L 1EY5A 4K2LA 1IKLA 3GTOI 3U9SA 2Z6KA 3PUYA 2JA7H 2H4OA 2OTL1 3LX0A 3KJOA 5JPMC 3CW2C 2QEXZ 3E3XA 5KYLA 5KYIA 4C3HG 5T64A 2XIWA 3F2UA 1PV4A 1VQKA 1D5XC 1PFMA 1MGSA 1QVFZ 3MA2B 1IW7D 4PQXA 3HOXB 1X3ZA 1AFPA 2ZTEA 2R7DA 2VY3A 4NBDA 2EYJA 4A3EG 1V43A 1HHVA 1TQOA 2F52A 2E75C 1RO0A 3A7LA 1U4PA 2HD3A 2Z4IA 4JBMA 3E5SA 2VF1A 2B2WA 4ZYSA 1V1QA 1YZ6A 1JT8A 1G2TA 1QNKA 1KXLA 1LTID 3PQIA 4IPCA 3HOUG 1HNXQ 4AIMA 2O4XA 3M3YH 2UXDL 5C3EI 1GUWA 1I6HI 1AW7A 3D0FA 3OW2Z 1Y1WG 3ESWA 5IP7I 4C2MB 1MD2D 1KDBA 3H15A 1I50H 1WCMI 1U9RA 4NDXA 3NTKA 3FKIB 3LUSA 2OTJZ 3F3FC 1KAWA 5JJIA 4BY1G 1KQSA 3KFUA 1DOKA 1WYDA 3EBEA 2XTIA 2F0WA 2MGSA 3UE1A 1WTPA 1YJNA 1BUVT 3G71A 1SFOB 2UU9L 4LF9Q 1PFBA 2EJGC 4X65Q 4IQZA 3DEOA 4RV9A 4EQPA 5C44I 4IALA 2JA6H 5A2Qb 2JA7I 3IR7A 1VCIA 4J8QA 3TMEA 1XTDA 1QJOA 4DR6Q 3S14H 4RKBA 1Z02A 1NJI2 4L6TB 1Q821 1S40A 2K3RA 1VQ41 3EEDA 4CKEA 3FEWX 3MEFA 3BDOA 4JV5Q 1YJ9A 1VMPA 3CMA1 1Y8OB 1WTRA 4A3MG 2V3VA 2H1EA 2R7ZB 2B63B 3IKJA 1GM5A 2D2CC 2JYOA 3CC7A 2CWAA 5D1PA 3RZOH 1YI2Z 4KKSA 4S1TA 4MNOA 1EZ8A 3CCL1 4Q5VA 2E8GA 2BH8A 2BA1A 2PNHA 4QB4A 2QCPX 5T1IA 3JAMb 4LUVA 4MHEA 4E2XA 1CFMA 1WOCA 2UXDQ 4UY8C 2C9OA 2VQEQ 4B9WA 2LFNA 3NH5A 3GV6A 2AWOA 1CT1D 1K0RA 3MEHA 2MNAA 1EEID 1ET6A 2CCZA 2L9HA 2AQ3B 4UPAA 3ND8A 2IHEA 2NVQB 4RCNA 3J80E 2PMZA 1UNSA 3CMEA 2PW5A 2F4VL 1TVXA 2Y0SG 4A3KI 4QQBX 5DAUA 2RHBA 2NVTI 1ICWA 1UE7A 2AMCB 3GTMH 4A93I 1KD11 4GLAC 4LUOA 1QVGY 2UUAL 1VQNZ 1JJ2Z 1B70B 1XXGA 1YHAA 1LTTD 4IUPA 3CD6A 1RIPA 4BXXH 1GUOA 3HOYH 3OW7A 3VR5A 4A3LG 5CV4A 2F4OA 3T1YL 4QJFA 2KEEA 3WOFA 3K58A 2DGYA 1XNRQ 3E0EA 1ET9A 5IT9f 4OL7A 1RJTA 1HNZL 2NTTA 4BA1I 3PO3G 1JQYD 2K1BA 2SNMA 4HGYA 4HEDA 1UAPA 1GOZA 1EU4A 1YHQZ 5IT9L 2HHHQ 5GADC 4KY7A 3Q22A 1ENFA 4K8IA 1PH7A 1L0WA 4DR5L 3NBHB 3KLSX 1G6PA 3VYUA 3VB9A 2RBLA 3D6CA 2WB1B 4RKLA 2HUGA 4NFRA 1X3GA 4DV4Q 4E30A 3L7ZC 5C5LA 3A7AB 5M5XH 1A63A 3KBXA 3VTNA 1N36L 4C3IH 5HY6A 1ZKOA 2LXJA 4R4OA 1MKHA 1S5BD 4CKCA 3CMEZ 3GTJH 4YCUA 3MXNA 3SK6A 2I5LX 3LGJA 5LL6f 4JI5L 2EY2A 2K5HA 4L63B 3J7YW 3HOWG 1D1KA 2A73B 3W5OA 4A3LH 4AH6A 3CXCZ 1G91A 3CCUA 2MO0A 4TRDA 4DXFA 3I56A 5FLXb 2A68D 1FVIA 3PO2B 1B50A 4PMWA 1XPUA 4DR1Q 5IE8A 4MIUA 3OYYA 1M1K1 2EVBA 3J80c 3GTOH 2Y0SE 4XQJA 3GTKH 2L4NA 5T67A 2RKSA 4RVFA 3CAMA 2RQXA 4CDCC 5C0XH 2ZM6Q 4A3FI 3HRZC 4BA2I 1B1ZA 1W6JA 4G57A 1Q81C 1VQP1 1YNXA 1V1PA 2BDOA 1EY9A 4KHPQ 4NBGA 5GAEC 4JI0L 3I4NB 2E9HA 1HNWL 2DE6A 4TSSA 2K5RA 4OEMB 3KF6A 2FMMA 4JI4L 3D4RA 2ZAEB 3M4OI 3BVGA 2KHSA 1YHQ1 3PSIA 1U0LA 2OTLZ 2CWPA 4F7XA 5EPKA 1YUAA 2YU9I 2M48A 1F2LA 1ESFA 1O7LA 4CL1A 3HOVH 1EQRA 4ZK9B 2QRDB 1VMCA 2BCOA 4RH6A 1MI2A 2B2YC 1SE3A 5C4XI 3MWYW 3CCR1 2JN4A 4YY3Q 3CCV1 1H9SB 1LT5D 3R93A 5BR8Q 5DM73 4YHHQ 4PG3A 2HU9A 2XWBB 3W3AA 2E2HB 1TWAI 2F0LA 1T5EA 1QNUA 1RO2A 4JBWA 1LTAD 4GKKL 1VQPZ 4B9XA 3I4MI 3NELA 4IUNA 1EY7A 5J3BA 1VF7A 3CCQZ 4KD3A 1K83H 4YCVA 5JPNC 1KL9A 3K59A 1CHPD 2KHIA 2MP1A 2JA6I 1SE2A 3GTKI 2KECA 1KRSA 3NXWA 4M8AA 5IT9b 1KHIA 4LF6Q 3GTLI 2AKWB 2SDFA 1HCZA 4HSPA 4V190 4GZYC 1IBMQ 1JWUD 4KTAA 4KJNA 4KHPL 5C6AA 2WP8J 1KC8C 2FINB 4HIDA 3I561 3R2IA 2ZJRA 4A3GG 5M3MG 1PZKD 1F2YA 3ULJA 4ZAIA 4K0KL 1JJCB 3OMCA 2JA8G 4HH4A 3G711 2QLVB 3Q23A 4ME5A 3F8TA 2M00A 4LFCL 5BN4A 1E24A 2EYMA 4OGQC 2KI7B 3STBD 3V96A 3CCMA 4RVDA 2LEXA 3PGZA 2IZ3A 1TWCH 5EKIA 3KF8B 2I07B 4XIGS 1YUKA 3T53B 3J81f 2V8KA 3QOJA 2E76C 2YTYA 4GN5A 1WJ2A 5FO7B 1JMCA 1QYPA 1D2BA 3ICEA 2HCIA 5CBAE 4L5SA 1HUMA 1SYDA 1QWYA 4A3DB 4MONA 1RDPD 2L0CA 3U4ZA 3LNNA 1I3QI 1A2TA 5M3FH 4DUYL 2KVMA 1K3BC 2WB1G 4I65A 3BZKA 3BVZA 4A3KH 4PMBA 1L1OA 1HXYD 3CCLA 1AE3A 4A93H 3HKZB 3MFGA 1PTOF 1K83B 4BXXI 3MZLB 3WOEA 3HOYI 1IYVA 3VMIA 1TY0A 4ZKCB 3CCRZ 1VQ6A 3M4YA 2F3WA 1YJNZ 4WJ4A 5C4HA 2E2HH 2MJ8A 4NW2A 1X55A 4LAAA 1JC7A 4Y7NB 4HCSA 5CORA 1YBYA 5C44G 1GHJA 1QVFY 3I72A 1KC81 2JA7G 4B3RL 2CHBD 2XSCA 3OTOL 1YJN1 4JI4Q 3EFXD 1KDCA 3HOXI 3FP9A 3BU2A 4XT1B 5GAGC 3OW2A 4EQOA 2PMZE 4UP7A 4JI0Q 2IL8A 2F0FA 2J4XA 1Q8KA 2ICEC 1LTSD 4K5XA 4A3MI 3GCFA 1TWCI 3BG0B 1FJGQ 1J5EL 5BN3A 2A74C 2AQ1B 3GTQB 2DE7A 1RCVD 3CU7A 1K73C 2HQEA 1I6HH 1CKMA 1BVSA 4F88A 2J7ZA 3J81j 4J1MA 3GTJI 2PZWA 1A2UA 1MJCA 1TWAB 4ZUIA 1K8MA 2R92G 1Q46A 1WI5A 5JVG3 3ULLA 1I3QH 1VQFA 4JPBW 4LMQD 1B9NA 4AYBA 1VQKZ 3X3MA 5IYDH 4NBEA 3OPOA 1YVCA 1VQ81 1D1IA 1KIXA 1CKOA 5I4DA 3CC4A 3OMGA 1RO4A 3GTKB 2JP1A 3P20A 4DAMA 2EXZA 2PW7A 2IWHA 3IAYA 4FP5D 4RGMA 2MFIA 3CCLZ 4A3JH 2EY5A 3PCOB 5IIFA 1F9QA 1K0SA 1TWGI 3S2HB 4A3GH 2NVYB 4R8NA 4A93G 1JB7A 1FNVA 1EQTA 5CBEE 1VLAA 3ZJYC 5C0XI 1QE6A 4DV4L 2K04A 2A5HA 4OO1G 4CGYB 1F9SA 2XWJB 1Q812 3JAMc 4LF4Q 2MO1A 1SJHD 2R7ZI 4DR5Q 1CTMA 1RQFA 4KV6A 3I4NI 4DKAC 4XT3B 5HURA 1C0AA 1K9M2 2M2LA 1VQ5A 3CD61 1LTLA 2CH4W 5C3XA 5D65A 1Q12A 1B3AA 3EIVA 2Z9HA 1P9NA 3KIFA 2NVXH 2VUGA 1K731 3HOZB 2K28A 2K5WA 4XYQA 3BYYB 5IGCA 2K5VA 3J7A5 5IYCH 1X0TA 3HOVI 1SN8A 4EQNA 2OTLA 4DU9A 2BDNA 2QEJC 5FKAC 3J7ZC 5I2XA 4KN7C 4KKUA 2Q8RE 4BS9A 2UUAQ 2DE5A 2KA7A 3D3RA 3IRBA 1ESRA 3GTMI 2PM9A 3PO3H 1LTBD 1TWAH 3S1NH 2J0TD 1R4QB 4B3SL 3HOWI 1I6HB 2F0MA 4GNXB 3AEVA 1GUNA 1GVPA 5IODA 1EYDA 3NH4A 2RT9A 2O5JC 3KK7A 3MZ5A 2I0QA 1PH3A 3G7LA 5IOCA 3DMUA 3PUWA 4DUZQ 2JA6B 2Q2TA 3H3VC 2DNEA 1VQ8Z 5FLXE 1RNIA 2P28A 3RD4A 3GTPI 1Z01A 4Y7NH 3I4NH 3G4SZ 3S24A 2ZT9C 2KCCA 3DXJC 2ZXRA 1I4HA 4XXEA 1Q82C 2LKVA 1HZBA 1O78A 3KUPA 4DAYA 1OO9B 1P16A 2E2DC 4A3FG 3CC21 3GTJB 4NH1C 3ND9A 4MTNA 4Y52I 1SNQA 3DEPA 2EYOA 4BBSH 4GS3A 4GN4B 2KUMA 1JWMD 1Y1VH 1YJW1 1BCPF 1HFGA 1S3OA 2GVAA 2HF1A 2FXQA 3EN2A 2OOYB 3CMAA 4A3DH 2UU9Q 1J8IA 4X64Q 2B2VA 2KENA 1PZID 4A3BG 2PQAB 4FF1A 4ID6A 1CI3M 1QF8A 4K6DA 2BH2A 5KEEA 1X6OA 3AB9A 3C1FA 3K8AA 5AFWA 4C3HH 3K7AI 2NVYI 1NUIA 1SNCA 3BG1B 1PTOB 2EIFA 5E7NA 2D0OA 2F03A 3S15I 3CCEA 2WB1A 5A2QL 4A3EH 1HNXL 1EU3A 1S5ED 1Y1VS 1E2WA 4QMGA 2CW0D 3S2DI 1DYQA 3U9OA 1JWHC 4RHRA 4UP8A 3MTSA 1Y8CA 3QJYA 1VQMA 2F0SA 2EE1A 3V2TA 1WZNA 3J80f 1ILQA 4ZRZA 1E1TA 3BZCA 4RGNA 2JA6G 4MD8A 3PMFA 4MD9A 4JI2Q 5K5PA 3AQQA 3CPWY 1GXDC 4B3MQ 3G6EZ 2VPXA 4MTKA 1N33Q 1ZXTA 5CMDA 3H3VH 4IOCA 1TWHB 4JI6Q 3U4VA 3MZKB 3CP0A 3PF4A 2IHFA 4DR3Q 1CHQD 2B3GA 2D0PA 2PZTA 1BDOA 4A3MH 1TWCB 1WFQA 3T1HL 3BS1A 2B63G 3RLFA 4HJ7A 1EOVA 2KEDA 1NP6A 1AZPA 1PLFA 5IP9G 1SMYD 3FKII 1FR3A 2QF7A 2AHOB 1KDAA 2HCCA 1SXTA 1PA6A 1PH9A 5AJ3L 1X65A 1LT6D 1Z03A 3M7NA 3VMHA 4HGZA 1AE2A 5DEHA 4M1UB 4IPDA 5A2Qf 1NBWA 4A3JI 1KNAA 4IO9A 3AU7A 3LWEA 4BY7I 3KOJA 1OXTA 3S2DH 4J6HA 4NMZA 1WTWA 1H95A 4JI8Q 3PIP3 1TS3A 3FHWA 3BJUA 3A74A 2O5IC 5IGBA 5M5WH 4RGTA 1PDQA 3CCMZ 3SDZA 2PZUA 3I90A 4IN3A 2E74C 4DR2Q 1I5FA 1F77A 4A3IH 1FNWA 2R7ZH 1PMRA 3Q24A 2OTJA 3A5UA 1WTHA 3FMCA 4TKOB 4XTCS 1B4OA 4JOIA 5T1GA 2N8NA 4MD7A 4FF3A 1TKWB 3J81E 1Q16A 1X3EA 1JORA 4R4TA 4LF5L 3M3YI 3GQBA 1YI2A 3PF5A 2CQAA 5C0XJ 2R93H 5IP7H 1VQ71 3HOXG 2AQ2B 2Q4ZA 4A3BH 4X62Q 3J7AF 4P72A 1N8R2 1J5EQ 3OW2Y 2LMCB 2Q8TA 5CGKA 5CC4A 2R6GA 4R8IA 1BXTA 4DV1Q 5I9OA 4C1NI 4KI0A 1GUGA 3A56A 2LIYA 2RPRA 1LT4D 1I4XA 2WINB 5J22A 1ASZA 1I3QB 3S15B 4A3FB 2PI2E 4NBCA 2BOSA 5FO9B 1KLGD 5I2YA 2R92I 2QEXA 1VQBA 3S2DB 1N32L 4X6AH 1WIIA 3MXNB 1SNMA 3S14I 1DOMA 1J6QA 2KCMA 1RD9D 4GOPC 3VYSA 2RF4A 4GKKQ 2EPBA 2VNUD 4XQQA 2E2HI 1VF5C 2KHJA 4IUUA 5IT9c 4DGLA 4KLKA 3CRLC 1FDOA 4C3JH 1VQLZ 1GO3E 3QIAA 4PZ7A 2B2TC 4R4QA 2OQKA 4UAIA 1L1OC 3MONA 3HOXH 4Y7NI 1CKNA 3TSSA 2RA4A 2AUKA 2N55A 4YWLA 2K5QA 2R61A 2VPYA 3IF8A 4IUTA 4DV5L 4HJAA 1KD12 4QGUA 3H91A 5C0XG 5C4XB 2WKCA 2WAQA 2E7ZA 1O80A 3PO2G 4DAPA 2R93I 1YNJC 2V8IA 4A3MB 2ZJPA 2R7ZG 3CCEZ 1GUSA 1ENAA 3I4NG 3STBC 2GU2A 3P1HA 1HR0L 1SNPA 5M5XB 4MZ9A 3I4MB 3PO3S 5M3FG 1N8R1 5C5MA 3HFZB 1Y1VI 3PUZA 1VQ7Z 1T5XD 4DV1L 3R8BA 3S1NB 4H7BA 1KRTA 1VQEA 4P75A 1OTCA 1DM0B 2VB2X 4R4CA 4NXML 1JB3A 3I3CA 4CDEC 2F0HA 1TR5A 4NBBA 1JCKB 4KJOA 4DPGA 1KD1C 2R92H 4C1NK 4JBKA 3HEJA 1VQCA 3HOVG 4HSVA 1Y8NB 2M9VA 1NMGA 4TQUS 4G7HC 1STYA 5JEAJ 3K7AH 5C44B 2O4HA 1PH1A 3TBIB 1IBML 1Q1BA 3E9IA 4H13C 2ENBA 3S16H 1UUPA 4E2YA 2Z4HA 1DCZA 4A3EI 2YTXA 3NK9A 2LFUA 1PXUA 2OT2A 2IV2X 1XMOL 5IT9E 3I7FA 3C2PA 4XX2A 1IBLL 5ELDA 1VQOZ 1Q3LA 1L0XB 2XVSA 2NN6I 3H09A 4WJ3M 1ML8A 1C9OA 3CF5A 1NJIC 4DNRB 1I94L 1Y1WI 3M9BA 5D1OB 4RGOS 3SK4A 1VQ8A 4BBSB 3OSOA 1WCMG 4RS4A 3IFUA 1PZJD 1D5MC 2DY7A 4BBRB 2VUMH 5T6BA 4N8X1 1X54A 5GROA 2N78A 1EY0A 2IY5B 4KHVA 4ZCKA 4IFDJ 5M3MB 1XNQL 1VQ61 1L0YB 5AJ3Q 2WB1E 4JG2A 3F2BA 1TWHH 3SK8A 1HQRD 2B2UC 1KNEA 1TFIA 1VQJA 4JCVE 4OWWB 3CD6Z 4A3KB 4DAYB 5IYCG 4DNTB 1EYGA 3HOWH 4E2WA 3CCJA 4FF4A 2OF1A 3WWVA 4LF7L 3KF6B 3PUXA 2F0VA 2OOXB 3TP8A 4A76A 3HKZE 5CV9A 1OXVA 3SK5A 4A3GB 4R9WA 3S1MB 2LY7A 1D6EC 2ZM6L 4KY6A 3GO5A 5KRUA 1UWVA 1BCPC 4A3JB 1Q7Y1 5EKLA 4BY7H 3MVVA 5J1ZA 3NHHA 3DWAA 2KJXA 1VQ5Z 3L3OC 1WTOA 5A35A 1RKNA 3L2PA 5M9OA 1H9MA 2N49A 3NTHA 4B08A 5IGDA 3M4OH 2QILA 4OELB 5EPLA 4C3IG 2Z1CA 1H9SA 3CCVZ 2F3VA 5EBDA 3W2DA 1NAPA 1PFSA 1YITA 4BWGB 2UXCQ 5IGFA 1KLUD 1YIJZ 2JEAI 3CC7Z 2NVXB 2WKDA 1PRTD 4Y52H 1EYCA 1X3PA 1Y1VB 2BA0A 3E6ZX 4ALPA 3FRPB 4JI5Q 4JW0A 1EY8A 2R6MA 2I5HA 1EFWA 3I56Z 4AYBG 1FYCA 2WV6D 4FYDA 2TSSA 1K8AC 1VQK1 1CM9A 5C4XH 4X64L 4A3DI 1J9OA 2A69D 1LYLA 4U68A 2JA9A 1DGSA 3CC4Z 2YV5A 1V9PA 3L0OA 4ZKBB 3H0GG 3J80b 4K5VA 2VZAA 3BZDB 2OTJ1 3CCJZ 5IGGA 3FQMA 3DHQA 5ELEA 2NVYH 4DR6L 2MPMA 2F0PA 1K83I 3FKIG 3G4SA 3D6WA 3HOVB 2B2WC 4JI3L 1TS5A 1SRUA 2CW0C 3NTIA 3TDHB 4LF9L 1DJRD 3IFTA 2RHQB 3VR3A 3KF8A 1S5FD 3KLSA 1X9NA 4HIOA 3CCVA 3T16A 3OWEB 3KYHC 4ME3A 2NB0A 2DY8A 5BN5A 2JUBA 3HOWB 4FDBA 1BNZA 1EWHA 1SE8A 2KBNA 2E2IH 2EGTA 1N33L 2A1AA 3NQTA 4BY7G 2IZ4A 2JA5G 1BBWA 1OXUA 1FGBD 3VYRA 3H3VI 5I6YA 2H5XA 1VDZA 1SNDA 4NBAA 2C35B 1MHWC 2HIXA 1EIGA 3BG3A 5FLMH 3HOUH 1HUNA 1N2FA 5ELOA 1QZHA 1JJ2A 2PQAA 2E2JH 4A3BB 3GTQI 4YIJA 2PI2A 2PYKA 3CPFA 2EQSA 4OHJA 1C7YA 1LT3D 5IYBG 1H9RA 4B3SQ 3HOZH 3RLOA 1VQ4A 4G4KA 2K5DA 2YTVA 1HJPA 2MHVA 5ELNA 4UDUC 1X3WA 2K14A 2X6LA 1PH8A 4CJ1B 2KCNA 2FMCA 1NMFA 1K8A1 5ISRA 1EQQA 3NDJA 3J81i 4H02A 3VA5A 2RSNA 1YIT1 3RLNA 1SIWA 4GNXC 2XRQD 5CYUA 1K9M1 1RTNA 1G8ZD 1SE4A 2BJOA 2JMOA 4X66Q 1LACA 1Q861 2A8VA 2WACA 1HFNA 1XPRA 3IX0A 2JQOA 3DLLA 1SMXA 3S2HI 3IFDA 1PVOA 1SYEA 2B29A 2ICIA 1II3A 1VQ7A 1R4PB 2EYPA 4LFAQ 3PIO3 3ERQA 4IZ8A 5FLMG 2EYHA 1A0IA 1WTXA 1OXSC 3SEBA 2RVLA 3GTGB 4CDDC 4OXPA 4DV6L 2F0UA 4A3II 3I70A 3CXCA 4X66L 4E2ZA 4E31A 1I4PA 4N8FA 4HJ5A 2NN6H 1Q1EA 2QGQA 3KJPA 3S9WA 3DWPA 2I3CA 2B63H 5FJ8H 2JSOA 2RSOA 3C1EA 2OZKA 4DK1A 3GTQH 4IPHA 5LMUL 3GDEA 2D9UA 4APVA 3HOZI 3G71Z 1R9TB 2DN8A 2JA5H 2VUMI 4BBRI 3Q8DA 3AFPA 1O7IA 3OIQA 3P75A 4X3UA 2VQFQ 4NB8A 2VXWA 4BY1B 2X69A 4A4IA 4O42A 3CHBD 1AP0A 1VQPA 1TWHI 3I551 1CKNB 1PFNA 1PRTB 2FFKB 4CKBA 3GTMB 4QTTA 1EY4A 2HDMA 2XRSD 3H3VJ 2F0KA 2ZXOA 2QA4Z 1Q8IA 2PNRC 5DM63 2NVQH 4OIJA 4DR4Q 1ZYRC 3ERSX 1K9MC 4X6AI 4YWMA 2JIMA 1M1K2 1Y8PB 2SNSA 3J80L 3EVQA 3HS0C 3I8ZA 1FJGL 2Z6BA 2EOTA 4CHTB 3GD7A 2EYFA 4A3GI 2CH4A 4P2CB 4WRDA 4JI7Q 4LNQA 3S1MI 5JJKA 5E3FA 2P5ZX 1BOSA 2RCFA 3K81C 4WJWA 3ITPA 4EVOA 3RN5A 2UXBQ 4QIWB 1Z9FA 1M8AA 4F87A 4B3RQ 5E4XA 4X3SA 3J7AV 2L12A 1DZ1A 3NH8A 3KLRA 1EL0A 5LMNQ 1FD7D 3GKQA 4DR7Q 5D14A 2JR6A 1E2ZA 2L5TA 2XN9C 5IYBH 2EJFC 4IJHA 2IJ0A 1QOHA 2WIIB 2K52A 2F0GA 5C3WA 2D62A 1KQSY 4DQYB 2XGTA 1JOKA 3QR8A 3F1ZA 1PH5A 2ES2A 1SYBA 3DM3A 1UE5A 2SEBD 3N6RA 3M85A 3K0YA 1R9TH 3PIOA 4GNXA 1I94Q 3EA6A 4R4IA 1SROA 4MH4A 5H1SE 3HOUB 2A6ED 2NTSA 1NJI1 4GOPA 1XX8A 4KKTA 2PO4A 2F4IA 2YYZA 5CR3A 1IBLQ 1SFOI 3CCS1 4IFDH 1AEXA 4BXXG 3S1NI 2O2LD 3CC71 4QY7A 4HJ8A 2G9DA 2F0QA 4PNYA 1ONLA 3T4NB 4DV3Q 2K32A 1A62A 4HIMA 5C3EG 3CCSZ 3QWUA 1NSNS 1EZ6A 2G2KA 3A54A 2UUBL 1ASYA 1JE4A 1HA5A 2N88A 1N34L 2V4DA 1BF4A 2BE5C 4OWXB 4K6LA 1LABA 1P8LA 4POFA 5JJZA 1ENCA 2WAQB 3TQYA 1PYSB 3J81b 3I55A 2J6AA 3GTPH 3VMGA 4DXGA 1LQLA 2I46A 4X3TA 2E2II 3G6JB 4RWSC 4DN4M 5KNBA 1EY6A 3JC66 1Y1WH 1L2FA 5M5WB 1G2SA 1XJVA 1E1OA 1M4VA 3B6YA 4Q0FA 1O7ZA 4JK1C 3QB3A 1IBKQ 4L5RC 2F3IA 4DV7Q 2GVBA 1QVGZ 1STGA 4DV2L 5I9PA 3MXGA 4BBSI 1T9HA 2K33A 1O7YA 2LXKA 4LUZA 3D8GA 2EYLA 4DV0Q 2E2JB 4E33A 2VL6A 2PPBC 2R92B 1WW9A 1DXMA 4NXNL 2E5LL 3AFQA 3M7GA 1STEA 1V1OA 2B2UA 3D4WA 1AZQA 2VPZA 1BCPB 1QVCA 1WCMB 1EWCA 4ODGA 5NUCA 1USPA 2E5LQ 1DD2A 3FQQA 1I6VC 2JXMB 2X6GA 2W03A 1S721 4DUYQ 3VR4A 4EQ5A 3CCM1 5L37A 5E4WC 5ELFA 2ZJQA 2GN5A 4A3CI 4OO1I 4BY7B 1QUQA 3UI2A 3K5MA 1M90C 2AUJD 3S2HH 4NBHA 1IBKL 3H0GI 5D1OA 2F0JA 1YJWA 5C4JH 1OXXK 1U4LA 2JIQA 5FLXc 1HPCA 3T13A 1ILPA 3OWFA 1YIJA 2DJFC 1HTLD 4L5QA 3NFZA 3I4OA 4LFCQ 3PO3B 2F0TA 2EZVA 1CK1A 4A75A 1WJJA 4LW1A 1BBUA 2IX3A 1WTQA 1VQMZ 4A3IB 4C3JB 4MXUA 2WAQG 3UE0A 1B2TA 3R3OA 2G5DA 3K0XA 3S1RI 1I50B 3TEHB 4NXMQ 1IYJB 1JE5A 4RVGA 3G4S1 1HZAA 1SYCA 3PUVA 3TP7A 1EIYB 3JAMi 2L15A 1TWFI 1M902 3CCJ1 1X56A 2PK7A 3OIPA 1N34Q 1SYFA 2V45A 2UUBQ 1LO5D 2JA5I 4H44C 1JR0D 4BBRH 4LF6L 3J81c 1HR0Q 4HMJA 2VUMB 1CUKA 5LL6S 2MUYA 3ONAB 4C3IB 2CKZB 4FXKC 4DV3L 4C3HB 5ELBA 5CV5A 4IJLA 3X3NA 4KHZA 5IWAL 5FJ8G 1Y1WB 3TDQA 4LF8L 1SEBD 3K5LA 5CV6A 2K7VA 1EEFD 2LSSA 5G3LD 1G6ZA 1H9KA 1I4GA 1YNJD 3URYA 1SAPA 3RNUA 5EPJA 3BDCA 1IKMA 4JC0A 3SXHA 3NEMA 4YHHL 3UDXA 1B7YB 4FVMA 3CPWA 1C48A 3NDIA 4YY3L 3S14B 4OO1H 1N36Q 4G7OC 1VQ9A 1XYIA 3TZUA 5DLQE 1X3FA 2K6AA 1EUJA 4NXNQ 2ID0A 3CCQ1 3HG9A 1EQVA 1NR2A 3S1MH 1Q822 1HZ9A 5C44H 2JNYA 1HZCA 5TSSA 2UUCQ 5EAYA 2DJGC 1ICFB 1YEZA 3OOCA 2HHHL 3NENA 1NE3A 1Y69U 1PH6A 2B2YA 1HQMC 2IX1A 1NNXA 3EERA 4DV7L 2JE6I 1HR0W 3CQZI 2W04A 3A8IE 1A3TA 4RHSA 1CSQA 1VQNA 1XNRL 5FLXf 1IL2A 1M1KC 4GKJL 4QUCA 1V8QA 5FLMI 2PCFB 5K36G 1BQQT 3I07A 3Q87A 1TWFH 2E2JI 1JJGA 1Z7TA 5D3IB 2NZOA 3K6OA 1PRTF 2A6EC 2Z0SA 5E1FA 5FOBB 4A3IG 4X62L 2RDFA 1Q7Y2 4A3BI 3H94A 1VQ9Z 4ZUJA 5C4ZA 2MQHA 1YIJ1 1MBYA 4FNFA 4QTUA 4DR4L 2NZHA 1HH2P 3ER0A 1G291 4E32A 2TMPA 3DWQA 1K8A2 1ZH1A 2F1MA 2IT1A 1GKHA 5EJWA 3V05A 1FDIA 1LUZA 1LLRD 3TS2A 2VUMG 3HKZG 4BBRG 2RHSB 4IFDI 3VYTA 3UDFA 4DK3C 4FXGC 5KIXA 3MAQA 3PIPA 1E7ZA 2VQEL 1JJ2Y 2QR1B 1RODA 4HCEA 3C46A 1CA6A 4NPSA 2Z8LA 3T51B 4PZ8A 4K5WA 4P71A 4PZ6A 2K5NA 5C4XG 4JOIC 5LMUQ 3S1QI 5JEAH 1GJXA 1I4RA 3AMUA 1IHZA 3JAME 3K7AB 4NB9A 3CCUZ 3SGIA 3I4MG 3WDNA 1GUTA 3KDFB 2OWOA 2V8JA 1WVLA 1SSOA 4E6IA 2KCTA 4O0AA 3N52A 4J15A 4RFBA 1EIHA 4JV5L 2HDLA 2B63I 2E2IB 2QEX1 1CSPA 1MSHA 2IPKD 3I4LA 4DR7L 2Q2IA 5LMNL 1W6KA 4RA8A 3IL8A 1SNOA 3M4PA 3NE5B 1KQSZ 1RTOA 1PTOD 1CA5A 1IYUA 2F0NA 3RN2A 2N3SA 3M3YB 4BY1H 3RZDI 1PYBA 2QKDA 1KAAA 3T56B 2K01A 1XWEA 1PRTC 5IYDG 3T1YQ 1STAA 1B3QA 2JA8I 1UE6A 2DNCA 2EY6A 2B2TA 2F0IA 3T1HQ 5COYA 4Z9CB 2GA4B 2RIQA 1X32A 4IURA 2I5MX 2GTIA 2Y0SA 3CXCY
chains in the Genus database with same CATH topology
4OONA 4AQYQ 3TRZA 2K75A 2OQ0A 2A19A 4B3TL 1YJWZ 2NVQI 4JI2L 4DUZL 3CC2A 3GTGH 3S1QH 1VQOA 3S16I 1PH2A 1XPOA 3H0GH 2VQFL 5C4JI 5HGQA 5CM2M 4B3TQ 4POGA 2AWNA 3CCSA 1W3SA 1Q811 1W2BZ 1XMQL 3HOYG 2R7FA 3CC41 3S1RH 4QIWE 4DV6Q 4JI3Q 3RZDH 4YWKA 1K732 2CQOA 5JJLA 2YU9H 2P3YA 4L5TA 1VQM1 3U58A 3S17H 4LF4L 3KIHA 4BBSG 2ATWA 1DL6A 1K3RA 1XMQQ 1RL2A 5IP9H 3GTGI 3W1GA 3U50C 4DNIA 3I4MH 1VQAA 2HQLA 1AH9A 3UDGA 3JAMf 1VQLA 2ZTCA 3TS0A 2EXDA 1IZ6A 4JBJA 4LFBL 3TREA 4A3CG 1KC82 4RVHA 1A8VA 3F2CA 2R93G 4IPGA 3CQZH 3G48A 1Q86C 3J80i 3PV0A 1U5KA 2QA41 1Y1VG 2QREB 4AQYL 1VQ91 1PFTA 3CC2Z 3VDYA 4LF7Q 1PHJA 3CCQA 4O2DA 4GKJQ 3OTOQ 3TE5B 5C3EH 5LMNW 4P74A 1WCMH 4QL5A 1Q7YC 3CPWZ 2AKLA 2IX0A 3CMAZ 1EWIA 4A3CH 3A0JA 1Q862 3ULPA 1YI21 2JJQA 2NN6G 1EIFA 1MIUA 2ALYB 1YHBA 2K4KA 3CME1 4NBFA 2JK8A 3CCU1 1TXYA 3W1BA 3E9HA 4JYAQ 1XMOQ 4RG1A 4OWTB 1W2BY 3A5ZB 2UXCL 1MJEA 2O53A 3HOUI 3J7A4 2F4MA 4AYBE 5IP7G 2H85A 5GAHC 4IOAA 4UP9A 3RR5A 1VQ4Z 4BY1I 1NY4A 1QUQB 1ZB9A 2ZTDA 2HIVA 1B8AA 1YHQA 2JS4A 3G6EA 1FL0A 1RLYA 2NVTH 4YCWA 5GQOA 1VQ51 3UDIA 4IFDG 1XNQQ 2UUCL 2Z6KC 2WAQE 4TVAB 4NOZA 1TWGH 2V1CC 1KRLA 1IXRA 3AYHB 4MRIA 1QVGA 2CFMA 1UEBA 4OX9L 1S72A 4A3DG 1Y14B 1ZB8A 4LF8Q 1VQIA 5IWAQ 5IY0A 1N32Q 4DV2Q 1L1OB 1D7QA 4A3KG 3I55Z 3KDFA 1PH4A 3F3PC 2NVXI 1I50I 3F2DA 2Q2UA 3KLWA 1YJ91 4GN3B 3S17I 1YITZ 4JI1Q 3HKSA 2DUDA 4A3LI 1VQDA 4TNUA 3D9XA 3I2ZA 4K0KQ 1S7MA 1SLJA 2GTHA 1BKBA 4LF5Q 4JI1L 5IP9I 3PO3I 4R1JA 2Q2HA 1E3PA 1K8GA 4DR1L 4HJ9A 2YADA 5AN9F 4DR2L 4A3FH 4GOPB 3K80C 2HT1A 4A3JG 3G6E1 4DV5Q 3RZOI 4OX9Q 3D31A 1YJ9Z 2OCEA 2KPIA 5BR8L 4C2MH 1UE1A 1E22A 1VS0A 1R9TI 5M3MH 1S72Z 1VQL1 2JA8H 4DV0L 4NB3A 1N8RC 3CCE1 1SFOH 3M4QA 4GLVB 2RCNA 1Z47A 3PO2H 2UXBL 5JEAG 4LWCA 2ASBA 1VQN1 1HNWQ 1QVFA 2QA4A 4P73A 4JI7L 3P5JB 4DR3L 4JI6L 1FGUA 2Q51A 4B3ML 2M6NA 1QZGA 3S15H 2F4VQ 4EWCA 5M5YH 3GTLH 1VQGA 1G51A 4HIKA 4LFBQ 3HOZG 2K50A 1VQ6Z 3CCRA 3HKZA 2JEBI 3GTMS 1USPB 4JYAL 3K7UC 2QRCB 1NTGA 1SR3A 4DK6C 1D8LA 4JI8L 1GD7A 1VQO1 1N9WA 2WFWA 2VW9A 3FKIH 2VS1A 3PO2I 4GLXA 1LM0A 4EX5A 1VQHA 4LFAL 1W2BA 4RMFA 1M901 1HNZQ 4X65L 3GTOI 2Z6KA 3PUYA 2JA7H 2OTL1 3KJOA 3CW2C 2QEXZ 1PV4A 5T64A 1VQKA 1QVFZ 1X3ZA 2ZTEA 2R7DA 2VY3A 4NBDA 4A3EG 1V43A 2F52A 1RO0A 4JBMA 2VF1A 1V1QA 1YZ6A 1JT8A 1KXLA 4IPCA 3HOUG 1HNXQ 4AIMA 3M3YH 2UXDL 5C3EI 1I6HI 1Y1WG 3D0FA 3OW2Z 3ESWA 5IP7I 3H15A 1I50H 1WCMI 3LUSA 2OTJZ 3F3FC 1KAWA 5JJIA 4BY1G 1KQSA 3KFUA 1WYDA 3EBEA 2XTIA 3UE1A 1YJNA 3G71A 2UU9L 4LF9Q 4X65Q 4RV9A 5C44I 2JA6H 5A2Qb 2JA7I 1VCIA 1XTDA 4DR6Q 3S14H 1Z02A 1NJI2 1Q821 1S40A 2K3RA 1VQ41 3EEDA 3MEFA 4JV5Q 1YJ9A 3CMA1 4A3MG 1GM5A 3CC7A 2CWAA 5D1PA 3RZOH 1YI2Z 4S1TA 4MNOA 3CCL1 2E8GA 2BH8A 2BA1A 2PNHA 3JAMb 4LUVA 4E2XA 1WOCA 2UXDQ 4UY8C 2VQEQ 3NH5A 2AWOA 1K0RA 2MNAA 2CCZA 4UPAA 2IHEA 2PMZA 3CMEA 2F4VL 2Y0SG 4A3KI 4QQBX 2RHBA 2NVTI 1UE7A 2AMCB 3GTMH 4A93I 1KD11 4GLAC 4LUOA 1QVGY 2UUAL 1VQNZ 1JJ2Z 1B70B 1YHAA 3CD6A 1RIPA 4BXXH 3HOYH 4A3LG 2F4OA 3T1YL 4QJFA 2DGYA 1XNRQ 3E0EA 5IT9f 1HNZL 3PO3G 4BA1I 4HGYA 1YHQZ 2HHHQ 5GADC 1PH7A 1L0WA 4DR5L 3NBHB 1G6PA 3VB9A 2RBLA 4NFRA 1X3GA 4DV4Q 4E30A 3L7ZC 5M5XH 1A63A 3VTNA 1N36L 4C3IH 5HY6A 2LXJA 4R4OA 1MKHA 3CMEZ 3GTJH 4YCUA 2I5LX 3LGJA 5LL6f 4JI5L 2K5HA 3HOWG 3W5OA 4A3LH 4AH6A 3CXCZ 3CCUA 2MO0A 3I56A 5FLXb 1FVIA 4PMWA 1XPUA 4DR1Q 5IE8A 3OYYA 1M1K1 3J80c 3GTOH 2Y0SE 3GTKH 5T67A 3CAMA 4RVFA 2ZM6Q 4A3FI 4BA2I 1Q81C 1VQP1 1YNXA 4KHPQ 4NBGA 5GAEC 4JI0L 2E9HA 1HNWL 2DE6A 2K5RA 4JI4L 3KF6A 2ZAEB 3M4OI 1YHQ1 3PSIA 1U0LA 2OTLZ 2CWPA 1YUAA 2YU9I 2M48A 4CL1A 3HOVH 1EQRA 2QRDB 5C4XI 4YY3Q 3CCR1 3CCV1 4YHHQ 5BR8Q 4PG3A 2HU9A 1TWAI 1RO2A 4JBWA 4GKKL 1VQPZ 3I4MI 3NELA 5J3BA 3CCQZ 1K83H 4YCVA 1KL9A 2KHIA 2JA6I 3GTKI 1KRSA 5IT9b 1KHIA 4LF6Q 3GTLI 2AKWB 1IBMQ 4KHPL 2WP8J 1KC8C 4HIDA 3I561 2ZJRA 4A3GG 5M3MG 3ULJA 4K0KL 1JJCB 2JA8G 4HH4A 3G711 2QLVB 3F8TA 4LFCL 1E24A 2KI7B 3STBD 3CCMA 4RVDA 3PGZA 2IZ3A 1TWCH 3KF8B 4XIGS 1YUKA 3J81f 2V8KA 4GN5A 2YTYA 1JMCA 1QYPA 3ICEA 4L5SA 4MONA 3U4ZA 1I3QI 5M3FH 4DUYL 2WB1G 3BZKA 4A3KH 1L1OA 3CCLA 1AE3A 4A93H 4BXXI 3MZLB 3HOYI 3VMIA 3CCRZ 1VQ6A 1YJNZ 4WJ4A 2E2HH 1X55A 1YBYA 5C44G 1QVFY 4B3RL 1KC81 2JA7G 3OTOL 1YJN1 4JI4Q 3HOXI 3FP9A 3BU2A 5GAGC 3OW2A 2PMZE 4UP7A 4JI0Q 1Q8KA 4A3MI 3GCFA 1TWCI 3BG0B 1FJGQ 1J5EL 2DE7A 1K73C 1I6HH 1CKMA 1BVSA 3J81j 3GTJI 1MJCA 2R92G 1Q46A 1WI5A 3ULLA 1I3QH 1VQFA 4AYBA 1VQKZ 5IYDH 4NBEA 1YVCA 1VQ81 1KIXA 1CKOA 3CC4A 1RO4A 4DAMA 2MFIA 3CCLZ 4A3JH 3PCOB 1TWGI 4A3GH 4A93G 1JB7A 1VLAA 3ZJYC 5C0XI 4DV4L 4OO1G 4LF4Q 1Q812 3JAMc 2MO1A 2R7ZI 4DR5Q 1RQFA 4DKAC 3I4NI 1C0AA 1K9M2 1VQ5A 3CD61 1LTLA 1Q12A 3EIVA 1P9NA 3KIFA 2NVXH 2VUGA 1K731 2K5VA 3J7A5 5IYCH 1X0TA 3HOVI 1SN8A 2OTLA 3J7ZC 2UUAQ 2DE5A 3IRBA 3GTMI 2PM9A 3PO3H 1TWAH 3S1NH 4B3SL 3HOWI 4GNXB 3AEVA 1GVPA 3NH4A 2RT9A 2I0QA 1PH3A 3PUWA 4DUZQ 2Q2TA 1VQ8Z 1RNIA 2P28A 3GTPI 1Z01A 4Y7NH 3I4NH 3G4SZ 3S24A 1Q82C 1HZBA 1P16A 4A3FG 3CC21 4NH1C 4MTNA 4Y52I 4BBSH 4GS3A 4GN4B 1Y1VH 1YJW1 1S3OA 2GVAA 2HF1A 2FXQA 3EN2A 2OOYB 3CMAA 4A3DH 2UU9Q 4X64Q 2KENA 4A3BG 2PQAB 1QF8A 2BH2A 1X6OA 4C3HH 3K8AA 3K7AI 2NVYI 1NUIA 3BG1B 2EIFA 5E7NA 2D0OA 3S15I 3CCEA 2WB1A 4A3EH 1HNXL 1Y1VS 3S2DI 1JWHC 4UP8A 1VQMA 3J80f 2JA6G 1E1TA 3BZCA 4MD8A 4MD9A 4JI2Q 3AQQA 3CPWY 4B3MQ 3G6EZ 1N33Q 3H3VH 4IOCA 4JI6Q 3U4VA 3MZKB 3CP0A 3PF4A 2IHFA 4DR3Q 2B3GA 2D0PA 4A3MH 1WFQA 3T1HL 2B63G 3RLFA 4HJ7A 1EOVA 1NP6A 5IP9G 3FKII 2AHOB 1PA6A 1PH9A 5AJ3L 1X65A 1Z03A 3M7NA 3VMHA 4HGZA 1AE2A 4IPDA 5A2Qf 1NBWA 4A3JI 4IO9A 4BY7I 3KOJA 1OXTA 3S2DH 1H95A 4JI8Q 3FHWA 3BJUA 3A74A 5M5WH 3CCMZ 4DR2Q 1I5FA 4A3IH 2R7ZH 2OTJA 3A5UA 4XTCS 4JOIA 2N8NA 4MD7A 1X3EA 4R4TA 4LF5L 3M3YI 1YI2A 3PF5A 5C0XJ 2R93H 5IP7H 1VQ71 3HOXG 2Q4ZA 4A3BH 4X62Q 4P72A 1N8R2 1J5EQ 3OW2Y 2R6GA 4DV1Q 4KI0A 2LIYA 2RPRA 1ASZA 2PI2E 4NBCA 2R92I 2QEXA 1VQBA 1N32L 4X6AH 1WIIA 3MXNB 3S14I 1J6QA 2KCMA 4GOPC 2RF4A 4GKKQ 2VNUD 2E2HI 2KHJA 5IT9c 4DGLA 4KLKA 4C3JH 1VQLZ 1GO3E 4PZ7A 4R4QA 2OQKA 3HOXH 1L1OC 3MONA 4Y7NI 1CKNA 4YWLA 3IF8A 4DV5L 4HJAA 1KD12 4QGUA 5C0XG 2WAQA 3PO2G 2R93I 2V8IA 2R7ZG 2ZJPA 3CCEZ 3I4NG 3STBC 2GU2A 1HR0L 4MZ9A 3PO3S 5M3FG 1N8R1 3HFZB 1Y1VI 3PUZA 1VQ7Z 4DV1L 1KRTA 1VQEA 4P75A 1OTCA 4R4CA 4NXML 4NBBA 4DPGA 1KD1C 2R92H 4JBKA 1VQCA 3HOVG 1NMGA 4TQUS 5JEAJ 3K7AH 1PH1A 2O4HA 1IBML 1Q1BA 3E9IA 3S16H 4E2YA 4A3EI 2YTXA 2LFUA 1XMOL 3I7FA 4XX2A 1IBLL 1VQOZ 2NN6I 4WJ3M 1ML8A 1C9OA 3CF5A 1NJIC 1I94L 1Y1WI 3M9BA 5D1OB 1VQ8A 1WCMG 4RS4A 3IFUA 2VUMH 5T6BA 1X54A 5GROA 2N78A 2IY5B 4IFDJ 1XNQL 1VQ61 5AJ3Q 2WB1E 4JG2A 3F2BA 1TWHH 1TFIA 1VQJA 4OWWB 4JCVE 3CD6Z 4DAYB 5IYCG 1EYGA 3HOWH 4E2WA 3CCJA 3WWVA 4LF7L 3KF6B 3PUXA 4A76A 2OOXB 3HKZE 1OXVA 2ZM6L 3GO5A 1UWVA 1Q7Y1 4BY7H 1VQ5Z 3L2PA 2N49A 3M4OH 3CCVZ 1PFSA 1YITA 2UXCQ 1YIJZ 2JEAI 3CC7Z 4Y52H 2BA0A 4ALPA 4JI5Q 2R6MA 2I5HA 1EFWA 3I56Z 4AYBG 1K8AC 1VQK1 5C4XH 4X64L 4A3DI 1LYLA 2JA9A 1DGSA 3CC4Z 2YV5A 1V9PA 3L0OA 3H0GG 3J80b 2VZAA 2OTJ1 3CCJZ 3FQMA 4DR6L 2NVYH 1K83I 3FKIG 3G4SA 3D6WA 4JI3L 1SRUA 4LF9L 3TDHB 2RHQB 1X9NA 4HIOA 3CCVA 3KYHC 4ME3A 2JUBA 4FDBA 1SE8A 2KBNA 2E2IH 2EGTA 1N33L 2A1AA 4BY7G 2IZ4A 2JA5G 1BBWA 1OXUA 3H3VI 2H5XA 4NBAA 2C35B 2HIXA 5FLMH 3HOUH 1N2FA 5ELOA 1QZHA 1JJ2A 2PQAA 2E2JH 3GTQI 2PI2A 3CPFA 2EQSA 1C7YA 4B3SQ 5IYBG 3HOZH 3RLOA 1VQ4A 2YTVA 1HJPA 5ELNA 1X3WA 2K14A 1PH8A 1NMFA 1K8A1 1EQQA 3NDJA 3J81i 4H02A 1YIT1 3RLNA 4GNXC 1K9M1 2BJOA 2JMOA 4X66Q 1Q861 2A8VA 1XPRA 3IX0A 2JQOA 3DLLA 1SMXA 3S2HI 1PVOA 2B29A 1VQ7A 4LFAQ 5FLMG 1A0IA 1OXSC 4OXPA 4DV6L 4A3II 3CXCA 4X66L 4E2ZA 4E31A 4HJ5A 1Q1EA 2QGQA 3KJPA 2I3CA 2B63H 5FJ8H 2OZKA 4DK1A 3GTQH 4IPHA 5LMUL 3GDEA 4APVA 3HOZI 3G71Z 2JA5H 2VUMI 4BBRI 3Q8DA 3AFPA 1O7IA 2VQFQ 4NB8A 4A4IA 1VQPA 1TWHI 3I551 1CKNB 4QTTA 3H3VJ 2QA4Z 2NVQH 4DR4Q 3ERSX 1K9MC 4X6AI 4YWMA 1M1K2 1FJGL 3GD7A 4A3GI 4JI7Q 4LNQA 3S1MI 5JJKA 3K81C 2UXBQ 3RN5A 1Z9FA 4B3RQ 3NH8A 5LMNQ 3GKQA 4DR7Q 2JR6A 5IYBH 4IJHA 2K52A 2D62A 1KQSY 4DQYB 2XGTA 3F1ZA 1PH5A 2ES2A 3DM3A 1UE5A 3M85A 1R9TH 3PIOA 4GNXA 1I94Q 4R4IA 1SROA 4MH4A 5H1SE 1NJI1 4GOPA 2YYZA 1IBLQ 1SFOI 3CCS1 4BXXG 3S1NI 3CC71 4QY7A 4HJ8A 4DV3Q 3T4NB 1A62A 4HIMA 5C3EG 3CCSZ 3QWUA 2G2KA 2UUBL 1ASYA 1N34L 4OWXB 1P8LA 4POFA 3TQYA 1PYSB 3J81b 3I55A 2J6AA 3GTPH 3VMGA 1LQLA 2E2II 3JC66 1Y1WH 1L2FA 1XJVA 1E1OA 3B6YA 1IBKQ 4L5RC 2F3IA 4DV7Q 2GVBA 1QVGZ 4DV2L 4BBSI 1T9HA 2LXKA 4LUZA 4DV0Q 4E33A 2VL6A 1WW9A 4NXNL 2E5LL 3AFQA 1QVCA 1USPA 2E5LQ 3FQQA 2W03A 1S721 4DUYQ 4EQ5A 3CCM1 2ZJQA 2GN5A 4A3CI 4OO1I 1QUQA 1M90C 3S2HH 4NBHA 1IBKL 3H0GI 5D1OA 1YJWA 5C4JH 1OXXK 5FLXc 1YIJA 4L5QA 3NFZA 3I4OA 4LFCQ 4A75A 1WJJA 4LW1A 1BBUA 1VQMZ 4MXUA 2WAQG 3UE0A 3K0XA 3S1RI 3TEHB 4NXMQ 1IYJB 1JE5A 4RVGA 3G4S1 1HZAA 3PUVA 1EIYB 3JAMi 2L15A 1TWFI 1M902 3CCJ1 1X56A 2PK7A 1N34Q 2UUBQ 2JA5I 4BBRH 4LF6L 3J81c 1HR0Q 1CUKA 2CKZB 4DV3L 4IJLA 5IWAL 4KHZA 5FJ8G 4LF8L 2LSSA 3RNUA 4JC0A 3NEMA 4YHHL 3UDXA 1B7YB 3CPWA 3NDIA 4YY3L 1N36Q 1VQ9A 5DLQE 1X3FA 1EUJA 4NXNQ 2ID0A 3CCQ1 3S1MH 1Q822 1HZ9A 5C44H 2JNYA 1HZCA 2UUCQ 5EAYA 1YEZA 2HHHL 3NENA 1NE3A 1PH6A 2IX1A 4DV7L 3EERA 2JE6I 1HR0W 3CQZI 2W04A 1CSQA 1VQNA 1XNRL 5FLXf 1IL2A 1M1KC 4GKJL 5FLMI 5K36G 3I07A 3Q87A 1TWFH 2E2JI 1JJGA 2NZOA 2Z0SA 4A3IG 4X62L 1Q7Y2 4A3BI 1VQ9Z 4DR4L 2MQHA 1YIJ1 4QTUA 2NZHA 1HH2P 3ER0A 1G291 4E32A 1K8A2 1ZH1A 2IT1A 1GKHA 1LUZA 3TS2A 2VUMG 3HKZG 4BBRG 2RHSB 4IFDI 3UDFA 4DK3C 3PIPA 1E7ZA 2VQEL 1JJ2Y 2QR1B 4NPSA 4PZ8A 4P71A 4PZ6A 2K5NA 5C4XG 4JOIC 5LMUQ 3S1QI 4NB9A 3CCUZ 3SGIA 3I4MG 3KDFB 2OWOA 2V8JA 2KCTA 4O0AA 4J15A 4JV5L 2B63I 2QEX1 1CSPA 4DR7L 2Q2IA 5LMNL 3M4PA 1KQSZ 3RN2A 2N3SA 4BY1H 3RZDI 1PYBA 2QKDA 5IYDG 3T1YQ 2JA8I 1UE6A 3T1HQ 2RIQA 2I5MX 2GTIA 2Y0SA 3CXCY
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OON A;  1SE8 A;  2KBN A;  4AQY Q;  2E2I H;  3TRZ A;  2UUA Q;  2K75 A;  2OQ0 A;  2DE5 A;  1X3Z A;  2A19 A;  4B3T L;  1N33 L;  2NVQ I;  2A1A A;  3IRB A;  4BY7 G;  2JA5 G;  1BBW A;  1OXU A;  3GTM I;  2ZTE A;  3H3V I;  4JI2 L;  2R7D A;  2VY3 A;  3PO3 H;  4DUZ L;  4NBD A;  1TWA H;  2H5X A;  4A3E G;  1V43 A;  3CC2 A;  4NBA A;  2C35 B;  3S1N H;  2HIX A;  4B3S L;  3HOW I;  5FLM H;  3HOU H;  2F52 A;  1N2F A;  3GTG H;  5ELO A;  1QZH A;  1JJ2 A;  2PQA A;  4JBM A;  3S1Q H;  4GNX B;  2E2J H;  3AEV A;  3GTQ I;  1VQO A;  3S16 I;  1GVP A;  2PI2 A;  1PH2 A;  1V1Q A;  3CPF A;  2EQS A;  2I0Q A;  1YZ6 A;  1XPO A;  1PH3 A;  5IYB G;  1C7Y A;  4B3S Q;  3HOZ H;  3RLO A;  1JT8 A;  1VQ4 A;  1KXL A;  3H0G H;  2VQF L;  3PUW A;  4IPC A;  3HOU G;  4DUZ Q;  1HNX Q;  2YTV A;  1HJP A;  4AIM A;  3M3Y H;  2Q2T A;  5C3E I;  5C4J I;  1I6H I;  1Y1W G;  3D0F A;  5ELN A;  2UXD L;  3ESW A;  1X3W A;  5IP7 I;  2K14 A;  5CM2 M;  5HGQ A;  1PH8 A;  4B3T Q;  4POG A;  3H15 A;  1I50 H;  2AWN A;  1WCM I;  3CCS A;  1NMF A;  1W3S A;  1EQQ A;  3GTP I;  3J81 i;  3LUS A;  4H02 A;  4Y7N H;  1KAW A;  3I4N H;  4BY1 G;  5JJI A;  3S24 A;  1KQS A;  1XMQ L;  3HOY G;  3KFU A;  3RLN A;  1WYD A;  3EBE A;  2XTI A;  2R7F A;  3UE1 A;  4GNX C;  1Q82 C;  1YJN A;  1HZB A;  3G71 A;  2BJO A;  4X66 Q;  3S1R H;  1P16 A;  2UU9 L;  4LF9 Q;  4QIW E;  4A3F G;  4X65 Q;  2A8V A;  4DV6 Q;  4JI3 Q;  3RZD H;  1XPR A;  2JQO A;  3DLL A;  1SMX A;  3S2H I;  4MTN A;  5C44 I;  2JA6 H;  2JA7 I;  1VCI A;  4YWK A;  4Y52 I;  1PVO A;  2B29 A;  1XTD A;  2CQO A;  1VQ7 A;  5JJL A;  4LFA Q;  4DR6 Q;  2YU9 H;  3S14 H;  4BBS H;  5FLM G;  2P3Y A;  4L5T A;  4GS3 A;  4GN4 B;  1A0I A;  1S40 A;  1Y1V H;  1OXS C;  3MEF A;  4JV5 Q;  3U58 A;  3S17 H;  1YJ9 A;  4LF4 L;  1S3O A;  2GVA A;  4OXP A;  4DV6 L;  2HF1 A;  2FXQ A;  3EN2 A;  4A3M G;  3CMA A;  4A3D H;  1GM5 A;  4BBS G;  4A3I I;  2UU9 Q;  4X64 Q;  4X66 L;  2CWA A;  3CXC A;  3CC7 A;  2ATW A;  2KEN A;  4HJ5 A;  4A3B G;  3RZO H;  1Q1E A;  2PQA B;  2QGQ A;  3KJP A;  4MNO A;  1DL6 A;  1K3R A;  1XMQ Q;  1RL2 A;  2B63 H;  5IP9 H;  3GTG I;  5FJ8 H;  2E8G A;  2BH2 A;  3GTM H;  1X6O A;  2BH8 A;  3K8A A;  2BA1 A;  2PNH A;  3W1G A;  4C3H H;  3U50 C;  3K7A I;  4DNI A;  3GTQ H;  2NVY I;  1NUI A;  4IPH A;  5LMU L;  3GDE A;  4LUV A;  2EIF A;  5E7N A;  3I4M H;  2D0O A;  4APV A;  3HOZ I;  1VQA A;  2HQL A;  1AH9 A;  2JA5 H;  1WOC A;  2VUM I;  4BBR I;  3UDG A;  1VQL A;  3S15 I;  3CCE A;  4UY8 C;  2VQE Q;  2UXD Q;  3Q8D A;  2ZTC A;  4A3E H;  1HNX L;  3TS0 A;  2EXD A;  1O7I A;  3AFP A;  2VQF Q;  1Y1V S;  2AWO A;  4NB8 A;  3S2D I;  1IZ6 A;  1K0R A;  4JBJ A;  4A4I A;  2MNA A;  2CCZ A;  4UP8 A;  4UPA A;  1EIY B;  1VQM A;  2IHE A;  4LFB L;  3TRE A;  1VQP A;  1TWH I;  1CKN B;  4A3C G;  4QTT A;  1A8V A;  3F2C A;  2R93 G;  4IPG A;  3CME A;  3H3V J;  1E1T A;  2Y0S G;  3BZC A;  4A3K I;  3CQZ H;  2F4V L;  2JA6 G;  4QQB X;  3G48 A;  4JI2 Q;  1Q86 C;  3AQQ A;  1UE7 A;  2NVT I;  3J80 i;  2NVQ H;  4DR4 Q;  2AMC B;  3ERS X;  1K9M C;  3PV0 A;  4A93 I;  4B3M Q;  1U5K A;  1N33 Q;  4GLA C;  4X6A I;  4LUO A;  4YWM A;  3H3V H;  1Y1V G;  2UUA L;  4IOC A;  1B70 B;  4AQY L;  4JI6 Q;  3U4V A;  1YHA A;  3CP0 A;  1FJG L;  3PF4 A;  2IHF A;  3CD6 A;  3GD7 A;  4DR3 Q;  2B3G A;  2D0P A;  1RIP A;  4BXX H;  4A3M H;  4A3G I;  3HOY H;  1PFT A;  3VDY A;  4JI7 Q;  4LF7 Q;  3S1M I;  1WFQ A;  3T1H L;  1PHJ A;  4LNQ A;  4A3L G;  3CCQ A;  2F4O A;  5JJK A;  2B63 G;  3T1Y L;  3RLF A;  4QJF A;  4HJ7 A;  3K81 C;  4O2D A;  1EOV A;  4GKJ Q;  2DGY A;  3OTO Q;  3RN5 A;  1XNR Q;  2UXB Q;  1Z9F A;  3E0E A;  5IP9 G;  3PO3 G;  1HNZ L;  3FKI I;  4B3R Q;  4BA1 I;  5C3E H;  5LMN W;  4P74 A;  2AHO B;  1WCM H;  5LMN Q;  1PA6 A;  3GKQ A;  4QL5 A;  5AJ3 L;  1Q7Y C;  1X65 A;  1PH9 A;  2HHH Q;  5GAD C;  4DR7 Q;  2JR6 A;  2AKL A;  1PH7 A;  1L0W A;  4DR5 L;  2IX0 A;  3NBH B;  5IYB H;  1G6P A;  1EWI A;  3VB9 A;  2RBL A;  3M7N A;  4IJH A;  3VMH A;  4A3C H;  3A0J A;  1AE2 A;  1X3G A;  2K52 A;  4DV4 Q;  3L7Z C;  2D62 A;  5M5X H;  3ULP A;  2XGT A;  1A63 A;  4IPD A;  3F1Z A;  1PH5 A;  2ES2 A;  3DM3 A;  1UE5 A;  3M85 A;  4C3I H;  1NBW A;  4A3J I;  2JJQ A;  5HY6 A;  4IO9 A;  2NN6 G;  1N36 L;  1R9T H;  3PIO A;  4BY7 I;  3KOJ A;  2LXJ A;  4R4O A;  1MKH A;  1OXT A;  4GNX A;  1I94 Q;  1EIF A;  3S2D H;  4R4I A;  1MIU A;  4MH4 A;  1SRO A;  2ALY B;  4YCU A;  4JI8 Q;  3GTJ H;  1H95 A;  2I5L X;  1YHB A;  3LGJ A;  4JI5 L;  5H1S E;  2K5H A;  3FHW A;  4GOP A;  3BJU A;  3HOW G;  2K4K A;  4NBF A;  2YYZ A;  3A74 A;  2JK8 A;  3W5O A;  1TXY A;  5M5W H;  3W1B A;  1SFO I;  1IBL Q;  3E9H A;  4AH6 A;  4JYA Q;  1XMO Q;  4RG1 A;  4A3L H;  3CCU A;  2MO0 A;  4OWT B;  3A5Z B;  4DR2 Q;  3I56 A;  3S1N I;  1I5F A;  4BXX G;  4QY7 A;  2UXC L;  4HJ8 A;  1FVI A;  1MJE A;  4DV3 Q;  4A3I H;  4PMW A;  2R7Z H;  3HOU I;  2OTJ A;  1XPU A;  3A5U A;  1A62 A;  4HIM A;  4DR1 Q;  5C3E G;  2F4M A;  4XTC S;  4AYB E;  5IE8 A;  4JOI A;  5IP7 G;  3OYY A;  2N8N A;  5GAH C;  2UUB L;  1ASY A;  4IOA A;  1N34 L;  4OWX B;  1X3E A;  4UP9 A;  4R4T A;  3RR5 A;  1P8L A;  4BY1 I;  4POF A;  4LF5 L;  3M3Y I;  1NY4 A;  3J80 c;  1YI2 A;  3PF5 A;  5C0X J;  2R93 H;  5IP7 H;  3GTO H;  2Y0S E;  3HOX G;  3GTK H;  3TQY A;  1QUQ B;  3CAM A;  1PYS B;  4A3B H;  4X62 Q;  4P72 A;  1J5E Q;  3I55 A;  2J6A A;  2ZM6 Q;  3GTP H;  3VMG A;  4A3F I;  1ZB9 A;  1LQL A;  4BA2 I;  1Q81 C;  2R6G A;  1YNX A;  4DV1 Q;  4NBG A;  2E2I I;  2ZTD A;  5GAE C;  2HIV A;  4JI0 L;  4KHP Q;  4DV7 L;  1HNW L;  2DE6 A;  1B8A A;  3JC6 6;  4KI0 A;  2K5R A;  2JS4 A;  1Y1W H;  1L2F A;  1YHQ A;  3KF6 A;  4JI4 L;  1JJG A;  3G6E A;  3M4O I;  1FL0 A;  1XJV A;  1E1O A;  1ASZ A;  3B6Y A;  1RLY A;  2PI2 E;  4NBC A;  3PSI A;  1IBK Q;  2NVT H;  4L5R C;  2R92 I;  2F3I A;  4YCW A;  2GVB A;  1VQB A;  5GQO A;  2QEX A;  4DV7 Q;  1U0L A;  4DV2 L;  1N32 L;  2CWP A;  4X6A H;  3MXN B;  1YUA A;  2YU9 I;  3S14 I;  4BBS I;  1J6Q A;  2KCM A;  3UDI A;  1T9H A;  4IFD G;  4GOP C;  1XNQ Q;  2LXK A;  4LUZ A;  2UUC L;  2RF4 A;  4DV0 Q;  4GKK Q;  2Z6K C;  2WAQ E;  2VNU D;  2E2H I;  2VL6 A;  3HOV H;  4TVA B;  1WW9 A;  1EQR A;  2KHJ A;  4NOZ A;  4NXN L;  2E5L L;  1TWG H;  5IT9 c;  2V1C C;  3AFQ A;  4KLK A;  4C3J H;  1IXR A;  1GO3 E;  1QVC A;  5C4X I;  4PZ7 A;  3AYH B;  4YY3 Q;  1USP A;  4YHH Q;  5BR8 Q;  4R4Q A;  4PG3 A;  2OQK A;  3HOX H;  1L1O C;  1QVG A;  1HR0 L;  2E5L Q;  4Y7N I;  1CKN A;  1TWA I;  4YWL A;  4DUY Q;  4JBW A;  2CFM A;  1UEB A;  4OX9 L;  4GKK L;  1S72 A;  4DV5 L;  3I4M I;  3NEL A;  4HJA A;  4EQ5 A;  4QGU A;  5J3B A;  4A3D G;  1Y14 B;  2ZJQ A;  5C0X G;  1ZB8 A;  4LF8 Q;  2GN5 A;  4A3C I;  1VQI A;  5IWA Q;  1QUQ A;  5IY0 A;  4OO1 I;  1K83 H;  1M90 C;  4DV2 Q;  4YCV A;  3PO2 G;  1N32 Q;  1KL9 A;  2R93 I;  1L1O B;  3S2H H;  4NBH A;  2KHI A;  1IBK L;  3H0G I;  2ZJP A;  2JA6 I;  2R7Z G;  3GTK I;  1D7Q A;  1KRS A;  4A3K G;  3I4N G;  3STB C;  1KHI A;  3KDF A;  1YJW A;  5C4J H;  3GTL I;  1OXX K;  4MZ9 A;  3PO3 S;  2AKW B;  5M3F G;  1PH4 A;  4LF6 Q;  2NVX I;  5FLX c;  1IBM Q;  1I50 I;  3HFZ B;  1Y1V I;  3PUZ A;  3KLW A;  4L5Q A;  3F2D A;  1YIJ A;  4DV1 L;  2Q2U A;  4KHP L;  2WP8 J;  1KC8 C;  4HID A;  4GN3 B;  3I4O A;  3S17 I;  4LFC Q;  1KRT A;  2ZJR A;  1VQE A;  4P75 A;  1OTC A;  4JI1 Q;  4A75 A;  4A3G G;  1WJJ A;  3HKS A;  1BBU A;  2DUD A;  4LW1 A;  4R4C A;  4A3L I;  1VQD A;  5M3M G;  4NXM L;  3ULJ A;  4K0K L;  2WAQ G;  1JJC B;  3UE0 A;  3I2Z A;  4NBB A;  3K0X A;  4K0K Q;  3S1R I;  3TEH B;  1SLJ A;  4DPG A;  1KD1 C;  1IYJ B;  1JE5 A;  4JBK A;  4NXM Q;  1VQC A;  1BKB A;  1HZA A;  2R92 H;  3HOV G;  4LF5 Q;  4JI1 L;  5IP9 I;  3PO3 I;  3PUV A;  4R1J A;  1NMG A;  3F8T A;  4TQU S;  3JAM i;  2L15 A;  4LFC L;  5JEA J;  1TWF I;  1E24 A;  1X56 A;  3K7A H;  1PH1 A;  2PK7 A;  3STB D;  3CCM A;  1N34 Q;  3PGZ A;  2UUB Q;  2Q2H A;  1Q1B A;  3E9I A;  1IBM L;  1TWC H;  3KF8 B;  2JA5 I;  1E3P A;  4XIG S;  4BBR H;  1K8G A;  3J81 c;  1HR0 Q;  4DR1 L;  4LF6 L;  1CUK A;  3S16 H;  4A3E I;  2YTX A;  4HJ9 A;  2CKZ B;  4GN5 A;  4DV3 L;  2YTY A;  1JMC A;  1QYP A;  3ICE A;  4DR2 L;  4IJL A;  5IWA L;  4KHZ A;  5FJ8 G;  4L5S A;  1XMO L;  4LF8 L;  3I7F A;  4XX2 A;  1IBL L;  4A3F H;  4GOP B;  2LSS A;  3K80 C;  2HT1 A;  4A3J G;  4DV5 Q;  3RZO I;  2NN6 I;  1I3Q I;  3U4Z A;  4OX9 Q;  5M3F H;  4DUY L;  4WJ3 M;  3D31 A;  2OCE A;  1ML8 A;  1C9O A;  3CF5 A;  2WB1 G;  3RNU A;  2KPI A;  3BZK A;  4A3K H;  1NJI C;  1I94 L;  4JC0 A;  1Y1W I;  1L1O A;  5BR8 L;  3NEM A;  4YHH L;  3CCL A;  3UDX A;  1AE3 A;  1B7Y B;  3M9B A;  4C2M H;  3CPW A;  4YY3 L;  1VQ8 A;  4A93 H;  1N36 Q;  1WCM G;  1VQ9 A;  1UE1 A;  1E22 A;  1VS0 A;  1R9T I;  5M3M H;  2VUM H;  5DLQ E;  1X3F A;  1EUJ A;  1X54 A;  4BXX I;  5GRO A;  2N78 A;  4NXN Q;  2ID0 A;  2IY5 B;  3HOY I;  2JA8 H;  3S1M H;  3VMI A;  1HZ9 A;  4DV0 L;  5C44 H;  2JNY A;  1HZC A;  2UUC Q;  1VQ6 A;  1XNQ L;  5EAY A;  4IFD J;  4NB3 A;  1N8R C;  1YEZ A;  1SFO H;  2HHH L;  3NEN A;  1NE3 A;  5AJ3 Q;  2WB1 E;  4WJ4 A;  2E2H H;  4JG2 A;  3F2B A;  1PH6 A;  1TWH H;  3M4Q A;  1X55 A;  2IX1 A;  4GLV B;  1TFI A;  3EER A;  1VQJ A;  2JE6 I;  2RCN A;  4JCV E;  1YBY A;  5C44 G;  3CQZ I;  1Z47 A;  1HR0 W;  4OWW B;  2JA7 G;  4B3R L;  1CSQ A;  1VQN A;  1XNR L;  4DAY B;  3OTO L;  3PO2 H;  1IL2 A;  2UXB L;  1M1K C;  5JEA G;  4LWC A;  4JI4 Q;  5IYC G;  2ASB A;  4GKJ L;  3HOX I;  5FLM I;  3FP9 A;  3BU2 A;  1EYG A;  5GAG C;  3OW2 A;  3CCJ A;  3HOW H;  1QVF A;  3I07 A;  3Q87 A;  2PMZ E;  4UP7 A;  4JI0 Q;  1HNW Q;  1TWF H;  2E2J I;  1Q8K A;  3WWV A;  4P73 A;  3KF6 B;  3PUX A;  2QA4 A;  4A76 A;  4JI7 L;  4LF7 L;  3HKZ E;  2NZO A;  1OXV A;  4A3M I;  3GCF A;  1TWC I;  4DR3 L;  2Z0S A;  2ZM6 L;  4A3I G;  5K36 G;  4JI6 L;  1FJG Q;  1J5E L;  1FGU A;  4X62 L;  3GO5 A;  1UWV A;  4A3B I;  2DE7 A;  1K73 C;  4B3M L;  1I6H H;  4BY7 H;  1CKM A;  2MQH A;  4DR4 L;  4QTU A;  1BVS A;  3J81 j;  1QZG A;  3S15 H;  2NZH A;  3GTJ I;  1HH2 P;  3ER0 A;  1MJC A;  2F4V Q;  1G29 1;  5M5Y H;  3GTL H;  1VQG A;  2R92 G;  1Q46 A;  1WI5 A;  1G51 A;  2IT1 A;  3L2P A;  1GKH A;  4HIK A;  4LFB Q;  3ULL A;  1I3Q H;  1VQF A;  2N49 A;  1LUZ A;  3HOZ G;  3TS2 A;  2K50 A;  2VUM G;  3HKZ G;  4BBR G;  3CCR A;  2RHS B;  3M4O H;  4IFD I;  5IYD H;  4NBE A;  1YVC A;  2JEB I;  3GTM S;  1KIX A;  3UDF A;  1CKO A;  1USP B;  4DK3 C;  1PFS A;  3PIP A;  1YIT A;  1RO4 A;  1E7Z A;  3CC4 A;  2VQE L;  2UXC Q;  4DAM A;  4JYA L;  4NPS A;  2JEA I;  3K7U C;  4PZ8 A;  2MFI A;  4Y52 H;  1NTG A;  4P71 A;  2BA0 A;  2K5N A;  4PZ6 A;  4JOI C;  3PCO B;  1SR3 A;  4DK6 C;  3S1Q I;  5LMU Q;  5C4X G;  4ALP A;  1D8L A;  4JI5 Q;  4JI8 L;  2I5H A;  1TWG I;  1EFW A;  1GD7 A;  4A3G H;  1N9W A;  4NB9 A;  4AYB G;  2WFW A;  4A93 G;  1JB7 A;  3SGI A;  1K8A C;  3I4M G;  2VW9 A;  5C4X H;  1VLA A;  3KDF B;  4X64 L;  2OWO A;  4A3D I;  3ZJY C;  5C0X I;  1LYL A;  2JA9 A;  1DGS A;  4DV4 L;  2YV5 A;  4OO1 G;  2KCT A;  4O0A A;  3FKI H;  2VS1 A;  3PO2 I;  4J15 A;  4LF4 Q;  3JAM c;  1V9P A;  2MO1 A;  3L0O A;  4GLX A;  4JV5 L;  2R7Z I;  3H0G G;  1LM0 A;  4DR5 Q;  2B63 I;  4DKA C;  3I4N I;  4EX5 A;  2VZA A;  1CSP A;  4DR7 L;  1VQH A;  2NVY H;  4LFA L;  4DR6 L;  1C0A A;  2Q2I A;  5LMN L;  1K83 I;  3FKI G;  3M4P A;  1LTL A;  3G4S A;  1W2B A;  1VQ5 A;  3D6W A;  4RMF A;  1Q12 A;  3RN2 A;  2N3S A;  3EIV A;  4JI3 L;  1HNZ Q;  1SRU A;  4BY1 H;  3RZD I;  4X65 L;  4LF9 L;  1PYB A;  2NVX H;  3GTO I;  2Z6K A;  3PUY A;  2JA7 H;  5IYD G;  2RHQ B;  3T1Y Q;  2JA8 G;  2JA8 I;  1UE6 A;  2K5V A;  3T1H Q;  3KJO A;  5IYC H;  4A3J H;  3J7A 5;  3HOV I;  1SN8 A;  4HIO A;  3CCV A;  1X9N A;  2OTL A;  3CW2 C;  1PV4 A;  2I5M X;  3J7Z C;  3KYH C;  4ME3 A;  1VQK A;  4FDB A; 
#chains in the Genus database with same CATH topology
 4OON A;  4AQY Q;  3TRZ A;  2K75 A;  2OQ0 A;  2A19 A;  1A3U A;  1YJW Z;  2NVQ I;  2Q8I B;  4B3T L;  4XQN A;  1PTO C;  4JI2 L;  5EKK A;  1S5C D;  4DUZ L;  3CC2 A;  2EJM A;  1CZG A;  3D4D A;  5C3E B;  3GTG H;  1QB5 D;  3J81 L;  2OEO A;  3S1Q H;  4HAE A;  1VQO A;  3S16 I;  1BBX C;  1PH2 A;  4OIK A;  1XPO A;  4DA2 A;  3H0G H;  2VQF L;  2EY1 A;  5C4J I;  5HGQ A;  5CM2 M;  4B3T Q;  4POG A;  3K5O A;  3BDL A;  4CDF C;  3C3L A;  1TII D;  2AWN A;  3CCS A;  4FXD A;  1W3S A;  1ML0 D;  1Q81 1;  4ZQ3 A;  5JAV A;  2FJ2 A;  5EGT A;  1W2B Z;  1U4M A;  1XMQ L;  3HOY G;  1JIC A;  4JVZ A;  4PV1 C;  2R7F A;  2ZXP A;  1STN A;  3CC4 1;  3KBG A;  3O13 A;  3S1R H;  3JAM L;  4QIW E;  4DV6 Q;  4JI3 Q;  3RZD H;  2R93 B;  1HRJ A;  3FDT A;  1WD1 A;  3Q6S A;  5D3D A;  4YWK A;  1K73 2;  2CQO A;  5JJL A;  4DGZ A;  2A69 C;  2YU9 H;  3P7J A;  2JA5 B;  2P3Y A;  4L5T A;  1HA6 A;  2NBF A;  4FO2 A;  1VQM 1;  3U58 A;  1TS4 A;  3HP3 A;  3I73 A;  3S17 H;  4LF4 L;  3H6M A;  3KIH A;  4LK1 C;  2JIO A;  2EDG A;  1RF2 D;  3SHL A;  4BBS G;  1K8O A;  3DM1 A;  4QCL A;  1EOT A;  2F0D A;  2ATW A;  1B9M A;  3NSW A;  1DL6 A;  4KY5 A;  3A8K E;  1K3R A;  1XMQ Q;  1RL2 A;  2F0O A;  3GTG I;  5IP9 H;  1TWG B;  3W1G A;  3U50 C;  1YNN C;  4DNI A;  1B53 A;  3I4M H;  3GTO B;  3VA7 A;  3NBH A;  1VQA A;  2B8G A;  2HQL A;  1AH9 A;  1KAB A;  3UDG A;  3JAM f;  1VQL A;  2ZTC A;  4KD4 A;  3TS0 A;  2EXD A;  4PMC A;  4UHV A;  1PTO H;  3HOY B;  1IZ6 A;  1D5Z C;  4HN7 A;  3NUC A;  4JBJ A;  3NWS A;  2VB3 X;  2NVT B;  1AA6 A;  1ZYR D;  3FVQ A;  1JOQ A;  3T4A C;  3TRE A;  4A3C G;  4LFB L;  1BO0 A;  3RZO B;  1KC8 2;  4DAV A;  4RVH A;  1A8V A;  2KQ3 A;  3F2C A;  2R93 G;  1E2V A;  4IPG A;  3QO2 A;  3CQZ H;  4ULL A;  3CQZ B;  3G48 A;  1Q86 C;  3L9A X;  3J80 i;  5A2Q E;  3PV0 A;  4HMI A;  2AYD A;  1U5K A;  2QA4 1;  1Y1V G;  2QRE B;  4AQY L;  2JA8 B;  1VQ9 1;  3NP8 A;  4K8J A;  1AN8 A;  4V0B A;  5KGU A;  1PFT A;  3CC2 Z;  3VDY A;  4LF7 Q;  4I7A A;  1JOO A;  5LHY 1;  1PHJ A;  3CCQ A;  2NAP A;  4A93 B;  4O2D A;  4GKJ Q;  3OTO Q;  5K36 H;  3E0J A;  2LS0 1;  1SDF A;  2PQE A;  3TE5 B;  5C3E H;  5LMN W;  1DOL A;  2A6H C;  4WOR A;  4P74 A;  1WCM H;  4QL5 A;  1TS2 A;  1Q7Y C;  2B39 A;  3CPW Z;  2AKL A;  1UEA B;  2IX0 A;  3CMA Z;  1EWI A;  5FK9 C;  4QUF A;  3S17 B;  4G7Z C;  4O1N A;  4A3C H;  2JIR A;  3A0J A;  1Q86 2;  4HR7 B;  5C4J B;  3ULP A;  1YI2 1;  2QW7 A;  2L11 A;  1ZEQ X;  2JJQ A;  2NN6 G;  5I6W A;  4C56 C;  1BR9 A;  1EIF A;  1MIU A;  5J39 A;  2ALY B;  2NZ1 D;  2BE5 D;  1YHB A;  2PMZ B;  2QDB A;  4F8M A;  2G9H D;  2K4K A;  3CME 1;  1STB A;  4NBF A;  4ILW A;  2JK8 A;  3CCU 1;  1TXY A;  3CRK C;  3W1B A;  3E9H A;  1A15 A;  4CJ2 C;  1XMO Q;  1LV9 A;  4RG1 A;  4JYA Q;  3HZX A;  4OWT B;  3TP5 A;  1W2B Y;  3A5Z B;  3I91 A;  2UXC L;  1MJE A;  2XNA C;  2O53 A;  1F2M A;  3HOU I;  1DON A;  5F2D A;  3J7A 4;  2K03 A;  4DK0 A;  3QWN A;  2F4M A;  4AYB E;  2NYZ D;  1FNU A;  1LTR D;  5IP7 G;  2H85 A;  3MXP A;  4NKL A;  1NR4 A;  5GAH C;  3BVM A;  4IOA A;  1F9R A;  3MHB A;  5KND A;  4UP9 A;  3RR5 A;  1VQ4 Z;  4BY1 I;  5JVH 3;  1NY4 A;  1H9J A;  3SVM A;  3LWU A;  3VR6 A;  1QUQ B;  5HGT A;  1ZB9 A;  4K14 A;  3GV3 A;  2ZTD A;  2HIV A;  1IL8 A;  3EJI A;  2JIP A;  1B8A A;  5M3F B;  1YHQ A;  2JS4 A;  3G6E A;  1FL0 A;  2C5C A;  1RLY A;  3SE0 A;  1NUC A;  2NVT H;  4YCW A;  5GQO A;  1TY2 A;  2NUC A;  4C3J G;  1VQ5 1;  3UDI A;  4IFD G;  3S16 B;  3TN2 A;  1XNQ Q;  2UUC L;  1CZW A;  2Z6K C;  4KN4 C;  2WAQ E;  1SBB B;  1QXF A;  4TVA B;  1K28 A;  4NOZ A;  1SYG A;  1F2Z A;  1TWG H;  2V1C C;  1KRL A;  2R3Z A;  1IXR A;  4AYB B;  4QF4 A;  1BCP D;  1HTP A;  3RMH A;  3AYH B;  5ELC A;  4MRI A;  4CBV A;  1QVG A;  1XTC D;  1STH A;  2KOL A;  1C8C A;  2CFM A;  1UEB A;  4OX9 L;  1QG7 A;  1S72 A;  3GTL B;  5M5Y B;  4A3D G;  1Y14 B;  1ZB8 A;  4LF8 Q;  4N9P A;  1VQI A;  5IWA Q;  5IY0 A;  1N32 Q;  1F9P A;  4DV2 Q;  1L1O B;  2A68 C;  1NCV A;  1D7Q A;  4A3K G;  1GHK A;  3I55 Z;  2CVR A;  4MN3 A;  3KDF A;  1PH4 A;  4XDX A;  3F3P C;  1V1P B;  1WTV A;  2NVX I;  4N9T A;  2K05 A;  1I50 I;  3F2D A;  3S1R B;  2Q2U A;  3KLW A;  1YJ9 1;  3DUZ A;  5LL6 X;  1QIL A;  4GN3 B;  3S17 I;  1YIT Z;  4JI1 Q;  1SJE D;  3FPP A;  3HKS A;  2DUD A;  5EBC A;  3K5N A;  4A3L I;  1VQD A;  3K57 A;  4TNU A;  3D9X A;  1C4Q A;  3I2Z A;  4K0K Q;  1S7M A;  1SLJ A;  2GTH A;  2QKI C;  4RCO A;  5DNF A;  1BKB A;  4LF5 Q;  4JI1 L;  5IP9 I;  3PO3 I;  4R1J A;  3FPU B;  2B2V C;  3MFY A;  2SOB A;  2JA7 B;  1LTG D;  2Q2H A;  4ABN A;  4IUV A;  5JOB A;  1I4Q A;  1E3P A;  4NP5 A;  1K8G A;  3BYT B;  4DR1 L;  3CKI B;  3S1Q B;  2L1B A;  4HJ9 A;  2Y0S B;  5CV8 A;  2F0E A;  2YAD A;  5AN9 F;  1TWF B;  4DR2 L;  4KK7 A;  4A3F H;  4GOP B;  3K80 C;  2OXP A;  2HT1 A;  2NWG A;  2RDG A;  3HGB A;  3G6E 1;  4IUQ A;  3RZO I;  4DV5 Q;  4A3J G;  4OX9 Q;  3M4O B;  1WD0 A;  1JWS D;  3D31 A;  1YJ9 Z;  2OCE A;  2KPI A;  1A3V A;  4DF7 A;  3D2L A;  5BR8 L;  4LJZ C;  4C2M H;  2YU9 B;  1TU2 B;  1UE1 A;  1E22 A;  1VS0 A;  1R9T I;  2FHT A;  3EQL C;  5M3M H;  1S72 Z;  1RHP A;  1VQL 1;  2A6H D;  3VR2 A;  2JA8 H;  4DV0 L;  3RZD B;  1YNN D;  3TP6 A;  4NB3 A;  1N8R C;  3CCE 1;  1SFO H;  1Q90 A;  4CJ0 B;  1TT2 A;  3R2T A;  3M4Q A;  1B44 D;  5G3L F;  4GLV B;  1EFI D;  3RUZ A;  4EGV A;  2RCN A;  1Z47 A;  3NPP A;  3PO2 H;  2UXB L;  5JEA G;  4LWC A;  2ASB A;  1VQN 1;  3NWT A;  1IW7 C;  3TZD A;  1X3Q A;  1HNW Q;  1QVF A;  1SMY C;  3MXU A;  2QA4 A;  4P73 A;  3A55 A;  4JI7 L;  5EQ0 A;  2VPW A;  3ERO A;  2RBM A;  3P5J B;  3H0G B;  4DR3 L;  5FLX L;  4HTH A;  5IGE A;  4JI6 L;  1FGU A;  2Q51 A;  4B3M L;  2M6N A;  2L55 A;  5CV7 A;  1CQV A;  3QOL A;  4KMU C;  1QZG A;  1PYW D;  3S15 H;  2F4V Q;  4EWC A;  4I7Z C;  5M5Y H;  3GTL H;  1VQG A;  1A6X A;  1G51 A;  2QDL A;  3Q0A A;  2IW3 A;  4HIK A;  4LFB Q;  4H0L C;  3HOZ G;  2K50 A;  1VQ6 Z;  3NBI A;  4XYO A;  3CCR A;  3HKZ A;  2D5D A;  2JEB I;  3GTP B;  3GTM S;  1USP B;  1Z6H A;  2RDH A;  3QG1 A;  3ZYY X;  1KTK A;  2B8F A;  3NQI A;  3GP7 A;  4JYA L;  1U4R A;  3K7U C;  2QRC B;  4FF2 A;  1NTG A;  1SR3 A;  4DK6 C;  3SR1 A;  1D8L A;  1QCB D;  1MSG A;  4JI8 L;  3OHX C;  1GD7 A;  4ZLT F;  1VQO 1;  1N9W A;  4RAU C;  2WFW A;  4K2K A;  3A8J E;  4S3S A;  2VW9 A;  4X3K A;  3MC0 B;  1S5D D;  3FKI H;  2VS1 A;  3PO2 I;  5FO8 B;  4GLX A;  4WFN 3;  1LM0 A;  4EX5 A;  1EYA A;  4DFA A;  1CQF A;  1VQH A;  4L8J A;  4LFA L;  4A3E B;  1W2B A;  5KNC A;  1S4Z A;  4RMF A;  1M90 1;  4U67 3;  1E0B A;  1HNZ Q;  4X65 L;  1EY5 A;  4K2L A;  1IKL A;  3GTO I;  3U9S A;  2Z6K A;  3PUY A;  2JA7 H;  2H4O A;  2OTL 1;  3LX0 A;  3KJO A;  5JPM C;  3CW2 C;  2QEX Z;  3E3X A;  5KYL A;  5KYI A;  4C3H G;  5T64 A;  2XIW A;  3F2U A;  1PV4 A;  1VQK A;  1D5X C;  1PFM A;  1MGS A;  1QVF Z;  3MA2 B;  1IW7 D;  4PQX A;  3HOX B;  1X3Z A;  1AFP A;  2ZTE A;  2R7D A;  2VY3 A;  4NBD A;  2EYJ A;  4A3E G;  1V43 A;  1HHV A;  1TQO A;  2F52 A;  2E75 C;  1RO0 A;  3A7L A;  1U4P A;  2HD3 A;  2Z4I A;  4JBM A;  3E5S A;  2VF1 A;  2B2W A;  4ZYS A;  1V1Q A;  1YZ6 A;  1JT8 A;  1G2T A;  1QNK A;  1KXL A;  1LTI D;  3PQI A;  4IPC A;  3HOU G;  1HNX Q;  4AIM A;  2O4X A;  3M3Y H;  2UXD L;  5C3E I;  1GUW A;  1I6H I;  1AW7 A;  3D0F A;  3OW2 Z;  1Y1W G;  3ESW A;  5IP7 I;  4C2M B;  1MD2 D;  1KDB A;  3H15 A;  1I50 H;  1WCM I;  1U9R A;  4NDX A;  3NTK A;  3FKI B;  3LUS A;  2OTJ Z;  3F3F C;  1KAW A;  5JJI A;  4BY1 G;  1KQS A;  3KFU A;  1DOK A;  1WYD A;  3EBE A;  2XTI A;  2F0W A;  2MGS A;  3UE1 A;  1WTP A;  1YJN A;  1BUV T;  3G71 A;  1SFO B;  2UU9 L;  4LF9 Q;  1PFB A;  2EJG C;  4X65 Q;  4IQZ A;  3DEO A;  4RV9 A;  4EQP A;  5C44 I;  4IAL A;  2JA6 H;  5A2Q b;  2JA7 I;  3IR7 A;  1VCI A;  4J8Q A;  3TME A;  1XTD A;  1QJO A;  4DR6 Q;  3S14 H;  4RKB A;  1Z02 A;  1NJI 2;  4L6T B;  1Q82 1;  1S40 A;  2K3R A;  1VQ4 1;  3EED A;  4CKE A;  3FEW X;  3MEF A;  3BDO A;  4JV5 Q;  1YJ9 A;  1VMP A;  3CMA 1;  1Y8O B;  1WTR A;  4A3M G;  2V3V A;  2H1E A;  2R7Z B;  2B63 B;  3IKJ A;  1GM5 A;  2D2C C;  2JYO A;  3CC7 A;  2CWA A;  5D1P A;  3RZO H;  1YI2 Z;  4KKS A;  4S1T A;  4MNO A;  1EZ8 A;  3CCL 1;  4Q5V A;  2E8G A;  2BH8 A;  2BA1 A;  2PNH A;  4QB4 A;  2QCP X;  5T1I A;  3JAM b;  4LUV A;  4MHE A;  4E2X A;  1CFM A;  1WOC A;  2UXD Q;  4UY8 C;  2C9O A;  2VQE Q;  4B9W A;  2LFN A;  3NH5 A;  3GV6 A;  2AWO A;  1CT1 D;  1K0R A;  3MEH A;  2MNA A;  1EEI D;  1ET6 A;  2CCZ A;  2L9H A;  2AQ3 B;  4UPA A;  3ND8 A;  2IHE A;  2NVQ B;  4RCN A;  3J80 E;  2PMZ A;  1UNS A;  3CME A;  2PW5 A;  2F4V L;  1TVX A;  2Y0S G;  4A3K I;  4QQB X;  5DAU A;  2RHB A;  2NVT I;  1ICW A;  1UE7 A;  2AMC B;  3GTM H;  4A93 I;  1KD1 1;  4GLA C;  4LUO A;  1QVG Y;  2UUA L;  1VQN Z;  1JJ2 Z;  1B70 B;  1XXG A;  1YHA A;  1LTT D;  4IUP A;  3CD6 A;  1RIP A;  4BXX H;  1GUO A;  3HOY H;  3OW7 A;  3VR5 A;  4A3L G;  5CV4 A;  2F4O A;  3T1Y L;  4QJF A;  2KEE A;  3WOF A;  3K58 A;  2DGY A;  1XNR Q;  3E0E A;  1ET9 A;  5IT9 f;  4OL7 A;  1RJT A;  1HNZ L;  2NTT A;  4BA1 I;  3PO3 G;  1JQY D;  2K1B A;  2SNM A;  4HGY A;  4HED A;  1UAP A;  1GOZ A;  1EU4 A;  1YHQ Z;  5IT9 L;  2HHH Q;  5GAD C;  4KY7 A;  3Q22 A;  1ENF A;  4K8I A;  1PH7 A;  1L0W A;  4DR5 L;  3NBH B;  3KLS X;  1G6P A;  3VYU A;  3VB9 A;  2RBL A;  3D6C A;  2WB1 B;  4RKL A;  2HUG A;  4NFR A;  1X3G A;  4DV4 Q;  4E30 A;  3L7Z C;  5C5L A;  3A7A B;  5M5X H;  1A63 A;  3KBX A;  3VTN A;  1N36 L;  4C3I H;  5HY6 A;  1ZKO A;  2LXJ A;  4R4O A;  1MKH A;  1S5B D;  4CKC A;  3CME Z;  3GTJ H;  4YCU A;  3MXN A;  3SK6 A;  2I5L X;  3LGJ A;  5LL6 f;  4JI5 L;  2EY2 A;  2K5H A;  4L63 B;  3J7Y W;  3HOW G;  1D1K A;  2A73 B;  3W5O A;  4A3L H;  4AH6 A;  3CXC Z;  1G91 A;  3CCU A;  2MO0 A;  4TRD A;  4DXF A;  3I56 A;  5FLX b;  2A68 D;  1FVI A;  3PO2 B;  1B50 A;  4PMW A;  1XPU A;  4DR1 Q;  5IE8 A;  4MIU A;  3OYY A;  1M1K 1;  2EVB A;  3J80 c;  3GTO H;  2Y0S E;  4XQJ A;  3GTK H;  2L4N A;  5T67 A;  2RKS A;  4RVF A;  3CAM A;  2RQX A;  4CDC C;  5C0X H;  2ZM6 Q;  4A3F I;  3HRZ C;  4BA2 I;  1B1Z A;  1W6J A;  4G57 A;  1Q81 C;  1VQP 1;  1YNX A;  1V1P A;  2BDO A;  1EY9 A;  4KHP Q;  4NBG A;  5GAE C;  4JI0 L;  3I4N B;  2E9H A;  1HNW L;  2DE6 A;  4TSS A;  2K5R A;  4OEM B;  3KF6 A;  2FMM A;  4JI4 L;  3D4R A;  2ZAE B;  3M4O I;  3BVG A;  2KHS A;  1YHQ 1;  3PSI A;  1U0L A;  2OTL Z;  2CWP A;  4F7X A;  5EPK A;  1YUA A;  2YU9 I;  2M48 A;  1F2L A;  1ESF A;  1O7L A;  4CL1 A;  3HOV H;  1EQR A;  4ZK9 B;  2QRD B;  1VMC A;  2BCO A;  4RH6 A;  1MI2 A;  2B2Y C;  1SE3 A;  5C4X I;  3MWY W;  3CCR 1;  2JN4 A;  4YY3 Q;  3CCV 1;  1H9S B;  1LT5 D;  3R93 A;  5BR8 Q;  5DM7 3;  4YHH Q;  4PG3 A;  2HU9 A;  2XWB B;  3W3A A;  2E2H B;  1TWA I;  2F0L A;  1T5E A;  1QNU A;  1RO2 A;  4JBW A;  1LTA D;  4GKK L;  1VQP Z;  4B9X A;  3I4M I;  3NEL A;  4IUN A;  1EY7 A;  5J3B A;  1VF7 A;  3CCQ Z;  4KD3 A;  1K83 H;  4YCV A;  5JPN C;  1KL9 A;  3K59 A;  1CHP D;  2KHI A;  2MP1 A;  2JA6 I;  1SE2 A;  3GTK I;  2KEC A;  1KRS A;  3NXW A;  4M8A A;  5IT9 b;  1KHI A;  4LF6 Q;  3GTL I;  2AKW B;  2SDF A;  1HCZ A;  4HSP A;  4V19 0;  4GZY C;  1IBM Q;  1JWU D;  4KTA A;  4KJN A;  4KHP L;  5C6A A;  2WP8 J;  1KC8 C;  2FIN B;  4HID A;  3I56 1;  3R2I A;  2ZJR A;  4A3G G;  5M3M G;  1PZK D;  1F2Y A;  3ULJ A;  4ZAI A;  4K0K L;  1JJC B;  3OMC A;  2JA8 G;  4HH4 A;  3G71 1;  2QLV B;  3Q23 A;  4ME5 A;  3F8T A;  2M00 A;  4LFC L;  5BN4 A;  1E24 A;  2EYM A;  4OGQ C;  2KI7 B;  3STB D;  3V96 A;  3CCM A;  4RVD A;  2LEX A;  3PGZ A;  2IZ3 A;  1TWC H;  5EKI A;  3KF8 B;  2I07 B;  4XIG S;  1YUK A;  3T53 B;  3J81 f;  2V8K A;  3QOJ A;  2E76 C;  2YTY A;  4GN5 A;  1WJ2 A;  5FO7 B;  1JMC A;  1QYP A;  1D2B A;  3ICE A;  2HCI A;  5CBA E;  4L5S A;  1HUM A;  1SYD A;  1QWY A;  4A3D B;  4MON A;  1RDP D;  2L0C A;  3U4Z A;  3LNN A;  1I3Q I;  1A2T A;  5M3F H;  4DUY L;  2KVM A;  1K3B C;  2WB1 G;  4I65 A;  3BZK A;  3BVZ A;  4A3K H;  4PMB A;  1L1O A;  1HXY D;  3CCL A;  1AE3 A;  4A93 H;  3HKZ B;  3MFG A;  1PTO F;  1K83 B;  4BXX I;  3MZL B;  3WOE A;  3HOY I;  1IYV A;  3VMI A;  1TY0 A;  4ZKC B;  3CCR Z;  1VQ6 A;  3M4Y A;  2F3W A;  1YJN Z;  4WJ4 A;  5C4H A;  2E2H H;  2MJ8 A;  4NW2 A;  1X55 A;  4LAA A;  1JC7 A;  4Y7N B;  4HCS A;  5COR A;  1YBY A;  5C44 G;  1GHJ A;  1QVF Y;  3I72 A;  1KC8 1;  2JA7 G;  4B3R L;  2CHB D;  2XSC A;  3OTO L;  1YJN 1;  4JI4 Q;  3EFX D;  1KDC A;  3HOX I;  3FP9 A;  3BU2 A;  4XT1 B;  5GAG C;  3OW2 A;  4EQO A;  2PMZ E;  4UP7 A;  4JI0 Q;  2IL8 A;  2F0F A;  2J4X A;  1Q8K A;  2ICE C;  1LTS D;  4K5X A;  4A3M I;  3GCF A;  1TWC I;  3BG0 B;  1FJG Q;  1J5E L;  5BN3 A;  2A74 C;  2AQ1 B;  3GTQ B;  2DE7 A;  1RCV D;  3CU7 A;  1K73 C;  2HQE A;  1I6H H;  1CKM A;  1BVS A;  4F88 A;  2J7Z A;  3J81 j;  4J1M A;  3GTJ I;  2PZW A;  1A2U A;  1MJC A;  1TWA B;  4ZUI A;  1K8M A;  2R92 G;  1Q46 A;  1WI5 A;  5JVG 3;  3ULL A;  1I3Q H;  1VQF A;  4JPB W;  4LMQ D;  1B9N A;  4AYB A;  1VQK Z;  3X3M A;  5IYD H;  4NBE A;  3OPO A;  1YVC A;  1VQ8 1;  1D1I A;  1KIX A;  1CKO A;  5I4D A;  3CC4 A;  3OMG A;  1RO4 A;  3GTK B;  2JP1 A;  3P20 A;  4DAM A;  2EXZ A;  2PW7 A;  2IWH A;  3IAY A;  4FP5 D;  4RGM A;  2MFI A;  3CCL Z;  4A3J H;  2EY5 A;  3PCO B;  5IIF A;  1F9Q A;  1K0S A;  1TWG I;  3S2H B;  4A3G H;  2NVY B;  4R8N A;  4A93 G;  1JB7 A;  1FNV A;  1EQT A;  5CBE E;  1VLA A;  3ZJY C;  5C0X I;  1QE6 A;  4DV4 L;  2K04 A;  2A5H A;  4OO1 G;  4CGY B;  1F9S A;  2XWJ B;  1Q81 2;  3JAM c;  4LF4 Q;  2MO1 A;  1SJH D;  2R7Z I;  4DR5 Q;  1CTM A;  1RQF A;  4KV6 A;  3I4N I;  4DKA C;  4XT3 B;  5HUR A;  1C0A A;  1K9M 2;  2M2L A;  1VQ5 A;  3CD6 1;  1LTL A;  2CH4 W;  5C3X A;  5D65 A;  1Q12 A;  1B3A A;  3EIV A;  2Z9H A;  1P9N A;  3KIF A;  2NVX H;  2VUG A;  1K73 1;  3HOZ B;  2K28 A;  2K5W A;  4XYQ A;  3BYY B;  5IGC A;  2K5V A;  3J7A 5;  5IYC H;  1X0T A;  3HOV I;  1SN8 A;  4EQN A;  2OTL A;  4DU9 A;  2BDN A;  2QEJ C;  5FKA C;  3J7Z C;  5I2X A;  4KN7 C;  4KKU A;  2Q8R E;  4BS9 A;  2UUA Q;  2DE5 A;  2KA7 A;  3D3R A;  3IRB A;  1ESR A;  3GTM I;  2PM9 A;  3PO3 H;  1LTB D;  1TWA H;  3S1N H;  2J0T D;  1R4Q B;  4B3S L;  3HOW I;  1I6H B;  2F0M A;  4GNX B;  3AEV A;  1GUN A;  1GVP A;  5IOD A;  1EYD A;  3NH4 A;  2RT9 A;  2O5J C;  3KK7 A;  3MZ5 A;  2I0Q A;  1PH3 A;  3G7L A;  5IOC A;  3DMU A;  3PUW A;  4DUZ Q;  2JA6 B;  2Q2T A;  3H3V C;  2DNE A;  1VQ8 Z;  5FLX E;  1RNI A;  2P28 A;  3RD4 A;  3GTP I;  1Z01 A;  4Y7N H;  3I4N H;  3G4S Z;  3S24 A;  2ZT9 C;  2KCC A;  3DXJ C;  2ZXR A;  1I4H A;  4XXE A;  1Q82 C;  2LKV A;  1HZB A;  1O78 A;  3KUP A;  4DAY A;  1OO9 B;  1P16 A;  2E2D C;  4A3F G;  3CC2 1;  3GTJ B;  4NH1 C;  3ND9 A;  4MTN A;  4Y52 I;  1SNQ A;  3DEP A;  2EYO A;  4BBS H;  4GS3 A;  4GN4 B;  2KUM A;  1JWM D;  1Y1V H;  1YJW 1;  1BCP F;  1HFG A;  1S3O A;  2GVA A;  2HF1 A;  2FXQ A;  3EN2 A;  2OOY B;  3CMA A;  4A3D H;  2UU9 Q;  1J8I A;  4X64 Q;  2B2V A;  2KEN A;  1PZI D;  4A3B G;  2PQA B;  4FF1 A;  4ID6 A;  1CI3 M;  1QF8 A;  4K6D A;  2BH2 A;  5KEE A;  1X6O A;  3AB9 A;  3C1F A;  3K8A A;  5AFW A;  4C3H H;  3K7A I;  2NVY I;  1NUI A;  1SNC A;  3BG1 B;  1PTO B;  2EIF A;  5E7N A;  2D0O A;  2F03 A;  3S15 I;  3CCE A;  2WB1 A;  5A2Q L;  4A3E H;  1HNX L;  1EU3 A;  1S5E D;  1Y1V S;  1E2W A;  4QMG A;  2CW0 D;  3S2D I;  1DYQ A;  3U9O A;  1JWH C;  4RHR A;  4UP8 A;  3MTS A;  1Y8C A;  3QJY A;  1VQM A;  2F0S A;  2EE1 A;  3V2T A;  1WZN A;  3J80 f;  1ILQ A;  4ZRZ A;  1E1T A;  3BZC A;  4RGN A;  2JA6 G;  4MD8 A;  3PMF A;  4MD9 A;  4JI2 Q;  5K5P A;  3AQQ A;  3CPW Y;  1GXD C;  4B3M Q;  3G6E Z;  2VPX A;  4MTK A;  1N33 Q;  1ZXT A;  5CMD A;  3H3V H;  4IOC A;  1TWH B;  4JI6 Q;  3U4V A;  3MZK B;  3CP0 A;  3PF4 A;  2IHF A;  4DR3 Q;  1CHQ D;  2B3G A;  2D0P A;  2PZT A;  1BDO A;  4A3M H;  1TWC B;  1WFQ A;  3T1H L;  3BS1 A;  2B63 G;  3RLF A;  4HJ7 A;  1EOV A;  2KED A;  1NP6 A;  1AZP A;  1PLF A;  5IP9 G;  1SMY D;  3FKI I;  1FR3 A;  2QF7 A;  2AHO B;  1KDA A;  2HCC A;  1SXT A;  1PA6 A;  1PH9 A;  5AJ3 L;  1X65 A;  1LT6 D;  1Z03 A;  3M7N A;  3VMH A;  4HGZ A;  1AE2 A;  5DEH A;  4M1U B;  4IPD A;  5A2Q f;  1NBW A;  4A3J I;  1KNA A;  4IO9 A;  3AU7 A;  3LWE A;  4BY7 I;  3KOJ A;  1OXT A;  3S2D H;  4J6H A;  4NMZ A;  1WTW A;  1H95 A;  4JI8 Q;  3PIP 3;  1TS3 A;  3FHW A;  3BJU A;  3A74 A;  2O5I C;  5IGB A;  5M5W H;  4RGT A;  1PDQ A;  3CCM Z;  3SDZ A;  2PZU A;  3I90 A;  4IN3 A;  2E74 C;  4DR2 Q;  1I5F A;  1F77 A;  4A3I H;  1FNW A;  2R7Z H;  1PMR A;  3Q24 A;  2OTJ A;  3A5U A;  1WTH A;  3FMC A;  4TKO B;  4XTC S;  1B4O A;  4JOI A;  5T1G A;  2N8N A;  4MD7 A;  4FF3 A;  1TKW B;  3J81 E;  1Q16 A;  1X3E A;  1JOR A;  4R4T A;  4LF5 L;  3M3Y I;  3GQB A;  1YI2 A;  3PF5 A;  2CQA A;  5C0X J;  2R93 H;  5IP7 H;  1VQ7 1;  3HOX G;  2AQ2 B;  2Q4Z A;  4A3B H;  4X62 Q;  3J7A F;  4P72 A;  1N8R 2;  1J5E Q;  3OW2 Y;  2LMC B;  2Q8T A;  5CGK A;  5CC4 A;  2R6G A;  4R8I A;  1BXT A;  4DV1 Q;  5I9O A;  4C1N I;  4KI0 A;  1GUG A;  3A56 A;  2LIY A;  2RPR A;  1LT4 D;  1I4X A;  2WIN B;  5J22 A;  1ASZ A;  1I3Q B;  3S15 B;  4A3F B;  2PI2 E;  4NBC A;  2BOS A;  5FO9 B;  1KLG D;  5I2Y A;  2R92 I;  2QEX A;  1VQB A;  3S2D B;  1N32 L;  4X6A H;  1WII A;  3MXN B;  1SNM A;  3S14 I;  1DOM A;  1J6Q A;  2KCM A;  1RD9 D;  4GOP C;  3VYS A;  2RF4 A;  4GKK Q;  2EPB A;  2VNU D;  4XQQ A;  2E2H I;  1VF5 C;  2KHJ A;  4IUU A;  5IT9 c;  4DGL A;  4KLK A;  3CRL C;  1FDO A;  4C3J H;  1VQL Z;  1GO3 E;  3QIA A;  4PZ7 A;  2B2T C;  4R4Q A;  2OQK A;  4UAI A;  1L1O C;  3MON A;  3HOX H;  4Y7N I;  1CKN A;  3TSS A;  2RA4 A;  2AUK A;  2N55 A;  4YWL A;  2K5Q A;  2R61 A;  2VPY A;  3IF8 A;  4IUT A;  4DV5 L;  4HJA A;  1KD1 2;  4QGU A;  3H91 A;  5C0X G;  5C4X B;  2WKC A;  2WAQ A;  2E7Z A;  1O80 A;  3PO2 G;  4DAP A;  2R93 I;  1YNJ C;  2V8I A;  4A3M B;  2ZJP A;  2R7Z G;  3CCE Z;  1GUS A;  1ENA A;  3I4N G;  3STB C;  2GU2 A;  3P1H A;  1HR0 L;  1SNP A;  5M5X B;  4MZ9 A;  3I4M B;  3PO3 S;  5M3F G;  1N8R 1;  5C5M A;  3HFZ B;  1Y1V I;  3PUZ A;  1VQ7 Z;  1T5X D;  4DV1 L;  3R8B A;  3S1N B;  4H7B A;  1KRT A;  1VQE A;  4P75 A;  1OTC A;  1DM0 B;  2VB2 X;  4R4C A;  4NXM L;  1JB3 A;  3I3C A;  4CDE C;  2F0H A;  1TR5 A;  4NBB A;  1JCK B;  4KJO A;  4DPG A;  1KD1 C;  2R92 H;  4C1N K;  4JBK A;  3HEJ A;  1VQC A;  3HOV G;  4HSV A;  1Y8N B;  2M9V A;  1NMG A;  4TQU S;  4G7H C;  1STY A;  5JEA J;  3K7A H;  5C44 B;  2O4H A;  1PH1 A;  3TBI B;  1IBM L;  1Q1B A;  3E9I A;  4H13 C;  2ENB A;  3S16 H;  1UUP A;  4E2Y A;  2Z4H A;  1DCZ A;  4A3E I;  2YTX A;  3NK9 A;  2LFU A;  1PXU A;  2OT2 A;  2IV2 X;  1XMO L;  5IT9 E;  3I7F A;  3C2P A;  4XX2 A;  1IBL L;  5ELD A;  1VQO Z;  1Q3L A;  1L0X B;  2XVS A;  2NN6 I;  3H09 A;  4WJ3 M;  1ML8 A;  1C9O A;  3CF5 A;  1NJI C;  4DNR B;  1I94 L;  1Y1W I;  3M9B A;  5D1O B;  4RGO S;  3SK4 A;  1VQ8 A;  4BBS B;  3OSO A;  1WCM G;  4RS4 A;  3IFU A;  1PZJ D;  1D5M C;  2DY7 A;  4BBR B;  2VUM H;  5T6B A;  4N8X 1;  1X54 A;  5GRO A;  2N78 A;  1EY0 A;  2IY5 B;  4KHV A;  4ZCK A;  4IFD J;  5M3M B;  1XNQ L;  1VQ6 1;  1L0Y B;  5AJ3 Q;  2WB1 E;  4JG2 A;  3F2B A;  1TWH H;  3SK8 A;  1HQR D;  2B2U C;  1KNE A;  1TFI A;  1VQJ A;  4JCV E;  4OWW B;  3CD6 Z;  4A3K B;  4DAY B;  5IYC G;  4DNT B;  1EYG A;  3HOW H;  4E2W A;  3CCJ A;  4FF4 A;  2OF1 A;  3WWV A;  4LF7 L;  3KF6 B;  3PUX A;  2F0V A;  2OOX B;  3TP8 A;  4A76 A;  3HKZ E;  5CV9 A;  1OXV A;  3SK5 A;  4A3G B;  4R9W A;  3S1M B;  2LY7 A;  1D6E C;  2ZM6 L;  4KY6 A;  3GO5 A;  5KRU A;  1UWV A;  1BCP C;  4A3J B;  1Q7Y 1;  5EKL A;  4BY7 H;  3MVV A;  5J1Z A;  3NHH A;  3DWA A;  2KJX A;  1VQ5 Z;  3L3O C;  1WTO A;  5A35 A;  1RKN A;  3L2P A;  5M9O A;  1H9M A;  2N49 A;  3NTH A;  4B08 A;  5IGD A;  3M4O H;  2QIL A;  4OEL B;  5EPL A;  4C3I G;  2Z1C A;  1H9S A;  3CCV Z;  2F3V A;  5EBD A;  3W2D A;  1NAP A;  1PFS A;  1YIT A;  4BWG B;  2UXC Q;  5IGF A;  1KLU D;  1YIJ Z;  2JEA I;  3CC7 Z;  2NVX B;  2WKD A;  1PRT D;  4Y52 H;  1EYC A;  1X3P A;  1Y1V B;  2BA0 A;  3E6Z X;  4ALP A;  3FRP B;  4JI5 Q;  4JW0 A;  1EY8 A;  2R6M A;  2I5H A;  1EFW A;  3I56 Z;  4AYB G;  1FYC A;  2WV6 D;  4FYD A;  2TSS A;  1K8A C;  1VQK 1;  1CM9 A;  5C4X H;  4X64 L;  4A3D I;  1J9O A;  2A69 D;  1LYL A;  4U68 A;  2JA9 A;  1DGS A;  3CC4 Z;  2YV5 A;  1V9P A;  3L0O A;  4ZKB B;  3H0G G;  3J80 b;  4K5V A;  2VZA A;  3BZD B;  2OTJ 1;  3CCJ Z;  5IGG A;  3FQM A;  3DHQ A;  5ELE A;  2NVY H;  4DR6 L;  2MPM A;  2F0P A;  1K83 I;  3FKI G;  3G4S A;  3D6W A;  3HOV B;  2B2W C;  4JI3 L;  1TS5 A;  1SRU A;  2CW0 C;  3NTI A;  3TDH B;  4LF9 L;  1DJR D;  3IFT A;  2RHQ B;  3VR3 A;  3KF8 A;  1S5F D;  3KLS A;  1X9N A;  4HIO A;  3CCV A;  3T16 A;  3OWE B;  3KYH C;  4ME3 A;  2NB0 A;  2DY8 A;  5BN5 A;  2JUB A;  3HOW B;  4FDB A;  1BNZ A;  1EWH A;  1SE8 A;  2KBN A;  2E2I H;  2EGT A;  1N33 L;  2A1A A;  3NQT A;  4BY7 G;  2IZ4 A;  2JA5 G;  1BBW A;  1OXU A;  1FGB D;  3VYR A;  3H3V I;  5I6Y A;  2H5X A;  1VDZ A;  1SND A;  4NBA A;  2C35 B;  1MHW C;  2HIX A;  1EIG A;  3BG3 A;  5FLM H;  3HOU H;  1HUN A;  1N2F A;  5ELO A;  1QZH A;  1JJ2 A;  2PQA A;  2E2J H;  4A3B B;  3GTQ I;  4YIJ A;  2PI2 A;  2PYK A;  3CPF A;  2EQS A;  4OHJ A;  1C7Y A;  1LT3 D;  5IYB G;  1H9R A;  4B3S Q;  3HOZ H;  3RLO A;  1VQ4 A;  4G4K A;  2K5D A;  2YTV A;  1HJP A;  2MHV A;  5ELN A;  4UDU C;  1X3W A;  2K14 A;  2X6L A;  1PH8 A;  4CJ1 B;  2KCN A;  2FMC A;  1NMF A;  1K8A 1;  5ISR A;  1EQQ A;  3NDJ A;  3J81 i;  4H02 A;  3VA5 A;  2RSN A;  1YIT 1;  3RLN A;  1SIW A;  4GNX C;  2XRQ D;  5CYU A;  1K9M 1;  1RTN A;  1G8Z D;  1SE4 A;  2BJO A;  2JMO A;  4X66 Q;  1LAC A;  1Q86 1;  2A8V A;  2WAC A;  1HFN A;  1XPR A;  3IX0 A;  2JQO A;  3DLL A;  1SMX A;  3S2H I;  3IFD A;  1PVO A;  1SYE A;  2B29 A;  2ICI A;  1II3 A;  1VQ7 A;  1R4P B;  2EYP A;  4LFA Q;  3PIO 3;  3ERQ A;  4IZ8 A;  5FLM G;  2EYH A;  1A0I A;  1WTX A;  1OXS C;  3SEB A;  2RVL A;  3GTG B;  4CDD C;  4OXP A;  4DV6 L;  2F0U A;  4A3I I;  3I70 A;  3CXC A;  4X66 L;  4E2Z A;  4E31 A;  1I4P A;  4N8F A;  4HJ5 A;  2NN6 H;  1Q1E A;  2QGQ A;  3KJP A;  3S9W A;  3DWP A;  2I3C A;  2B63 H;  5FJ8 H;  2JSO A;  2RSO A;  3C1E A;  2OZK A;  4DK1 A;  3GTQ H;  4IPH A;  5LMU L;  3GDE A;  2D9U A;  4APV A;  3HOZ I;  3G71 Z;  1R9T B;  2DN8 A;  2JA5 H;  2VUM I;  4BBR I;  3Q8D A;  3AFP A;  1O7I A;  3OIQ A;  3P75 A;  4X3U A;  2VQF Q;  4NB8 A;  2VXW A;  4BY1 B;  2X69 A;  4A4I A;  4O42 A;  3CHB D;  1AP0 A;  1VQP A;  1TWH I;  3I55 1;  1CKN B;  1PFN A;  1PRT B;  2FFK B;  4CKB A;  3GTM B;  4QTT A;  1EY4 A;  2HDM A;  2XRS D;  3H3V J;  2F0K A;  2ZXO A;  2QA4 Z;  1Q8I A;  2PNR C;  5DM6 3;  2NVQ H;  4OIJ A;  4DR4 Q;  1ZYR C;  3ERS X;  1K9M C;  4X6A I;  4YWM A;  2JIM A;  1M1K 2;  1Y8P B;  2SNS A;  3J80 L;  3EVQ A;  3HS0 C;  3I8Z A;  1FJG L;  2Z6B A;  2EOT A;  4CHT B;  3GD7 A;  2EYF A;  4A3G I;  2CH4 A;  4P2C B;  4WRD A;  4JI7 Q;  4LNQ A;  3S1M I;  5JJK A;  5E3F A;  2P5Z X;  1BOS A;  2RCF A;  3K81 C;  4WJW A;  3ITP A;  4EVO A;  3RN5 A;  2UXB Q;  4QIW B;  1Z9F A;  1M8A A;  4F87 A;  4B3R Q;  5E4X A;  4X3S A;  3J7A V;  2L12 A;  1DZ1 A;  3NH8 A;  3KLR A;  1EL0 A;  5LMN Q;  1FD7 D;  3GKQ A;  4DR7 Q;  5D14 A;  2JR6 A;  1E2Z A;  2L5T A;  2XN9 C;  5IYB H;  2EJF C;  4IJH A;  2IJ0 A;  1QOH A;  2WII B;  2K52 A;  2F0G A;  5C3W A;  2D62 A;  1KQS Y;  4DQY B;  2XGT A;  1JOK A;  3QR8 A;  3F1Z A;  1PH5 A;  2ES2 A;  1SYB A;  3DM3 A;  1UE5 A;  2SEB D;  3N6R A;  3M85 A;  3K0Y A;  1R9T H;  3PIO A;  4GNX A;  1I94 Q;  3EA6 A;  4R4I A;  1SRO A;  4MH4 A;  5H1S E;  3HOU B;  2A6E D;  2NTS A;  1NJI 1;  4GOP A;  1XX8 A;  4KKT A;  2PO4 A;  2F4I A;  2YYZ A;  5CR3 A;  1IBL Q;  1SFO I;  3CCS 1;  4IFD H;  1AEX A;  4BXX G;  3S1N I;  2O2L D;  3CC7 1;  4QY7 A;  4HJ8 A;  2G9D A;  2F0Q A;  4PNY A;  1ONL A;  3T4N B;  4DV3 Q;  2K32 A;  1A62 A;  4HIM A;  5C3E G;  3CCS Z;  3QWU A;  1NSN S;  1EZ6 A;  2G2K A;  3A54 A;  2UUB L;  1ASY A;  1JE4 A;  1HA5 A;  2N88 A;  1N34 L;  2V4D A;  1BF4 A;  2BE5 C;  4OWX B;  4K6L A;  1LAB A;  1P8L A;  4POF A;  5JJZ A;  1ENC A;  2WAQ B;  3TQY A;  1PYS B;  3J81 b;  3I55 A;  2J6A A;  3GTP H;  3VMG A;  4DXG A;  1LQL A;  2I46 A;  4X3T A;  2E2I I;  3G6J B;  4RWS C;  4DN4 M;  5KNB A;  1EY6 A;  3JC6 6;  1Y1W H;  1L2F A;  5M5W B;  1G2S A;  1XJV A;  1E1O A;  1M4V A;  3B6Y A;  4Q0F A;  1O7Z A;  4JK1 C;  3QB3 A;  1IBK Q;  4L5R C;  2F3I A;  4DV7 Q;  2GVB A;  1QVG Z;  1STG A;  4DV2 L;  5I9P A;  3MXG A;  4BBS I;  1T9H A;  2K33 A;  1O7Y A;  2LXK A;  4LUZ A;  3D8G A;  2EYL A;  4DV0 Q;  2E2J B;  4E33 A;  2VL6 A;  2PPB C;  2R92 B;  1WW9 A;  1DXM A;  4NXN L;  2E5L L;  3AFQ A;  3M7G A;  1STE A;  1V1O A;  2B2U A;  3D4W A;  1AZQ A;  2VPZ A;  1BCP B;  1QVC A;  1WCM B;  1EWC A;  4ODG A;  5NUC A;  1USP A;  2E5L Q;  1DD2 A;  3FQQ A;  1I6V C;  2JXM B;  2X6G A;  2W03 A;  1S72 1;  4DUY Q;  3VR4 A;  4EQ5 A;  3CCM 1;  5L37 A;  5E4W C;  5ELF A;  2ZJQ A;  2GN5 A;  4A3C I;  4OO1 I;  4BY7 B;  1QUQ A;  3UI2 A;  3K5M A;  1M90 C;  2AUJ D;  3S2H H;  4NBH A;  1IBK L;  3H0G I;  5D1O A;  2F0J A;  1YJW A;  5C4J H;  1OXX K;  1U4L A;  2JIQ A;  5FLX c;  1HPC A;  3T13 A;  1ILP A;  3OWF A;  1YIJ A;  2DJF C;  1HTL D;  4L5Q A;  3NFZ A;  3I4O A;  4LFC Q;  3PO3 B;  2F0T A;  2EZV A;  1CK1 A;  4A75 A;  1WJJ A;  4LW1 A;  1BBU A;  2IX3 A;  1WTQ A;  1VQM Z;  4A3I B;  4C3J B;  4MXU A;  2WAQ G;  3UE0 A;  1B2T A;  3R3O A;  2G5D A;  3K0X A;  3S1R I;  1I50 B;  3TEH B;  4NXM Q;  1IYJ B;  1JE5 A;  4RVG A;  3G4S 1;  1HZA A;  1SYC A;  3PUV A;  3TP7 A;  1EIY B;  3JAM i;  2L15 A;  1TWF I;  1M90 2;  3CCJ 1;  1X56 A;  2PK7 A;  3OIP A;  1N34 Q;  1SYF A;  2V45 A;  2UUB Q;  1LO5 D;  2JA5 I;  4H44 C;  1JR0 D;  4BBR H;  4LF6 L;  3J81 c;  1HR0 Q;  4HMJ A;  2VUM B;  1CUK A;  5LL6 S;  2MUY A;  3ONA B;  4C3I B;  2CKZ B;  4FXK C;  4DV3 L;  4C3H B;  5ELB A;  5CV5 A;  4IJL A;  3X3N A;  4KHZ A;  5IWA L;  5FJ8 G;  1Y1W B;  3TDQ A;  4LF8 L;  1SEB D;  3K5L A;  5CV6 A;  2K7V A;  1EEF D;  2LSS A;  5G3L D;  1G6Z A;  1H9K A;  1I4G A;  1YNJ D;  3URY A;  1SAP A;  3RNU A;  5EPJ A;  3BDC A;  1IKM A;  4JC0 A;  3SXH A;  3NEM A;  4YHH L;  3UDX A;  1B7Y B;  4FVM A;  3CPW A;  1C48 A;  3NDI A;  4YY3 L;  3S14 B;  4OO1 H;  1N36 Q;  4G7O C;  1VQ9 A;  1XYI A;  3TZU A;  5DLQ E;  1X3F A;  2K6A A;  1EUJ A;  4NXN Q;  2ID0 A;  3CCQ 1;  3HG9 A;  1EQV A;  1NR2 A;  3S1M H;  1Q82 2;  1HZ9 A;  5C44 H;  2JNY A;  1HZC A;  5TSS A;  2UUC Q;  5EAY A;  2DJG C;  1ICF B;  1YEZ A;  3OOC A;  2HHH L;  3NEN A;  1NE3 A;  1Y69 U;  1PH6 A;  2B2Y A;  1HQM C;  2IX1 A;  1NNX A;  3EER A;  4DV7 L;  2JE6 I;  1HR0 W;  3CQZ I;  2W04 A;  3A8I E;  1A3T A;  4RHS A;  1CSQ A;  1VQN A;  1XNR L;  5FLX f;  1IL2 A;  1M1K C;  4GKJ L;  4QUC A;  1V8Q A;  5FLM I;  2PCF B;  5K36 G;  1BQQ T;  3I07 A;  3Q87 A;  1TWF H;  2E2J I;  1JJG A;  1Z7T A;  5D3I B;  2NZO A;  3K6O A;  1PRT F;  2A6E C;  2Z0S A;  5E1F A;  5FOB B;  4A3I G;  4X62 L;  2RDF A;  1Q7Y 2;  4A3B I;  3H94 A;  1VQ9 Z;  4ZUJ A;  5C4Z A;  2MQH A;  1YIJ 1;  1MBY A;  4FNF A;  4QTU A;  4DR4 L;  2NZH A;  1HH2 P;  3ER0 A;  1G29 1;  4E32 A;  2TMP A;  3DWQ A;  1K8A 2;  1ZH1 A;  2F1M A;  2IT1 A;  1GKH A;  5EJW A;  3V05 A;  1FDI A;  1LUZ A;  1LLR D;  3TS2 A;  2VUM G;  3HKZ G;  4BBR G;  2RHS B;  4IFD I;  3VYT A;  3UDF A;  4DK3 C;  4FXG C;  5KIX A;  3MAQ A;  3PIP A;  1E7Z A;  2VQE L;  1JJ2 Y;  2QR1 B;  1ROD A;  4HCE A;  3C46 A;  1CA6 A;  4NPS A;  2Z8L A;  3T51 B;  4PZ8 A;  4K5W A;  4P71 A;  4PZ6 A;  2K5N A;  5C4X G;  4JOI C;  5LMU Q;  3S1Q I;  5JEA H;  1GJX A;  1I4R A;  3AMU A;  1IHZ A;  3JAM E;  3K7A B;  4NB9 A;  3CCU Z;  3SGI A;  3I4M G;  3WDN A;  1GUT A;  3KDF B;  2OWO A;  2V8J A;  1WVL A;  1SSO A;  4E6I A;  2KCT A;  4O0A A;  3N52 A;  4J15 A;  4RFB A;  1EIH A;  4JV5 L;  2HDL A;  2B63 I;  2E2I B;  2QEX 1;  1CSP A;  1MSH A;  2IPK D;  3I4L A;  4DR7 L;  2Q2I A;  5LMN L;  1W6K A;  4RA8 A;  3IL8 A;  1SNO A;  3M4P A;  3NE5 B;  1KQS Z;  1RTO A;  1PTO D;  1CA5 A;  1IYU A;  2F0N A;  3RN2 A;  2N3S A;  3M3Y B;  4BY1 H;  3RZD I;  1PYB A;  2QKD A;  1KAA A;  3T56 B;  2K01 A;  1XWE A;  1PRT C;  5IYD G;  3T1Y Q;  1STA A;  1B3Q A;  2JA8 I;  1UE6 A;  2DNC A;  2EY6 A;  2B2T A;  2F0I A;  3T1H Q;  5COY A;  4Z9C B;  2GA4 B;  2RIQ A;  1X32 A;  4IUR A;  2I5M X;  2GTI A;  2Y0S A;  3CXC Y; 
#chains in the Genus database with same CATH homology
 4OON A;  4AQY Q;  3TRZ A;  2K75 A;  2OQ0 A;  2A19 A;  4B3T L;  1YJW Z;  2NVQ I;  4JI2 L;  4DUZ L;  3CC2 A;  3GTG H;  3S1Q H;  1VQO A;  3S16 I;  1PH2 A;  1XPO A;  3H0G H;  2VQF L;  5C4J I;  5HGQ A;  5CM2 M;  4B3T Q;  4POG A;  2AWN A;  3CCS A;  1W3S A;  1Q81 1;  1W2B Z;  1XMQ L;  3HOY G;  2R7F A;  3CC4 1;  3S1R H;  4QIW E;  4DV6 Q;  4JI3 Q;  3RZD H;  4YWK A;  1K73 2;  2CQO A;  5JJL A;  2YU9 H;  2P3Y A;  4L5T A;  1VQM 1;  3U58 A;  3S17 H;  4LF4 L;  3KIH A;  4BBS G;  2ATW A;  1DL6 A;  1K3R A;  1XMQ Q;  1RL2 A;  5IP9 H;  3GTG I;  3W1G A;  3U50 C;  4DNI A;  3I4M H;  1VQA A;  2HQL A;  1AH9 A;  3UDG A;  3JAM f;  1VQL A;  2ZTC A;  3TS0 A;  2EXD A;  1IZ6 A;  4JBJ A;  4LFB L;  3TRE A;  4A3C G;  1KC8 2;  4RVH A;  1A8V A;  3F2C A;  2R93 G;  4IPG A;  3CQZ H;  3G48 A;  1Q86 C;  3J80 i;  3PV0 A;  1U5K A;  2QA4 1;  1Y1V G;  2QRE B;  4AQY L;  1VQ9 1;  1PFT A;  3CC2 Z;  3VDY A;  4LF7 Q;  1PHJ A;  3CCQ A;  4O2D A;  4GKJ Q;  3OTO Q;  3TE5 B;  5C3E H;  5LMN W;  4P74 A;  1WCM H;  4QL5 A;  1Q7Y C;  3CPW Z;  2AKL A;  2IX0 A;  3CMA Z;  1EWI A;  4A3C H;  3A0J A;  1Q86 2;  3ULP A;  1YI2 1;  2JJQ A;  2NN6 G;  1EIF A;  1MIU A;  2ALY B;  1YHB A;  2K4K A;  3CME 1;  4NBF A;  2JK8 A;  3CCU 1;  1TXY A;  3W1B A;  3E9H A;  4JYA Q;  1XMO Q;  4RG1 A;  4OWT B;  1W2B Y;  3A5Z B;  2UXC L;  1MJE A;  2O53 A;  3HOU I;  3J7A 4;  2F4M A;  4AYB E;  5IP7 G;  2H85 A;  5GAH C;  4IOA A;  4UP9 A;  3RR5 A;  1VQ4 Z;  4BY1 I;  1NY4 A;  1QUQ B;  1ZB9 A;  2ZTD A;  2HIV A;  1B8A A;  1YHQ A;  2JS4 A;  3G6E A;  1FL0 A;  1RLY A;  2NVT H;  4YCW A;  5GQO A;  1VQ5 1;  3UDI A;  4IFD G;  1XNQ Q;  2UUC L;  2Z6K C;  2WAQ E;  4TVA B;  4NOZ A;  1TWG H;  2V1C C;  1KRL A;  1IXR A;  3AYH B;  4MRI A;  1QVG A;  2CFM A;  1UEB A;  4OX9 L;  1S72 A;  4A3D G;  1Y14 B;  1ZB8 A;  4LF8 Q;  1VQI A;  5IWA Q;  5IY0 A;  1N32 Q;  4DV2 Q;  1L1O B;  1D7Q A;  4A3K G;  3I55 Z;  3KDF A;  1PH4 A;  3F3P C;  2NVX I;  1I50 I;  3F2D A;  2Q2U A;  3KLW A;  1YJ9 1;  4GN3 B;  3S17 I;  1YIT Z;  4JI1 Q;  3HKS A;  2DUD A;  4A3L I;  1VQD A;  4TNU A;  3D9X A;  3I2Z A;  4K0K Q;  1S7M A;  1SLJ A;  2GTH A;  1BKB A;  4LF5 Q;  4JI1 L;  5IP9 I;  3PO3 I;  4R1J A;  2Q2H A;  1E3P A;  1K8G A;  4DR1 L;  4HJ9 A;  2YAD A;  5AN9 F;  4DR2 L;  4A3F H;  4GOP B;  3K80 C;  2HT1 A;  4A3J G;  3G6E 1;  4DV5 Q;  3RZO I;  4OX9 Q;  3D31 A;  1YJ9 Z;  2OCE A;  2KPI A;  5BR8 L;  4C2M H;  1UE1 A;  1E22 A;  1VS0 A;  1R9T I;  5M3M H;  1S72 Z;  1VQL 1;  2JA8 H;  4DV0 L;  4NB3 A;  1N8R C;  3CCE 1;  1SFO H;  3M4Q A;  4GLV B;  2RCN A;  1Z47 A;  3PO2 H;  2UXB L;  5JEA G;  4LWC A;  2ASB A;  1VQN 1;  1HNW Q;  1QVF A;  2QA4 A;  4P73 A;  4JI7 L;  3P5J B;  4DR3 L;  4JI6 L;  1FGU A;  2Q51 A;  4B3M L;  2M6N A;  1QZG A;  3S15 H;  2F4V Q;  4EWC A;  5M5Y H;  3GTL H;  1VQG A;  1G51 A;  4HIK A;  4LFB Q;  3HOZ G;  2K50 A;  1VQ6 Z;  3CCR A;  3HKZ A;  2JEB I;  3GTM S;  1USP B;  4JYA L;  3K7U C;  2QRC B;  1NTG A;  1SR3 A;  4DK6 C;  1D8L A;  4JI8 L;  1GD7 A;  1VQO 1;  1N9W A;  2WFW A;  2VW9 A;  3FKI H;  2VS1 A;  3PO2 I;  4GLX A;  1LM0 A;  4EX5 A;  1VQH A;  4LFA L;  1W2B A;  4RMF A;  1M90 1;  1HNZ Q;  4X65 L;  3GTO I;  2Z6K A;  3PUY A;  2JA7 H;  2OTL 1;  3KJO A;  3CW2 C;  2QEX Z;  1PV4 A;  5T64 A;  1VQK A;  1QVF Z;  1X3Z A;  2ZTE A;  2R7D A;  2VY3 A;  4NBD A;  4A3E G;  1V43 A;  2F52 A;  1RO0 A;  4JBM A;  2VF1 A;  1V1Q A;  1YZ6 A;  1JT8 A;  1KXL A;  4IPC A;  3HOU G;  1HNX Q;  4AIM A;  3M3Y H;  2UXD L;  5C3E I;  1I6H I;  1Y1W G;  3D0F A;  3OW2 Z;  3ESW A;  5IP7 I;  3H15 A;  1I50 H;  1WCM I;  3LUS A;  2OTJ Z;  3F3F C;  1KAW A;  5JJI A;  4BY1 G;  1KQS A;  3KFU A;  1WYD A;  3EBE A;  2XTI A;  3UE1 A;  1YJN A;  3G71 A;  2UU9 L;  4LF9 Q;  4X65 Q;  4RV9 A;  5C44 I;  2JA6 H;  5A2Q b;  2JA7 I;  1VCI A;  1XTD A;  4DR6 Q;  3S14 H;  1Z02 A;  1NJI 2;  1Q82 1;  1S40 A;  2K3R A;  1VQ4 1;  3EED A;  3MEF A;  4JV5 Q;  1YJ9 A;  3CMA 1;  4A3M G;  1GM5 A;  3CC7 A;  2CWA A;  5D1P A;  3RZO H;  1YI2 Z;  4S1T A;  4MNO A;  3CCL 1;  2E8G A;  2BH8 A;  2BA1 A;  2PNH A;  3JAM b;  4LUV A;  4E2X A;  1WOC A;  2UXD Q;  4UY8 C;  2VQE Q;  3NH5 A;  2AWO A;  1K0R A;  2MNA A;  2CCZ A;  4UPA A;  2IHE A;  2PMZ A;  3CME A;  2F4V L;  2Y0S G;  4A3K I;  4QQB X;  2RHB A;  2NVT I;  1UE7 A;  2AMC B;  3GTM H;  4A93 I;  1KD1 1;  4GLA C;  4LUO A;  1QVG Y;  2UUA L;  1VQN Z;  1JJ2 Z;  1B70 B;  1YHA A;  3CD6 A;  1RIP A;  4BXX H;  3HOY H;  4A3L G;  2F4O A;  3T1Y L;  4QJF A;  2DGY A;  1XNR Q;  3E0E A;  5IT9 f;  1HNZ L;  3PO3 G;  4BA1 I;  4HGY A;  1YHQ Z;  2HHH Q;  5GAD C;  1PH7 A;  1L0W A;  4DR5 L;  3NBH B;  1G6P A;  3VB9 A;  2RBL A;  4NFR A;  1X3G A;  4DV4 Q;  4E30 A;  3L7Z C;  5M5X H;  1A63 A;  3VTN A;  1N36 L;  4C3I H;  5HY6 A;  2LXJ A;  4R4O A;  1MKH A;  3CME Z;  3GTJ H;  4YCU A;  2I5L X;  3LGJ A;  5LL6 f;  4JI5 L;  2K5H A;  3HOW G;  3W5O A;  4A3L H;  4AH6 A;  3CXC Z;  3CCU A;  2MO0 A;  3I56 A;  5FLX b;  1FVI A;  4PMW A;  1XPU A;  4DR1 Q;  5IE8 A;  3OYY A;  1M1K 1;  3J80 c;  3GTO H;  2Y0S E;  3GTK H;  5T67 A;  3CAM A;  4RVF A;  2ZM6 Q;  4A3F I;  4BA2 I;  1Q81 C;  1VQP 1;  1YNX A;  4KHP Q;  4NBG A;  5GAE C;  4JI0 L;  2E9H A;  1HNW L;  2DE6 A;  2K5R A;  4JI4 L;  3KF6 A;  2ZAE B;  3M4O I;  1YHQ 1;  3PSI A;  1U0L A;  2OTL Z;  2CWP A;  1YUA A;  2YU9 I;  2M48 A;  4CL1 A;  3HOV H;  1EQR A;  2QRD B;  5C4X I;  4YY3 Q;  3CCR 1;  3CCV 1;  4YHH Q;  5BR8 Q;  4PG3 A;  2HU9 A;  1TWA I;  1RO2 A;  4JBW A;  4GKK L;  1VQP Z;  3I4M I;  3NEL A;  5J3B A;  3CCQ Z;  1K83 H;  4YCV A;  1KL9 A;  2KHI A;  2JA6 I;  3GTK I;  1KRS A;  5IT9 b;  1KHI A;  4LF6 Q;  3GTL I;  2AKW B;  1IBM Q;  4KHP L;  2WP8 J;  1KC8 C;  4HID A;  3I56 1;  2ZJR A;  4A3G G;  5M3M G;  3ULJ A;  4K0K L;  1JJC B;  2JA8 G;  4HH4 A;  3G71 1;  2QLV B;  3F8T A;  4LFC L;  1E24 A;  2KI7 B;  3STB D;  3CCM A;  4RVD A;  3PGZ A;  2IZ3 A;  1TWC H;  3KF8 B;  4XIG S;  1YUK A;  3J81 f;  2V8K A;  4GN5 A;  2YTY A;  1JMC A;  1QYP A;  3ICE A;  4L5S A;  4MON A;  3U4Z A;  1I3Q I;  5M3F H;  4DUY L;  2WB1 G;  3BZK A;  4A3K H;  1L1O A;  3CCL A;  1AE3 A;  4A93 H;  4BXX I;  3MZL B;  3HOY I;  3VMI A;  3CCR Z;  1VQ6 A;  1YJN Z;  4WJ4 A;  2E2H H;  1X55 A;  1YBY A;  5C44 G;  1QVF Y;  4B3R L;  1KC8 1;  2JA7 G;  3OTO L;  1YJN 1;  4JI4 Q;  3HOX I;  3FP9 A;  3BU2 A;  5GAG C;  3OW2 A;  2PMZ E;  4UP7 A;  4JI0 Q;  1Q8K A;  4A3M I;  3GCF A;  1TWC I;  3BG0 B;  1FJG Q;  1J5E L;  2DE7 A;  1K73 C;  1I6H H;  1CKM A;  1BVS A;  3J81 j;  3GTJ I;  1MJC A;  2R92 G;  1Q46 A;  1WI5 A;  3ULL A;  1I3Q H;  1VQF A;  4AYB A;  1VQK Z;  5IYD H;  4NBE A;  1YVC A;  1VQ8 1;  1KIX A;  1CKO A;  3CC4 A;  1RO4 A;  4DAM A;  2MFI A;  3CCL Z;  4A3J H;  3PCO B;  1TWG I;  4A3G H;  4A93 G;  1JB7 A;  1VLA A;  3ZJY C;  5C0X I;  4DV4 L;  4OO1 G;  4LF4 Q;  1Q81 2;  3JAM c;  2MO1 A;  2R7Z I;  4DR5 Q;  1RQF A;  4DKA C;  3I4N I;  1C0A A;  1K9M 2;  1VQ5 A;  3CD6 1;  1LTL A;  1Q12 A;  3EIV A;  1P9N A;  3KIF A;  2NVX H;  2VUG A;  1K73 1;  2K5V A;  3J7A 5;  5IYC H;  1X0T A;  3HOV I;  1SN8 A;  2OTL A;  3J7Z C;  2UUA Q;  2DE5 A;  3IRB A;  3GTM I;  2PM9 A;  3PO3 H;  1TWA H;  3S1N H;  4B3S L;  3HOW I;  4GNX B;  3AEV A;  1GVP A;  3NH4 A;  2RT9 A;  2I0Q A;  1PH3 A;  3PUW A;  4DUZ Q;  2Q2T A;  1VQ8 Z;  1RNI A;  2P28 A;  3GTP I;  1Z01 A;  4Y7N H;  3I4N H;  3G4S Z;  3S24 A;  1Q82 C;  1HZB A;  1P16 A;  4A3F G;  3CC2 1;  4NH1 C;  4MTN A;  4Y52 I;  4BBS H;  4GS3 A;  4GN4 B;  1Y1V H;  1YJW 1;  1S3O A;  2GVA A;  2HF1 A;  2FXQ A;  3EN2 A;  2OOY B;  3CMA A;  4A3D H;  2UU9 Q;  4X64 Q;  2KEN A;  4A3B G;  2PQA B;  1QF8 A;  2BH2 A;  1X6O A;  4C3H H;  3K8A A;  3K7A I;  2NVY I;  1NUI A;  3BG1 B;  2EIF A;  5E7N A;  2D0O A;  3S15 I;  3CCE A;  2WB1 A;  4A3E H;  1HNX L;  1Y1V S;  3S2D I;  1JWH C;  4UP8 A;  1VQM A;  3J80 f;  2JA6 G;  1E1T A;  3BZC A;  4MD8 A;  4MD9 A;  4JI2 Q;  3AQQ A;  3CPW Y;  4B3M Q;  3G6E Z;  1N33 Q;  3H3V H;  4IOC A;  4JI6 Q;  3U4V A;  3MZK B;  3CP0 A;  3PF4 A;  2IHF A;  4DR3 Q;  2B3G A;  2D0P A;  4A3M H;  1WFQ A;  3T1H L;  2B63 G;  3RLF A;  4HJ7 A;  1EOV A;  1NP6 A;  5IP9 G;  3FKI I;  2AHO B;  1PA6 A;  1PH9 A;  5AJ3 L;  1X65 A;  1Z03 A;  3M7N A;  3VMH A;  4HGZ A;  1AE2 A;  4IPD A;  5A2Q f;  1NBW A;  4A3J I;  4IO9 A;  4BY7 I;  3KOJ A;  1OXT A;  3S2D H;  1H95 A;  4JI8 Q;  3FHW A;  3BJU A;  3A74 A;  5M5W H;  3CCM Z;  4DR2 Q;  1I5F A;  4A3I H;  2R7Z H;  2OTJ A;  3A5U A;  4XTC S;  4JOI A;  2N8N A;  4MD7 A;  1X3E A;  4R4T A;  4LF5 L;  3M3Y I;  1YI2 A;  3PF5 A;  5C0X J;  2R93 H;  5IP7 H;  1VQ7 1;  3HOX G;  2Q4Z A;  4A3B H;  4X62 Q;  4P72 A;  1N8R 2;  1J5E Q;  3OW2 Y;  2R6G A;  4DV1 Q;  4KI0 A;  2LIY A;  2RPR A;  1ASZ A;  2PI2 E;  4NBC A;  2R92 I;  2QEX A;  1VQB A;  1N32 L;  4X6A H;  1WII A;  3MXN B;  3S14 I;  1J6Q A;  2KCM A;  4GOP C;  2RF4 A;  4GKK Q;  2VNU D;  2E2H I;  2KHJ A;  5IT9 c;  4DGL A;  4KLK A;  4C3J H;  1VQL Z;  1GO3 E;  4PZ7 A;  4R4Q A;  2OQK A;  3HOX H;  1L1O C;  3MON A;  4Y7N I;  1CKN A;  4YWL A;  3IF8 A;  4DV5 L;  4HJA A;  1KD1 2;  4QGU A;  5C0X G;  2WAQ A;  3PO2 G;  2R93 I;  2V8I A;  2R7Z G;  2ZJP A;  3CCE Z;  3I4N G;  3STB C;  2GU2 A;  1HR0 L;  4MZ9 A;  3PO3 S;  5M3F G;  1N8R 1;  3HFZ B;  1Y1V I;  3PUZ A;  1VQ7 Z;  4DV1 L;  1KRT A;  1VQE A;  4P75 A;  1OTC A;  4R4C A;  4NXM L;  4NBB A;  4DPG A;  1KD1 C;  2R92 H;  4JBK A;  1VQC A;  3HOV G;  1NMG A;  4TQU S;  5JEA J;  3K7A H;  1PH1 A;  2O4H A;  1IBM L;  1Q1B A;  3E9I A;  3S16 H;  4E2Y A;  4A3E I;  2YTX A;  2LFU A;  1XMO L;  3I7F A;  4XX2 A;  1IBL L;  1VQO Z;  2NN6 I;  4WJ3 M;  1ML8 A;  1C9O A;  3CF5 A;  1NJI C;  1I94 L;  1Y1W I;  3M9B A;  5D1O B;  1VQ8 A;  1WCM G;  4RS4 A;  3IFU A;  2VUM H;  5T6B A;  1X54 A;  5GRO A;  2N78 A;  2IY5 B;  4IFD J;  1XNQ L;  1VQ6 1;  5AJ3 Q;  2WB1 E;  4JG2 A;  3F2B A;  1TWH H;  1TFI A;  1VQJ A;  4OWW B;  4JCV E;  3CD6 Z;  4DAY B;  5IYC G;  1EYG A;  3HOW H;  4E2W A;  3CCJ A;  3WWV A;  4LF7 L;  3KF6 B;  3PUX A;  4A76 A;  2OOX B;  3HKZ E;  1OXV A;  2ZM6 L;  3GO5 A;  1UWV A;  1Q7Y 1;  4BY7 H;  1VQ5 Z;  3L2P A;  2N49 A;  3M4O H;  3CCV Z;  1PFS A;  1YIT A;  2UXC Q;  1YIJ Z;  2JEA I;  3CC7 Z;  4Y52 H;  2BA0 A;  4ALP A;  4JI5 Q;  2R6M A;  2I5H A;  1EFW A;  3I56 Z;  4AYB G;  1K8A C;  1VQK 1;  5C4X H;  4X64 L;  4A3D I;  1LYL A;  2JA9 A;  1DGS A;  3CC4 Z;  2YV5 A;  1V9P A;  3L0O A;  3H0G G;  3J80 b;  2VZA A;  2OTJ 1;  3CCJ Z;  3FQM A;  4DR6 L;  2NVY H;  1K83 I;  3FKI G;  3G4S A;  3D6W A;  4JI3 L;  1SRU A;  4LF9 L;  3TDH B;  2RHQ B;  1X9N A;  4HIO A;  3CCV A;  3KYH C;  4ME3 A;  2JUB A;  4FDB A;  1SE8 A;  2KBN A;  2E2I H;  2EGT A;  1N33 L;  2A1A A;  4BY7 G;  2IZ4 A;  2JA5 G;  1BBW A;  1OXU A;  3H3V I;  2H5X A;  4NBA A;  2C35 B;  2HIX A;  5FLM H;  3HOU H;  1N2F A;  5ELO A;  1QZH A;  1JJ2 A;  2PQA A;  2E2J H;  3GTQ I;  2PI2 A;  3CPF A;  2EQS A;  1C7Y A;  4B3S Q;  5IYB G;  3HOZ H;  3RLO A;  1VQ4 A;  2YTV A;  1HJP A;  5ELN A;  1X3W A;  2K14 A;  1PH8 A;  1NMF A;  1K8A 1;  1EQQ A;  3NDJ A;  3J81 i;  4H02 A;  1YIT 1;  3RLN A;  4GNX C;  1K9M 1;  2BJO A;  2JMO A;  4X66 Q;  1Q86 1;  2A8V A;  1XPR A;  3IX0 A;  2JQO A;  3DLL A;  1SMX A;  3S2H I;  1PVO A;  2B29 A;  1VQ7 A;  4LFA Q;  5FLM G;  1A0I A;  1OXS C;  4OXP A;  4DV6 L;  4A3I I;  3CXC A;  4X66 L;  4E2Z A;  4E31 A;  4HJ5 A;  1Q1E A;  2QGQ A;  3KJP A;  2I3C A;  2B63 H;  5FJ8 H;  2OZK A;  4DK1 A;  3GTQ H;  4IPH A;  5LMU L;  3GDE A;  4APV A;  3HOZ I;  3G71 Z;  2JA5 H;  2VUM I;  4BBR I;  3Q8D A;  3AFP A;  1O7I A;  2VQF Q;  4NB8 A;  4A4I A;  1VQP A;  1TWH I;  3I55 1;  1CKN B;  4QTT A;  3H3V J;  2QA4 Z;  2NVQ H;  4DR4 Q;  3ERS X;  1K9M C;  4X6A I;  4YWM A;  1M1K 2;  1FJG L;  3GD7 A;  4A3G I;  4JI7 Q;  4LNQ A;  3S1M I;  5JJK A;  3K81 C;  2UXB Q;  3RN5 A;  1Z9F A;  4B3R Q;  3NH8 A;  5LMN Q;  3GKQ A;  4DR7 Q;  2JR6 A;  5IYB H;  4IJH A;  2K52 A;  2D62 A;  1KQS Y;  4DQY B;  2XGT A;  3F1Z A;  1PH5 A;  2ES2 A;  3DM3 A;  1UE5 A;  3M85 A;  1R9T H;  3PIO A;  4GNX A;  1I94 Q;  4R4I A;  1SRO A;  4MH4 A;  5H1S E;  1NJI 1;  4GOP A;  2YYZ A;  1IBL Q;  1SFO I;  3CCS 1;  4BXX G;  3S1N I;  3CC7 1;  4QY7 A;  4HJ8 A;  4DV3 Q;  3T4N B;  1A62 A;  4HIM A;  5C3E G;  3CCS Z;  3QWU A;  2G2K A;  2UUB L;  1ASY A;  1N34 L;  4OWX B;  1P8L A;  4POF A;  3TQY A;  1PYS B;  3J81 b;  3I55 A;  2J6A A;  3GTP H;  3VMG A;  1LQL A;  2E2I I;  3JC6 6;  1Y1W H;  1L2F A;  1XJV A;  1E1O A;  3B6Y A;  1IBK Q;  4L5R C;  2F3I A;  4DV7 Q;  2GVB A;  1QVG Z;  4DV2 L;  4BBS I;  1T9H A;  2LXK A;  4LUZ A;  4DV0 Q;  4E33 A;  2VL6 A;  1WW9 A;  4NXN L;  2E5L L;  3AFQ A;  1QVC A;  1USP A;  2E5L Q;  3FQQ A;  2W03 A;  1S72 1;  4DUY Q;  4EQ5 A;  3CCM 1;  2ZJQ A;  2GN5 A;  4A3C I;  4OO1 I;  1QUQ A;  1M90 C;  3S2H H;  4NBH A;  1IBK L;  3H0G I;  5D1O A;  1YJW A;  5C4J H;  1OXX K;  5FLX c;  1YIJ A;  4L5Q A;  3NFZ A;  3I4O A;  4LFC Q;  4A75 A;  1WJJ A;  4LW1 A;  1BBU A;  1VQM Z;  4MXU A;  2WAQ G;  3UE0 A;  3K0X A;  3S1R I;  3TEH B;  4NXM Q;  1IYJ B;  1JE5 A;  4RVG A;  3G4S 1;  1HZA A;  3PUV A;  1EIY B;  3JAM i;  2L15 A;  1TWF I;  1M90 2;  3CCJ 1;  1X56 A;  2PK7 A;  1N34 Q;  2UUB Q;  2JA5 I;  4BBR H;  4LF6 L;  3J81 c;  1HR0 Q;  1CUK A;  2CKZ B;  4DV3 L;  4IJL A;  5IWA L;  4KHZ A;  5FJ8 G;  4LF8 L;  2LSS A;  3RNU A;  4JC0 A;  3NEM A;  4YHH L;  3UDX A;  1B7Y B;  3CPW A;  3NDI A;  4YY3 L;  1N36 Q;  1VQ9 A;  5DLQ E;  1X3F A;  1EUJ A;  4NXN Q;  2ID0 A;  3CCQ 1;  3S1M H;  1Q82 2;  1HZ9 A;  5C44 H;  2JNY A;  1HZC A;  2UUC Q;  5EAY A;  1YEZ A;  2HHH L;  3NEN A;  1NE3 A;  1PH6 A;  2IX1 A;  4DV7 L;  3EER A;  2JE6 I;  1HR0 W;  3CQZ I;  2W04 A;  1CSQ A;  1VQN A;  1XNR L;  5FLX f;  1IL2 A;  1M1K C;  4GKJ L;  5FLM I;  5K36 G;  3I07 A;  3Q87 A;  1TWF H;  2E2J I;  1JJG A;  2NZO A;  2Z0S A;  4A3I G;  4X62 L;  1Q7Y 2;  4A3B I;  1VQ9 Z;  4DR4 L;  2MQH A;  1YIJ 1;  4QTU A;  2NZH A;  1HH2 P;  3ER0 A;  1G29 1;  4E32 A;  1K8A 2;  1ZH1 A;  2IT1 A;  1GKH A;  1LUZ A;  3TS2 A;  2VUM G;  3HKZ G;  4BBR G;  2RHS B;  4IFD I;  3UDF A;  4DK3 C;  3PIP A;  1E7Z A;  2VQE L;  1JJ2 Y;  2QR1 B;  4NPS A;  4PZ8 A;  4P71 A;  4PZ6 A;  2K5N A;  5C4X G;  4JOI C;  5LMU Q;  3S1Q I;  4NB9 A;  3CCU Z;  3SGI A;  3I4M G;  3KDF B;  2OWO A;  2V8J A;  2KCT A;  4O0A A;  4J15 A;  4JV5 L;  2B63 I;  2QEX 1;  1CSP A;  4DR7 L;  2Q2I A;  5LMN L;  3M4P A;  1KQS Z;  3RN2 A;  2N3S A;  4BY1 H;  3RZD I;  1PYB A;  2QKD A;  5IYD G;  3T1Y Q;  2JA8 I;  1UE6 A;  3T1H Q;  2RIQ A;  2I5M X;  2GTI A;  2Y0S A;  3CXC Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...