1L1OC

Structure of the human replication protein a (rpa) trimerization core
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
178
structure length
173
Chain Sequence
b'NTNWKTLYEVKSENLGQGDKPDYFSSVATVVYLRKENCMYQACPTQDCNKKVIDQQNGLYRCEKCDTEFPNFKYRMILSVNIADFQENQWVTCFQESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFRSFIFRVRVKVETYIKATVMDVKPVDYREYGRRLVMSIRRSALM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Replication protein A 14 kDa subunit
publication title Structure of the RPA trimerization core and its role in the multistep DNA-binding mechanism of RPA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 39
structure length 173
sequence length 178
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08646 Rep_fac-A_C Replication factor-A C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1l1oC02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1l1oC01
1PHJA 4YWLA 4JBWA 4OWTB 1VQOA 4LF6Q 2E2IH 2WAQG 1B70B 1PH4A 1J5EL 1USPA 2A1AA 4NBGA 4B3TQ 1AH9A 3B6YA 3KF6A 4KHPQ 2JA5I 1TWCH 5C3EI 4DR6Q 1PFSA 4PZ6A 4A3MG 5IP7G 2IHFA 1WCMI 3A5ZB 4NXMQ 4LF7Q 1J6QA 2VNUD 4UPAA 3CCEA 1N34L 4IPCA 4A76A 1Y1WG 1NE3A 4HIDA 1VQHA 1R9TI 3S15I 3PUVA 3RLOA 3HOXH 3HOZG 1VQKA 2I5LX 1K83I 5C0XJ 4UP9A 1SROA 4A3MH 5IP7H 3FP9A 3VDYA 1GKHA 3E0EA 1VQPA 3D6WA 3F2BA 4A3BG 3GTMH 4A3LG 1Y14B 1Y1WH 1CKNA 2ZTDA 2UUAL 4L5RC 3S2DH 1VQBA 5IE8A 4A93G 2ATWA 2D0PA 4JI4L 1E22A 3CC4A 2IX1A 2R92G 3HOZH 1IBLQ 1EYGA 3GTOH 4NBHA 2ASBA 4QTTA 3PO3G 4DV4L 4POFA 1G6PA 1VCIA 1X3GA 3CPWA 4NBEA 4QGUA 2ZTEA 2R93H 4YY3L 4B3ML 1YEZA 3RZDH 3D0FA 1BVSA 1I50H 4A3KG 4QIWE 2R92H 3L0OA 5FLMH 5C0XI 3M7NA 5C4JI 2MFIA 1CKMA 2ZJQA 3PO3H 3U4VA 1VQ7A 4K0KL 3RNUA 3RLFA 4WJ3M 2UXDL 4MH4A 1E3PA 4QL5A 3CC7A 4FDBA 2DE7A 3S16H 5AJ3L 4KI0A 4DKAC 3BU2A 4DR5L 4TVAB 4B3SL 3TEHB 3KDFA 1HNWQ 3I4MG 3M3YH 4L5SA 3VMHA 1M1KC 3CP0A 3CF5A 2E5LQ 2CKZB 4DNIA 4A3GI 5FLXc 4JOIC 3VB9A 1GVPA 3ULLA 4HIMA 1C0AA 2OTLA 1VQCA 1VQIA 4AYBG 2R6GA 1PH7A 4IPHA 1D8LA 1JMCA 4B3TL 4MNOA 3PGZA 2QA4A 1ZB8A 3GTLH 4QTUA 5LMUQ 4DR6L 1NMFA 4GS3A 2JA5G 4GLAC 5C3EG 1SRUA 1WCMG 3EBEA 4IFDJ 1HZCA 1VQAA 1QVGA 3GDEA 4JI0L 1WJJA 3ER0A 2DE6A 3PIOA 4R4CA 2N49A 2UUBQ 1GD7A 1X3FA 1OXVA 2JA5H 5C3EH 5BR8L 1XJVA 3K81C 3K7AI 3RR5A 5GAEC 1WCMH 2K5VA 1V43A 2K14A 2ES2A 5C44I 1IL2A 2Y0SE 4GNXC 1HJPA 2OTJA 3GD7A 1LQLA 1R9TH 1HNZQ 4JI2Q 3I2ZA 4LFAQ 1NJIC 1YZ6A 4P75A 3J80i 4LWCA 4IFDI 1U5KA 4DR2Q 1X3WA 3UDIA 4KHZA 3KF6B 4A3JH 5M3MG 1YNXA 2WB1G 1S3OA 4LF8L 4GN4B 4LFBL 5C0XG 4GN5A 2E2II 1T9HA 1V1QA 1LTLA 1NY4A 1Q86C 1SE8A 3G6EA 1QUQA 3MEFA 4BY7I 1NBWA 2R7FA 3Q87A 4GOPB 5JJKA 1ZB9A 3UE1A 3CW2C 4DUYL 4HJ9A 3HFZB 1SLJA 3CCRA 2HF1A 1YUAA 1VQ6A 2RHSB 1RIPA 2CCZA 5IWAL 3AQQA 1XTDA 1CUKA 1WW9A 1KXLA 2KCTA 2F4VQ 4A3GG 1HZ9A 4YWKA 1XNRQ 1OXTA 1QZHA 3HOXI 1WFQA 4OONA 3CD6A 4JI5L 3GTMI 2LSSA 4JV5Q 2UUCL 1E1TA 1PH6A 4BBRI 1Y1WI 3S2DI 2HHHL 3J81j 1K8AC 4A3EI 5IT9c 1XPUA 1FGUA 5LMUL 4NBAA 2B29A 4ME3A 3S2HH 1TWAI 3ULJA 3D31A 2KCMA 1ASZA 1HH2P 2QEXA 1JJ2A 3FKII 2K4KA 2R93I 1PH3A 3S1NH 4PZ8A 3ULPA 1I50I 3KF8B 1RO4A 1MKHA 5FLMI 2JJQA 4AQYQ 1IZ6A 2N78A 1Q7YC 3DLLA 3RN5A 2NVQH 5C44G 1N2FA 5ELNA 3SGIA 1VQMA 1HZBA 3K7UC 1YJWA 4LFAL 4NBCA 4OWWB 1S72A 4YCUA 3I7FA 3I56A 3NBHB 2Z6KC 3DM3A 5JEAJ 2Q2UA 4DR2L 3RZOH 4IFDG 3LUSA 4YHHQ 5LMNQ 4LFCQ 1XNQQ 4HJAA 3PSIA 4UP7A 4DV7L 3T1HQ 3PV0A 2BA0A 2VS1A 1N32L 3BJUA 1KHIA 2P3YA 3TS2A 1H95A 1VQLA 2UXCL 1K0RA 2B63H 2R7DA 2NZOA 3CCJA 4BY7G 4JI6Q 5H1SE 3GTLI 5E7NA 1XMQL 1QVCA 4JI8Q 2VQFQ 1TFIA 1Q82C 4LF4Q 1RLYA 5GAGC 4GOPC 3LGJA 3CCLA 1PH2A 2RBLA 3I4NI 1FVIA 4BY7H 5GAHC 1XNRL 3NENA 3KJOA 4A75A 1FJGL 2AKLA 4OX9L 1K9MC 1UE1A 3HOXG 4A3CI 1BKBA 4C3JH 1SFOI 4QY7A 4DV0L 4IOAA 4JV5L 4HJ7A 4HJ8A 1PH1A 3ICEA 4X64L 3EERA 4BBRG 2DE5A 2ID0A 3G4SA 4DR3Q 1YJ9A 4A3EG 1YI2A 1TWGI 4GNXB 1A8VA 5JJIA 2WFWA 1YIJA 2OWOA 1YJNA 4BBSH 3UDFA 2UU9L 4A3JI 3FKIG 4BBRH 2BH8A 1K73C 2R93G 2IX0A 5HY6A 4A3EH 4DR1L 5FLMG 4Y7NH 2H5XA 4NBBA 3ESWA 1TWAH 3GTGI 2VZAA 4HJ5A 4TQUS 3FKIH 2A8VA 1FL0A 4XX2A 4X62Q 3T1YL 1PVOA 1NUIA 4IJHA 1C7YA 2GVAA 3GTQH 3G71A 2R7ZI 1K8GA 2JK8A 1KC8C 4H02A 4GLXA 3CCVA 3F1ZA 2YU9I 4L5QA 1X9NA 4JYAQ 3GKQA 5LMNL 4LFCL 4YHHL 3UDXA 5EAYA 1XNQL 4UP8A 4LW1A 3S1RH 2MQHA 4C2MH 4KLKA 4X6AH 4DR7Q 4LUOA 1HR0W 1TWHH 1X3ZA 5M5YH 2JA9A 5HGQA 1P8LA 4Y52I 2AHOB 1A0IA 1PA6A 4JI3Q 3S2HI 2BH2A 1IYJB 4LF6L 2PNHA 5JEAG 1Y1VS 4B3RQ 1MJEA 4C3HH 2MNAA 3BZCA 1N33Q 1X56A 2EXDA 1JJGA 3GTJH 3STBC 4P73A 3S1NI 2Q2TA 3I4NG 4KHPL 2PI2A 2NVXI 3G48A 2NVTI 3W5OA 4NXML 3S17I 3UDGA 4LF7L 4A3CG 2UXBQ 1I94Q 3M4OI 2MO1A 2NVQI 1HZAA 1VQEA 1CKOA 3OTOQ 1LM0A 2I0QA 3I4NH 4DR3L 1OXUA 4JBKA 2Q2HA 1RL2A 3AYHB 2VQEQ 1VQ9A 4DV2Q 5GADC 1N9WA 4DPGA 1AE2A 1E1OA 4DV3Q 4A3CH 1SFOH 1E7ZA 3RZOI 4DK3C 1KAWA 2VUMH 1L0WA 4JG2A 4A3JG 4NXNQ 3CCMA 2IT1A 1HNXQ 1IBLL 1VQNA 3PUXA 1LYLA 1TWGH 3CC2A 1EIYB 4R4IA 4LUZA 4C3IH 1USPB 2B63I 2PQAA 4NBFA 4X62L 2DGYA 2LXKA 3STBD 3F2DA 1DL6A 2YTYA 1UE7A 3HOUI 4X65Q 4UY8C 4DR4Q 3RLNA 4JC0A 1L1OA 2R7ZG 1VS0A 4MZ9A 2YTVA 3GTGH 3I07A 4JYAL 1VLAA 2K52A 3CMEA 3E9HA 4P72A 2NVYH 3CPFA 3PF4A 1E24A 1HNWL 3TREA 4O0AA 3GTKH 3HKZG 2R7ZH 1N36Q 2E5LL 1YBYA 4DR7L 2RHQB 1CKNB 2YU9H 1CSQA 3I55A 5M3FG 1HR0Q 1Q46A 3FHWA 5IP9I 1QZGA 2Z0SA 4XIGS 1BBWA 1G51A 4APVA 2CQOA 1ML8A 3CXCA 2I5HA 5FJ8G 2CWPA 3TRZA 1J5EQ 1ASYA 4MTNA 2KBNA 5J3BA 3KJPA 3GTPH 4DV6Q 4BBSI 4L5TA 1N33L 1IBKQ 5M3FH 2F4MA 3AEVA 1B7YB 2EIFA 1I3QI 3J7A5 1KRTA 1W2BA 4Y7NI 4Y52H 5FJ8H 1N34Q 1YVCA 2UXBL 2KPIA 4PMWA 3OTOL 1JJCB 1AE3A 3PO2H 5CM2M 1XPOA 3K0XA 2F52A 2UUBL 3KDFB 2NVXH 3GTQI 3JC66 1UEBA 4YCWA 1UWVA 2PI2E 2NVTH 2EQSA 1Q1BA 3OW2A 3S17H 4BY1I 2XGTA 3M4OH 4JI4Q 2K5NA 1PYBA 1PH8A 1X65A 4YCVA 1HNZL 4JI2L 1IBMQ 4A3DI 3S1RI 2WP8J 4RG1A 1VQ8A 4BXXI 1PH5A 4GKJQ 4X6AI 1YHBA 4YY3Q 4HIOA 1EQQA 4GN3B 1TWHI 3F2CA 3KFUA 2B63G 2WAQE 1D7QA 2I5MX 3GTMS 3Q8DA 4K0KQ 3HOUG 2RCNA 4DR4L 4LNQA 1EFWA 2ALYB 3CCSA 4DV5Q 2JA6H 2NZHA 2D0OA 1A63A 3GTJI 4EX5A 4GKKQ 2JNYA 4DR5Q 4LF9Q 1PFTA 3HOYH 1Z47A 2JE6I 1GM5A 3HOUH 3WWVA 2VY3A 2JA8I 2E2HI 4PG3A 2VW9A 2HQLA 4J15A 3PO3S 2Z6KA 2F4VL 3GCFA 3NEMA 3PUYA 1CSPA 4WJ4A 2OQKA 1Q81C 5IP9G 2ZM6Q 3H0GI 4A3FI 1TXYA 1YITA 4DAYB 3U50C 1KD1C 3EN2A 2IY5B 4DV6L 2PQAB 1IBKL 2VUMI 3KOJA 3ERSX 4BBSG 2KENA 4P71A 4JBMA 4JCVE 1EOVA 5IP9H 2ZJRA 2N8NA 4POGA 4AH6A 1L1OB 1DGSA 5GROA 2K5HA 2CWAA 1QUQB 4JI0Q 4IPGA 3GO5A 2PMZE 2ZTCA 4GOPA 3CAMA 4IOCA 1I3QH 1Z9FA 5BR8Q 4AQYL 2DUDA 2OQ0A 2BJOA 1QYPA 1X6OA 4R1JA 2MO0A 1XMOQ 3CCQA 3W1BA 5ELOA 4BY1G 1Y1VI 3U58A 2Q2IA 1VQGA 2NVYI 1YHQA 2N3SA 3S1MH 2ZJPA 1IBML 4LF5Q 4A3BH 3GTKI 1M90C 1C9OA 5DLQE 3S14H 4GKJL 4OO1I 4A3DG 5IY0A 4A3LH 2JA7I 4BXXG 2AKWB 4A93H 2XTIA 1YHAA 2HIXA 4BY1H 3TQYA 4AYBE 4LF8Q 1UE5A 3VMGA 4LFBQ 1K3RA 3T1HL 4X66Q 1I5FA 3K80C 4A3DH 5K36G 1P16A 1Q8KA 4BXXH 1Q1EA 4DV5L 3AFQA 1JE5A 3GTPI 1SR3A 4A3KH 1I6HH 4GKKL 2RF4A 2NN6I 4LF9L 3ZJYC 5IYDG 1IXRA 4JI6L 5IYBG 4DUYQ 1W3SA 2JS4A 3JAMc 4EQ5A 4JI8L 5IWAQ 3S1QH 3A0JA 2VQFL 4LF4L 2JA8G 3HOWI 1QVFA 2CFMA 1PH9A 3CQZI 5IYDH 3PO2I 4NPSA 5IYBH 2J6AA 2F4OA 4NOZA 3I4OA 1XPRA 3I4MH 3H3VJ 2ZM6L 3M85A 4LUVA 1KL9A 4PZ7A 2PK7A 4JI5Q 3H0GG 1MIUA 4A3FG 2UUCQ 1A62A 1EWIA 2GVBA 2JA8H 2E2HH 3NELA 2KHJA 2HHHQ 3MXNB 1SN8A 1O7IA 2B3GA 4GLVB 2VUMG 3HOVI 3PCOB 4JI7Q 3J81i 3A74A 3UE0A 1BBUA 2YV5A 4JOIA 2HT1A 1TWFI 3VMIA 3H0GH 3PUWA 4OWXB 4A3FH 1OXSC 2WB1E 5C4XI 4O2DA 1PYSB 4OXPA 3M4PA 3AFPA 2OCEA 5JJLA 4JI1Q 4BA1I 2JEAI 1L1OC 3H3VI 2AWOA 2KHIA 4DV1Q 2A19A 2BA1A 1XMOL 1GO3E 2E2JI 2JA6I 1OXXK 3L2PA 2K50A 4A3II 1OTCA 1EIFA 3S15H 3HOYI 3HKZE 3HKSA 1Y1VG 2JR6A 2GN5A 1WI5A 1K83H 3M9BA 3CCUA 4DUZQ 4LF5L 5LMNW 4BA2I 4OO1G 4JBJA 1V9PA 4HIKA 2JA7G 3W1GA 1U0LA 2C35B 4AIMA 4NBDA 3PUZA 1Y1VH 4DV7Q 5M5WH 2Y0SG 1EQRA 4X66L 4GNXA 3H15A 1N32Q 2QGQA 1G291 3RN2A 2UXCQ 3EIVA 2JA7H 3S24A 1VQ4A 4NB8A 5M3MH 1NTGA 1N8RC 1PV4A 1TWCI 2NN6G 3A5UA 1XMQQ 2VL6A 4RMFA 3L7ZC 5C4JH 5M5XH 4JI3L 5IYCG 2E8GA 2L15A 3OYYA 3TS0A 2JQOA 1Q12A 1VQ5A 4B3RL 4IPDA 3HOWG 1LUZA 4R4OA 1L2FA 1FJGQ 4OX9Q 2LXJA 4A3MI 3PO2G 5IP7I 3CMAA 5IYCH 3E9IA 2YTXA 4DV0Q 3PIPA 3BZKA 4R4TA 4A3GH 1I94L 1EUJA 4X64Q 3K8AA 3HOWH 3CQZH 3HOZI 3U4ZA 3GTOI 3M4QA 4JI7L 3HOVG 2IHEA 3S1MI 1JT8A 4NB3A 4ALPA 3KLWA 2VQEL 4A3BI 4DV2L 3S14I 4A3LI 4NB9A 4DV3L 4A93I 2UU9Q 3RZDI 2AMCB 2UUAQ 5C4XG 5GQOA 2R92I 4JI1L 4DR1Q 1VQDA 3PF5A 3HOVH 1B8AA 3PO3I 4IJLA 1KIXA 4YWMA 4NXNL 1X55A 3KYHC 1KRSA 2V1CC 3J81c 4DV4Q 1HNXL 4DV1L 1X3EA 1TWFH 3J7ZC 4QJFA 1WOCA 4B3MQ 3S16I 4A3KI 5C4XH 1I6HI 2JA6G 2JEBI 4DAMA 4A3IG 1WYDA 1JB7A 3T1YQ 1X54A 1SMXA 1KQSA 3HOYG 4X65L 3JAMi 3H3VH 3M3YI 4DUZL 1S40A 2YYZA 3K7AH 3S1QI 2UXDQ 4A4IA 5C44H 2FXQA 2E2JH 4P74A 1VQJA 5AJ3Q 4A3IH 2HIVA 4B3SQ 3I4MI 1VQFA 4IO9A 4R4QA 3IRBA 2F3IA 2AWNA 2D62A 3J80c 1NMGA 1N36L 3F8TA 4QQBX 2K75A 4DK6C 1HR0L 1UE6A 2K5RA 4XTCS 1MJCA
chains in the Genus database with same CATH superfamily
2N88A 2V8IA 1PHJA 4RHRA 4YWLA 4IQZA 5D3DA 2QREB 1VQN1 3Q0AA 4JBWA 4OWTB 1VQOA 1WD1A 2E2IH 4LF6Q 2WAQG 5D14A 2L12A 3HOXB 1SE4A 3CC21 2PNRC 4XXEA 4G7ZC 2V4DA 1B70B 1EZ8A 1PH4A 1J5EL 1LLRD 1USPA 2A1AA 5CYUA 2WV6D 4IUTA 1HA5A 4NBGA 4B3TQ 1AH9A 1CQFA 3B6YA 3GTMB 3KF6A 4KHPQ 3TDHB 2V45A 2EOTA 1ZYRC 2EYOA 1Y1WB 3S2DB 2JA5I 2PZUA 1TWCH 5EPJA 5C3EI 4DR6Q 1KQSZ 1PFSA 4PZ6A 5IT9L 3VR6A 4A3MG 3R93A 2NBFA 2IHFA 4G4KA 5IP7G 1WCMI 3A5ZB 1IYUA 4NXMQ 3HOZB 5DAUA 2Y0SA 4LF7Q 2RT9A 1J6QA 2VNUD 4UPAA 3CCEA 1N34L 4IPCA 1M902 1YNJC 2ZM6L 1TWAB 2AQ1B 1IW7D 4A76A 5KYIA 1GHKA 1Y1WG 1NE3A 4HIDA 1ICWA 3CME1 1VQHA 3FKIB 1R9TI 3S15I 2R93B 3DWQA 3NUCA 3PUVA 4J8QA 1G91A 3RLOA 3HOXH 3RZDB 3HOZG 1VQKA 2I5LX 1K83I 2AUKA 4UP9A 5C0XJ 1I50B 1SROA 1ENFA 3QIAA 5IP7H 4A3MH 4QB4A 3FP9A 2R92B 3VDYA 1GKHA 3E0EA 2FJ2A 1VQPA 3TBIB 3D6WA 5IT9E 3F2BA 5A35A 3PO3B 4A3BG 3GTMH 1NJI1 4DK0A 2HDLA 2Z1CA 3Q6SA 2X69A 4MRIA 4A3LG 2VUGA 1Y14B 4U68A 1H9SB 5FO7B 1Y1WH 1CKNA 2ZTDA 2UUAL 4L5RC 1UEAB 1VQBA 5IE8A 3S2DH 4A93G 2ATWA 2CH4A 2D0PA 4JI4L 3I551 1EEFD 4KY6A 4JK1C 1RTOA 1E22A 3CC4A 2IX1A 2R92G 3HOZH 1TS4A 1IBLQ 1SYGA 1EYGA 1CK1A 3S16B 3GTOH 4NBHA 3CXCY 2ASBA 5EKKA 1STHA 4QTTA 1UUPA 3PO3G 5TSSA 4DV4L 2K01A 4POFA 1G6PA 1WVLA 3A54A 3R2IA 1VCIA 2PMZB 1X3GA 3CPWA 4NBEA 5I2YA 1RQFA 2ZTEA 4QGUA 4C2MB 2CVRA 2R93H 4YY3L 4B3ML 2LKVA 1YEZA 3M7GA 3RZDH 3D0FA 2XWBB 5I6WA 1BVSA 1I50H 4A3KG 4QIWE 1MI2A 2R92H 1Q861 1B3QA 4ZLTF 3L0OA 2RBMA 5J39A 5FLMH 2LIYA 5C0XI 1W2BY 5CV9A 3M7NA 5C4JI 2MFIA 1CKMA 1NCVA 2F0QA 2ZJQA 2HCIA 4KJNA 3PO3H 1FNUA 2Q51A 5KGUA 3U4VA 1VQ7A 4K0KL 3K59A 3RNUA 5IT9b 1HRJA 1B9NA 4NDXA 2EY2A 3RLFA 5C6AA 2UXDL 4WJ3M 2DJFC 1X3QA 4MH4A 3CCEZ 1E3PA 1NUCA 4QL5A 4ME5A 2EE1A 2O53A 1YNJD 3FPUB 1W6KA 2SDFA 4RCNA 4CKEA 4DFAA 1EFID 3CC7A 4FDBA 2DE7A 2WKDA 2CW0C 3S16H 2IV2X 5AJ3L 1FNVA 2OOYB 4KI0A 5JPNC 4DKAC 2KHSA 3BU2A 4DR5L 3J7YW 3VA7A 4TVAB 2F0LA 4JW0A 4B3SL 1W6JA 3TEHB 1VQKZ 1HFNA 3KDFA 1HNWQ 4O1NA 1SNMA 2H85A 3I4MG 3M3YH 4L5SA 1Z03A 3GTLB 3VMHA 4MD8A 1VQPZ 1L0XB 2RVLA 1A2TA 1M1KC 3CP0A 3OW2Y 3CF5A 1FR3A 5J22A 2E5LQ 1IKMA 2F0TA 2PW7A 2CKZB 4FVMA 5BN4A 4DNIA 4AYBB 4A3GI 4XT3B 3IFUA 5FLXc 3FMCA 4RH6A 3DMUA 4JOIC 3VB9A 1GVPA 1D1IA 3ULLA 1HFGA 4HIMA 1C0AA 4KY5A 4GZYC 2OTLA 4ZUJA 4EQPA 3I4NB 2K32A 2W03A 1SXTA 4X3UA 2KOLA 1VQCA 1VQIA 4AYBG 2N55A 1PRTC 2R6GA 1K8A1 1PH7A 5EPKA 5EKLA 3K5LA 1PDQA 3CPWZ 4I65A 5C3EB 5T1IA 4IPHA 1D8LA 2O4XA 1JMCA 4B3TL 4XQJA 4MNOA 3PGZA 2LEXA 2QA4A 3IR7A 3IF8A 4EGVA 1ZB8A 3BG3A 3EJIA 3C46A 3GTLH 1CQVA 1SNPA 1LABA 4QTUA 2F0OA 5LMUQ 4DR6L 1NMFA 2B2WC 4GS3A 2JA5G 3HG9A 4GLAC 1VQ7Z 1B3AA 5C3EG 1G2TA 1SJHD 1SRUA 5JEAH 1R9TB 5KNCA 4ZK9B 1V1PB 2F0JA 1WCMG 1A3VA 2NAPA 3CCS1 2JN4A 2K5QA 1HZCA 1VQAA 3EBEA 4IFDJ 4RS4A 4C3IB 1QVGA 2F0GA 3QB3A 3WOEA 1K28A 3CC7Z 3VTNA 3GDEA 4KMUC 4JI0L 1WJJA 1SJED 4E31A 3ER0A 4HCSA 2CW0D 2DE6A 3PIOA 1Q7Y1 4R4CA 2N49A 2UUBQ 1GD7A 1I6VC 1X3FA 1U4RA 2KVMA 4A3JB 1OXVA 3CU7A 2JA5H 1HXYD 3BG1B 5C3EH 5BR8L 1XJVA 3K81C 2HU9A 2WIIB 3K7AI 3IFDA 3NK9A 3RR5A 3NQTA 5GAEC 1WCMH 2K5VA 3J81f 1E2ZA 2J4XA 1V43A 2LMCB 2K14A 2ES2A 2I07B 4RAUC 1STNA 5C44I 3Q24A 2K6AA 1SNOA 2K1BA 2QKIC 1IL2A 2Y0SE 4GNXC 1XXGA 3RUZA 2F0IA 3OMGA 2QEJC 1CZWA 1Y69U 1II3A 4NKLA 1HJPA 5IGGA 2QRDB 1M4VA 2OTJA 3GD7A 2IL8A 1LQLA 1N8R2 5FOBB 1R9TH 1HNZQ 4JI2Q 2PYKA 2PO4A 2OTLZ 3I2ZA 4LFAQ 1YNNC 1NJIC 1RJTA 3A56A 1YZ6A 4P75A 3J80i 4DAYA 4LWCA 1YIT1 2Z4HA 4IFDI 1U5KA 4DR2Q 1X3WA 5A2QE 1WTHA 3NWSA 1A2UA 5F2DA 4I7ZC 3UDIA 2X6LA 5CORA 2R7ZB 4KHZA 3KF6B 4A3JH 4B9XA 1EQVA 2OZKA 5M3MG 2QA4Z 1YNXA 2WB1G 2SOBA 1S3OA 4LF8L 3D8GA 3HRZC 3A7AB 4GN4B 1K8OA 2A73B 1DONA 4LFBL 5C0XG 3LWEA 3I73A 4GN5A 2E2II 1T9HA 1V1QA 2E9HA 1IKLA 1LTLA 1NY4A 3GV6A 1Q86C 3UI2A 1SE8A 3J80f 3HKZB 1LTGD 3G6EA 1QUQA 3MEFA 2EYLA 4BY7I 1STAA 1QVGZ 1Z02A 4DGZA 1NBWA 2WINB 5COYA 4KJOA 4PMCA 5CBEE 2R7FA 1WTOA 3Q87A 1KDCA 2I3CA 4GOPB 5M3FB 1BO0A 4R8NA 5JJKA 1ZB9A 3UE1A 3CW2C 4DUYL 4HJ9A 5C0XH 3HFZB 1SLJA 3CCRA 2HF1A 1YUAA 5I9OA 1VQ6A 2IPKD 2RHSB 1ONLA 3BZDB 1VQP1 2D2CC 1RIPA 3HGBA 3T53B 4CKBA 2CCZA 2LS01 4MD9A 1LV9A 5IWAL 2L0CA 3AQQA 1KLGD 1Y8OB 3S2HB 1PYWD 1S5DD 1XTDA 1K9M1 1CUKA 1WW9A 1CA5A 4FYDA 1KXLA 2KCTA 5ISRA 2F4VQ 2DNEA 2AQ2B 4K14A 4A3GG 2RDFA 4NW2A 2VPXA 1HZ9A 2KEEA 4YWKA 1XNRQ 4U673 2VPZA 2OTJZ 1OXTA 2M00A 1TIID 1QZHA 3HOXI 1WFQA 3S1NB 1ILPA 5HGTA 1YNND 4E2XA 1YHQ1 4HEDA 1TS3A 1F2MA 4OONA 1BF4A 1TU2B 4K2LA 1O7LA 3CD6A 3MFGA 1EWCA 4JI5L 4E2YA 3GTMI 2LSSA 4JV5Q 2UUCL 1E1TA 1PH6A 3M4YA 1TS2A 4BBRI 4N8X1 4RA8A 1Y1WI 3S2DI 2P5ZX 3MXGA 3BG0B 5EQ0A 3J81j 4HCEA 2HHHL 3M4OB 1Q90A 1K8AC 2NVQB 4A3EI 5IT9c 2EJGC 1XPUA 1FGUA 5LMUL 4QMGA 4NBAA 5LL6f 2B29A 1K731 4ME3A 3S2HH 1TWAI 1PZID 1D6EC 3ULJA 3D31A 2KCMA 1AZQA 2BDNA 1ASZA 3ND8A 3V2TA 1HH2P 2QEXA 1BCPB 1VF7A 2J0TD 1TY2A 1JJ2A 1SEBD 3FKII 1DOMA 3G6EZ 2K4KA 2R93I 4LJZC 1PH3A 1JOOA 2C5CA 1VQ4Z 3FQQA 5D1OB 3S1NH 4WORA 4PZ8A 3ULPA 1I50I 3KF8B 3QO2A 2O4HA 3L3OC 3RZOB 1RO4A 3NH8A 1MKHA 1RD9D 2NWGA 5FLMI 2JJQA 1DOLA 1WTWA 2K5WA 5A2Qf 1PTOF 2HDMA 2PPBC 4AQYQ 3TSSA 1VQ6Z 1IZ6A 3ZYYX 3A55A 4KD4A 3C1FA 2B2YA 2N78A 3OWFA 2YADA 4TSSA 4CL1A 4KD3A 1Q7YC 2EPBA 1JCKB 3DLLA 2CH4W 5G3LD 3RN5A 3OWEB 2F3WA 1SDFA 1QVFY 2NVQH 1JORA 2AYDA 5C44G 1BDOA 1N2FA 5ELNA 3SGIA 1VQMA 1FDIA 1HZBA 4K6DA 1KC81 1H9RA 1FDOA 1SMYC 3G7LA 3K7UC 5EBCA 3H6MA 1YJWA 4NBCA 4LFAL 4OWWB 1S72A 2B63B 1EQTA 4YCUA 3I7FA 3TDQA 3FRPB 3I56A 3NBHB 4RV9A 2Z6KC 2Q8RE 3DM3A 2A6HC 5JEAJ 3KUPA 3CD6Z 5DM63 2Q2UA 4DR2L 3ONAB 1SBBB 2D9UA 4RVHA 3NTIA 4H7BA 3RZOH 4IFDG 4E2WA 1KD12 3MXPA 1STGA 1S7MA 2W04A 3F3FC 3LUSA 1JB3A 3VYUA 4YHHQ 5LMNQ 4LFCQ 3MXNA 4EQOA 4V190 3MEHA 1JC7A 1XNQQ 3A8KE 4HJAA 4G57A 3SK4A 3T56B 3PSIA 4UP7A 5JJZA 1ICFB 4DV7L 3T1HQ 5K5PA 4HH4A 2L4NA 5FO8B 2GTHA 1H9KA 3PV0A 2BA0A 4MHEA 2VS1A 3C1EA 2QEXZ 1EYDA 3MHBA 1N32L 3BJUA 1KHIA 2P3YA 3TS2A 1JJ2Z 1H95A 1VQLA 4C3JB 4H13C 2UXCL 4F87A 1K0RA 1D2BA 1LT3D 2B63H 2R7DA 2NZOA 3CCJA 1PRTB 4BY7G 2J7ZA 1C48A 4JI6Q 4RFBA 5H1SE 3GTLI 1KAAA 2PZWA 4X3SA 5E7NA 1XMQL 1QVCA 2L5TA 5BN3A 4JI8Q 3GV3A 1TS5A 4M8AA 3VR2A 2VQFQ 2Z8LA 1TFIA 3TE5B 5ELDA 1Q82C 4C3JG 4LF4Q 3HS0C 1RLYA 2HQEA 5DM73 5GAGC 5C4ZA 4NFRA 1MHWC 4GOPC 1B53A 2JXMB 3LGJA 3NWTA 3CCLA 1PH2A 4KK7A 2RBLA 2VB2X 4OHJA 3I4NI 1I4QA 1FVIA 4BY7H 5GAHC 3SHLA 1VQMZ 1SYEA 3DEPA 1XNRL 5IGFA 3NENA 4BBSB 2Z6BA 3QJYA 3KJOA 4A75A 4BBRB 1FJGL 1YJWZ 2AKLA 1SMYD 1S72Z 4OX9L 1NAPA 1K9MC 4G7OC 3CCU1 1UE1A 3HOXG 2IJ0A 4A3CI 1BKBA 3I56Z 4C3JH 1AZPA 4A3EB 1SSOA 1SFOI 4QY7A 3OIPA 3KIFA 2A6HD 4Y7NB 4DV0L 4IOAA 4JV5L 3RMHA 4HJ7A 2Q8TA 3U9SA 4HJ8A 2F1MA 1PH1A 5E1FA 3ICEA 4X64L 3EERA 1ENCA 3D9XA 2FMMA 4BBRG 4PNYA 2DE5A 2ID0A 3G4SA 1EYCA 4K5VA 1S5FD 4DR3Q 4ZUIA 3AB9A 4DXFA 1YJ9A 5IODA 4A3EG 1YI2A 1TWGI 4GNXB 1A8VA 4ZQ3A 5JJIA 3MAQA 5JVH3 4LK1C 3Q22A 2F0NA 2WFWA 4H0LC 2XIWA 3VR3A 1YIJA 2OWOA 3GTQB 4R9WA 1VQLZ 2XRSD 1YJNA 4BBSH 1VQ41 2RDHA 3UDFA 2UU9L 4A3JI 3FKIG 3IL8A 2BH8A 4BBRH 1K73C 3E6ZX 2R93G 2IX0A 5HY6A 3CCJZ 1STBA 1TKWB 1ML0D 4BY1B 3E5SA 1BCPC 1EU3A 1EWHA 2CHBD 2NUCA 4A3EH 3I91A 4DR1L 5EKIA 1VQ61 5FLMG 4Y7NH 2QF7A 4R8IA 2V3VA 5KIXA 2H5XA 4EQNA 4NBBA 3ESWA 3IX0A 1TWAH 1EU4A 1VQOZ 1IHZA 3GTGI 4OELB 2RCFA 1M1K2 2Z9HA 2VZAA 4DU9A 2GTIA 3CCLZ 3FDTA 4A3DB 1VQ51 2EYHA 4TQUS 4HJ5A 3S1RB 4DA2A 3FKIH 2A8VA 3NXWA 3TP5A 2KQ3A 1FL0A 4XX2A 4X62Q 3K5MA 2B2TA 3DWAA 3NTHA 3CHBD 1TWHB 2OEOA 3T1YL 4ZKBB 1PVOA 1NUIA 5EPLA 4IJHA 2JIOA 3VYRA 5M5YB 1U9RA 4DNTB 1C7YA 3NBIA 1ZYRD 2GVAA 3NH4A 2EYFA 4UHVA 4KTAA 3GTQH 2V8JA 3G71A 3CMA1 2R7ZI 2MPMA 2KCNA 1A3TA 1K8GA 4RWSC 2JK8A 1KC8C 2OT2A 3P75A 4H02A 4GLXA 1EY8A 3Q23A 3CCVA 1PZJD 3F1ZA 2YU9I 4L5QA 1X9NA 1B9MA 1FD7D 3KK7A 4JYAQ 3K5OA 5D1PA 3GKQA 5LMNL 4LFCL 4YHHL 3UDXA 5EAYA 3MZ5A 3G4SZ 3NSWA 4C3HB 4E33A 1XNQL 3LNNA 1QB5D 4UP8A 1EY5A 3GTJB 1YJ9Z 1GXDC 2QKDA 1YI2Z 4NH1C 1HQRD 4LW1A 1GHJA 1GUGA 3S1RH 2MQHA 4C2MH 4KLKA 1A6XA 2AUJD 4MIUA 4X6AH 3FPPA 4QIWB 1YIJZ 4WRDA 3C3LA 4DR7Q 4LUOA 1HR0W 1QXFA 1TWHH 1YJNZ 1X3ZA 5M5YH 2E2HB 2JA9A 5HGQA 1CT1D 1P8LA 4Y52I 3CC4Z 1BCPD 2AHOB 2E74C 1A0IA 1STEA 3CRLC 4MONA 1PA6A 4JI3Q 3S2HI 1QE6A 5K36H 2BH2A 1IYJB 4LF6L 3P5JB 1PLFA 1XYIA 2PNHA 1CA6A 1RHPA 1Y8CA 5JEAG 1Y1VS 1BBXC 5CMDA 4B3RQ 3H0GB 1MJEA 2F0MA 3FVQA 4C3HH 2H1EA 4A3FB 2PQEA 2MNAA 3I72A 3BZCA 1N33Q 5C3WA 1X56A 2EXDA 3OSOA 1JJGA 3EVQA 3STBC 3GTJH 1EOTA 3IKJA 4P73A 3S1NI 5DNFA 4KY7A 2A68C 1SFOB 2Q2TA 3I4NG 1BOSA 4KHPL 2PI2A 4KHVA 3BYTB 1QNUA 4FNFA 1KQSY 2VUMB 1G8ZD 2NVXI 1GUSA 5IT9f 3G48A 3R2TA 4X3TA 1S5BD 2MUYA 1NJI2 2NVTI 5DEHA 3O13A 2RPRA 3TZDA 3W5OA 4NXML 3S17I 3UDGA 4LF7L 4A3CG 2UXBQ 1I94Q 3M4OI 2R3ZA 4DK1A 2HCCA 2MO1A 2NVQI 1HZAA 1TWGB 3CCVZ 1VQEA 1CKOA 1XWEA 2BCOA 4IALA 3OTOQ 1LM0A 1Q8IA 2I0QA 2D5DA 4ZKCB 4P2CB 3I4NH 1EY7A 1KABA 2L55A 2K33A 4OL7A 4DR3L 1OXUA 4JBKA 1WIIA 2Q2HA 4N9TA 1RL2A 3AYHB 4RGOS 3MWYW 4N9PA 4F7XA 5ELFA 2VQEQ 1VQ9A 4DV2Q 5GADC 3FEWX 1EL0A 3BYYB 1N9WA 4DPGA 1AE2A 1E1OA 4DV3Q 1PTOB 3D6CA 5CC4A 2HUGA 4A3CH 2F0KA 1AA6A 4C3IG 3BDOA 3C2PA 2WAQA 3J7AF 1SFOH 4RVDA 1Q862 3RZOI 1E7ZA 1UNSA 1EY4A 4DK3C 1DM0B 1KAWA 2E2DC 2VUMH 1Z7TA 1L0WA 4JG2A 3K58A 1SNCA 2F3VA 1TT2A 3GTGB 2B2VA 4A3JG 4NXNQ 1RF2D 2VPWA 2IT1A 3CCMA 3F3PC 1HNXQ 1IBLL 1VQNA 3PUXA 1LYLA 1MBYA 1KDBA 3EFXD 1TWGH 1VQO1 2NVYB 3CC2A 1EIYB 5AFWA 4XYOA 2XSCA 4R4IA 4LUZA 3J7AV 4C3IH 5JPMC 1RDPD 4BS9A 1PRTD 4PQXA 2B2WA 1USPB 3GTKB 4WJWA 5I2XA 2B63I 2EY1A 2PQAA 4NBFA 4X62L 2H4OA 2JA7B 2DGYA 2LXKA 3STBD 2XVSA 3F2DA 1RO0A 1WTVA 1DL6A 1DJRD 2YTYA 5E3FA 1STYA 1UE7A 3HOUI 4X65Q 1HUMA 3G6JB 3QOLA 2YU9B 2ZXOA 1PTOH 2VXWA 4UY8C 1NNXA 1F9QA 3NE5B 3EA6A 4DR4Q 3RLNA 4JC0A 2Y0SB 1M8AA 1C8CA 3TN2A 1L1OA 2F0PA 4IUQA 5D65A 3CCE1 1VS0A 2LY7A 4MZ9A 2R7ZG 2YTVA 1FYCA 3GTGH 3I07A 1LACA 4JYAL 3H91A 1CTMA 3DXJC 5AN9F 1VLAA 2K52A 3D4WA 3CMEA 4K8IA 3E9HA 4F8MA 4FXDA 1LT5D 1Q821 4P72A 3GTPB 1IYVA 2NVYH 1YJ91 3CPFA 1K8A2 5FKAC 4CJ2C 1B2TA 2NB0A 1VQK1 5CV6A 1JOQA 3HP3A 3PF4A 2FFKB 1E24A 1VQ9Z 3TREA 1HNWL 3KLRA 4O0AA 3GTKH 1A3UA 2A6EC 3MTSA 3JAML 3HKZG 2R7ZH 4OIKA 5C5LA 2EGTA 2A69C 1N36Q 1Q811 2E5LL 1YBYA 4ULLA 1YJN1 4DR7L 2B8GA 1HCZA 2RHQB 2RHBA 1H9SA 1CKNB 2YU9H 5FLXL 3QWUA 1CSQA 3I55A 5M3FG 1HR0Q 3V96A 1Q46A 2E75C 3FHWA 5IP9I 5JAVA 1QZGA 3CC41 2F0UA 2Z0SA 2XNAC 4XIGS 1BBWA 1G51A 4APVA 3CQZB 2CQOA 2QRCB 3CCMZ 3NPPA 4ZAIA 4KN7C 1ML8A 3CXCA 2I5HA 1VQNZ 3PO2B 2IWHA 4C1NI 2JMOA 5FJ8G 2L11A 3CC2Z 2PMZA 3CPWY 2CWPA 3HEJA 1GJXA 3TRZA 1J5EQ 1SAPA 1ASYA 2NVXB 4MTNA 2KBNA 1Q7Y2 3CRKC 5J3BA 1LTTD 3LWUA 3KJPA 3GTPH 5CV5A 1K8MA 4DV6Q 4BBSI 4L5TA 1ET9A 3D2LA 3JAME 1N33L 1IBKQ 2NVTB 5M3FH 2F4MA 3AEVA 5M9OA 1B7YB 2NN6H 2HD3A 2KA7A 2RSNA 3R3OA 2EIFA 3S17B 1BQQT 3NP8A 1I3QI 1FGBD 3J7A5 1QF8A 4J6HA 2EYJA 5CV7A 5FLXE 1CFMA 1KRTA 3T16A 1W2BA 4HSPA 5NUCA 4Y7NI 4Y52H 3KIHA 2XWJB 5FJ8H 1VQ71 1N34Q 1YVCA 2M48A 3OOCA 2UXBL 1LTAD 2QILA 4HTHA 1F9PA 2KPIA 4PMWA 4Q5VA 1ENAA 2B2UA 4XT1B 4IZ8A 2F03A 3A7LA 3OTOL 2MJ8A 1JJCB 4JVZA 2F0VA 3CC71 4RKLA 2KEDA 1V1OA 1AE3A 5E4XA 4DNRB 3CMEZ 4TNUA 3N52A 2L9HA 1HTPA 3PO2H 5CM2M 1XPOA 5C4XB 4FF2A 3K0XA 3KLSX 2F52A 1WZNA 4CGYB 2UUBL 4ZYSA 2Q8IB 4KN4C 3KDFB 2NVXH 1KDAA 3GTQI 2KI7B 1UEBA 3JC66 4YCWA 3CCRZ 1FNWA 1UWVA 2PI2E 2NVTH 4MTKA 1JQYD 3MZKB 2EQSA 2NYZD 1Q1BA 5LL6X 3OW2A 2A6ED 1XX8A 3S17H 4AYBA 3JAMb 2A69D 4BY1I 1EY6A 2XGTA 3M4OH 4FF4A 4JI4Q 2K5NA 1PYBA 2Q4ZA 1PH8A 1JWMD 3I55Z 2F4IA 1M901 1EYAA 5FLXb 2JA6B 1WTPA 1O7YA 2G2KA 1PTOC 2OOXB 3IFTA 4A3IB 1BNZA 2BE5C 5IGBA 1X65A 2OTL1 4K5XA 4YCVA 1HNZL 3BDCA 4JI2L 1IL8A 1F77A 3CXCZ 3I3CA 4C1NK 2ENBA 4IN3A 3HOYB 1IBMQ 4A3DI 5JVG3 3PQIA 3S1RI 2WP8J 4RG1A 1VQ8A 4BXXI 1PH5A 3HOUB 4GKJQ 4X6AI 1YHBA 4YY3Q 3QG1A 4HIOA 1ET6A 1EQQA 1GUOA 4GN3B 2NZ1D 1TWHI 4ZRZA 3F2CA 3BVZA 3KFUA 1PMRA 2A74C 4RGMA 2B63G 2XRQD 2WAQE 2QA41 1AW7A 1JWSD 1D7QA 4HMIA 2I5MX 3GTMS 3BVGA 1W2BZ 3Q8DA 4K0KQ 3HOUG 2RCNA 1K9M2 5I4DA 4DR4L 1J9OA 1I4XA 1SIWA 1T5XD 1V1PA 2RDGA 4LNQA 3VR5A 1RNIA 1EFWA 4DGLA 2ALYB 3CCSA 1CZGA 4DV5Q 1KLUD 4K2KA 2JA6H 1QVGY 1JE4A 2NZHA 2D0OA 1VMPA 2IZ3A 1A63A 3GTJI 1QILA 4EX5A 1I4HA 4E30A 2WACA 4GKKQ 1AP0A 5KNBA 1SNDA 2JNYA 4EVOA 4DR5Q 4LF9Q 1PFTA 4UAIA 4BWGB 3HOYH 1Z47A 2JE6I 1B50A 1HHVA 1GM5A 4IUUA 1QJOA 2VB3X 3HOUH 1S4ZA 1DZ1A 2F0DA 3K57A 4MN3A 3WWVA 1TWCB 2QW7A 1WTQA 2VY3A 3WOFA 3DEOA 5IIFA 3S9WA 1PZKD 2DY7A 2WAQB 2JA8I 2E2HI 4PG3A 3OW2Z 2VW9A 2HQLA 2PW5A 2TSSA 3DM1A 4J15A 1WTXA 2EJMA 3VA5A 2RIQA 1A15A 3PO3S 4G7HC 2Z6KA 4ID6A 2F4VL 2QDBA 2WKCA 3GCFA 1K732 4HR7B 3NEMA 3PUYA 1SYFA 1CSPA 2OTJ1 4WJ4A 1SYDA 2OQKA 3CCM1 1Q81C 5IP9G 1PTOD 1MGSA 2F0EA 2ZM6Q 2BE5D 2WB1A 3D4RA 3H0GI 4A3FI 2LFUA 1TXYA 1RO2A 2G9HD 1I3QB 1YITA 4DAYB 4A3MB 3U50C 1VQ8Z 2RQXA 1KD1C 3EN2A 2GU2A 4O42A 3VYSA 3X3MA 2IY5B 4DV6L 3KLSA 2PQAB 1HUNA 1P9NA 1IBKL 2VUMI 2X6GA 3N6RA 4M1UB 3KOJA 4QUFA 3ERSX 4BBSG 1F2YA 2KENA 5CV8A 4I7AA 4P71A 4JBMA 4FF1A 4JCVE 2EYMA 1EOVA 4DAVA 1DD2A 1HQMC 2F0FA 4NMZA 5IP9H 2ZJRA 2O2LD 3SE0A 2BDOA 5J1ZA 1SYCA 2N8NA 3VYTA 1H9MA 2SNMA 3GTOB 2JUBA 2V8KA 4POGA 4AH6A 1MSHA 2B2TC 1L1OB 1DGSA 5GROA 4RHSA 2K5HA 2CWAA 3S1MB 3CCSZ 1HPCA 3W2DA 3HKZA 1KC82 3G6E1 4A3BB 1QUQB 4ODGA 3OHXC 4JI0Q 1SE2A 3S14B 4IPGA 3GO5A 1ZEQX 2PMZE 2ZTCA 2TMPA 4GOPA 4A93B 1LTID 3CAMA 4IOCA 3TMEA 2QLVB 1BCPF 1I3QH 3KBGA 2QDLA 1RODA 1F2LA 1LTRD 1Z9FA 2EY5A 2F0WA 1ZKOA 5BR8Q 3CCR1 1NR2A 3W3AA 3URYA 1L0YB 5C5MA 4AQYL 3SK8A 4RKBA 2C9OA 2DUDA 2OQ0A 2ICEC 1I4GA 3ND9A 3SEBA 2RA4A 2BJOA 1QYPA 3J81L 1X6OA 4KV6A 4R1JA 4XQNA 2MO0A 1XMOQ 3SR1A 3DUZA 3CCQA 3E0JA 4PMBA 3CKIB 4UDUC 3W1BA 5T67A 2EY6A 5ELOA 4E2ZA 4BY1G 1Y1VI 3U58A 1QNKA 2Q2IA 1VQGA 3GP7A 4CJ0B 3H3VC 3EEDA 3FQMA 5L37A 1E2VA 2NVYI 4A3KB 5C4HA 1I6HB 2F0SA 2M9VA 3V05A 3SXHA 2N3SA 1YHQA 1ILQA 3S1MH 5T64A 3IAYA 1PFNA 2ZJPA 1IBML 4LF5Q 1QCBD 3NDJA 3MXUA 4A3BH 3GTKI 1M90C 1YITZ 1C9OA 5DLQE 3S14H 4GKJL 4OO1I 4A3DG 3CD61 5IY0A 3M3YB 4A3LH 3MZLB 2JA7I 1NP6A 1EZ6A 4BXXG 2AKWB 1K0SA 1CI3M 1GUNA 4A93H 4DQYB 1I4RA 1TY0A 2XTIA 3TP8A 3S1QB 1YHAA 2HIXA 4BY1H 3J81E 1YUKA 2B39A 1SYBA 2K05A 3TQYA 2PZTA 4AYBE 4LF8Q 4EWCA 1UE5A 3VMGA 4LFBQ 1K3BC 3QWNA 1K3RA 3T1HL 4X66Q 1I5FA 3EQLC 3K80C 1N8R1 4A3DH 3I4MB 5K36G 4KKUA 1P16A 2QEX1 1EIHA 1Q8KA 1JJ2Y 4BXXH 1Q1EA 4DV5L 3AFQA 5FK9C 1LTBD 1JE5A 3J80L 3GTPI 1SR3A 1JWHC 4A3KH 1I6HH 4C3HG 5D1OA 1F2ZA 4GKKL 2RF4A 3KF8A 2NN6I 4LF9L 1O80A 2JA8B 5ELCA 3ZJYC 5IYDG 2NTSA 1IXRA 4JI6L 5IYBG 4DUYQ 1ESFA 1CHPD 1W3SA 1J8IA 2JS4A 5T1GA 3JAMc 4EQ5A 4CDEC 1RKNA 4JI8L 5IWAQ 3S1QH 3A0JA 2VQFL 1PRTF 4RGNA 4QCLA 4LF4L 5CV4A 3D4DA 2JA8G 3J81b 3K6OA 1G6ZA 3HOWI 1QVFA 1D5ZC 3CCQZ 2ICIA 2CFMA 5CGKA 5I9PA 2DY8A 1H9JA 1PH9A 3CQZI 5IYDH 1VQM1 3PO2I 2K04A 4NPSA 3J80E 4N8FA 3QR8A 5IYBH 2J6AA 2NTTA 1KTKA 2F4OA 4NOZA 3I4OA 1XPRA 1S5ED 4X3KA 3I4MH 1JOKA 1YJW1 3H3VJ 1SE3A 2DNCA 2ZXPA 1S721 1Z01A 1O78A 3VR4A 4E6IA 3M85A 1RCVD 3T51B 1YHQZ 4ABNA 2QR1B 2SNSA 1OO9B 1DCZA 2G5DA 4RCOA 1VQ81 4LUVA 1KL9A 4PZ7A 3NBHA 2PK7A 4DXGA 3I561 4JI5Q 2JA5B 2B2VC 4FP5D 3H0GG 1Z6HA 1MIUA 3G71Z 1X0TA 1U4LA 4A3FG 2UUCQ 1A62A 1EWIA 2Z4IA 2GVBA 4XYQA 2JA8H 2CQAA 2E2HH 3NELA 1WCMB 1WJ2A 1B44D 2KHJA 5EJWA 3K0YA 1I4PA 2HHHQ 1R4PB 3MC0B 5D3IB 1MSGA 1RTNA 3MXNB 4FXKC 1SN8A 5IGCA 1O7IA 2B3GA 4GLVB 2VUMG 5CR3A 3HOVI 3NH5A 3PCOB 1LTSD 4JI7Q 3J81i 3A74A 4DF7A 4CDCC 4HMJA 2KCCA 3UE0A 4E32A 1BBUA 2K03A 3S15B 2YV5A 2K5DA 4JOIA 2HT1A 1TWFI 3VMIA 2MHVA 3H09A 3DWPA 3H0GH 3PUWA 4OWXB 5LL6S 3LX0A 1UAPA 4A3FH 1K83B 2QCPX 3BDLA 2F0HA 1OXSC 2WB1E 5C4XI 4PV1C 4O2DA 1PYSB 1VQL1 4OXPA 3M4PA 4ZCKA 3AFPA 1VMCA 4OIJA 3J80b 3NTKA 4CDFC 2OCEA 1LT4D 2DJGC 4IUNA 4OEMB 5JJLA 1PFBA 3CCJ1 4JI1Q 3PIO3 4BA1I 2JEAI 1L1OC 3R8BA 4HGYA 3H3VI 4KKSA 1Y8PB 5A2QL 2AWOA 1DYQA 1BR9A 4NP5A 1Y1VB 4TKOB 1BXTA 1ZXTA 2KHIA 4DV1Q 1QWYA 3J7A4 2DN8A 3F2UA 3T13A 5M5WB 2A19A 2BA1A 1XMOL 1GO3E 3P7JA 2E2JI 3CCL1 2JA6I 2SEBD 3OIQA 1QVFZ 1JICA 1OXXK 1U4PA 2K50A 3L2PA 4A3II 2A5HA 1CM9A 4RGTA 5I6YA 2K28A 3D3RA 1OTCA 1AN8A 1EIFA 2E76C 2JSOA 3S15H 3HOYI 3HKZE 4K5WA 1SNQA 1Y1VG 3HKSA 4JPBW 5M3MB 2JR6A 1PXUA 2A68D 1AEXA 2GN5A 2WB1B 1WI5A 1K83H 3M9BA 3CCUA 4DUZQ 2PCFB 3NFZA 2RKSA 4LAAA 4LF5L 3EROA 1E0BA 2ZXRA 1KRLA 5C4JB 1VDZA 3SDZA 1WTRA 5LMNW 5M5XB 1U4MA 4BA2I 3OW7A 4OO1G 4JBJA 1V9PA 4HIKA 3MFYA 2JA7G 3W1GA 1U0LA 5HURA 5CBAE 2C35B 4AIMA 4NBDA 3PUZA 1DXMA 5EGTA 4MD7A 2OF1A 3G4S1 3T4AC 4CBVA 1Y1VH 3X3NA 1ZH1A 2P28A 4DV7Q 5M5WH 1YI21 1TR5A 4L8JA 4FXGC 2Y0SG 1EQRA 4X66L 4GNXA 4XQQA 3H15A 3ITPA 2KECA 3BVMA 2QGQA 2VF1A 4IUPA 2IZ4A 1G291 3WDNA 1N32Q 3RN2A 4CKCA 5T6BA 5G3LF 4OO1H 2UXCQ 3EIVA 1X3PA 1YIJ1 2JA7H 4K6LA 3S24A 1VQ4A 5ELEA 3MVVA 3P1HA 4C56C 4NB8A 5BN5A 5M3MH 1JR0D 1MD2D 3K5NA 1NTGA 1NR4A 2GA4B 1EY9A 1GUWA 2EZVA 1JWUD 4A3GB 1N8RC 1PV4A 3QOJA 1D5MC 1KD11 4DN4M 1TWCI 1EIGA 2NN6G 3A5UA 1XMQQ 2VL6A 3TP7A 3A8IE 1QG7A 4RMFA 5KNDA 2IX3A 3HOWB 3L7ZC 2B2UC 5C4JH 1B1ZA 3AMUA 5M5XH 2KJXA 5A2Qb 4JI3L 2O5IC 5KRUA 5IYCG 2E8GA 4MXUA 2K7VA 2L15A 5KYLA 3L9AX 3OYYA 3TS0A 3OMCA 4CJ1B 2JQOA 4H44C 1Q12A 4ILWA 1HA6A 1VQ5A 3CCQ1 5IOCA 3PMFA 1QOHA 1VF5C 4B3RL 3TZUA 2R61A 3NQIA 4S1TA 4IPDA 3HOWG 4K8JA 4S3SA 1LUZA 1EY0A 4R4OA 2B2YC 1L2FA 4WFN3 1FJGQ 1Y8NB 1GOZA 4OX9Q 2LXJA 2E7ZA 4A3MI 3PO2G 5IP7I 4IURA 1DOKA 3CCUZ 4B08A 1BUVT 2AQ3B 3RD4A 3CMAA 2FHTA 5IYCH 2LFNA 3E9IA 3G711 3HOVB 3AU7A 1KNEA 2YTXA 4DV0Q 2VPYA 3PIPA 2EXZA 3BZKA 4R4TA 3PIP3 5IGEA 2K3RA 4A3GH 2L1BA 1I94L 1EUJA 1ESRA 3SVMA 4X64Q 3CCV1 1X32A 1Q3LA 5C3XA 3K8AA 1TWFB 3HOWH 4B9WA 3CQZH 3HZXA 3HOZI 4CDDC 2IW3A 3U4ZA 3GTOI 3DHQA 3M4QA 4CHTB 3NHHA 4JI7L 1G2SA 5E4WC 3HOVG 2IHEA 3S1MI 5FO9B 1JT8A 4NB3A 4ALPA 1T5EA 2KUMA 3KLWA 5ELBA 2VQEL 4A3BI 2R6MA 4DV2L 1R4QB 3S14I 4OGQC 3MONA 4A3LI 4NB9A 3SK5A 4DV3L 1TQOA 2MP1A 4A93I 3K7AB 2UU9Q 2JIRA 3RZDI 2FMCA 2XN9C 2AMCB 2UUAQ 5C4XG 1EEID 5GQOA 1O7ZA 2R92I 2EVBA 5C44B 4JI1L 1F9SA 1WD0A 4DR1Q 2E2JB 1VQDA 3PF5A 3HOVH 1B8AA 4J1MA 3PO3I 4IJLA 1KIXA 4YWMA 3A8JE 3KBXA 4NXNL 1X55A 3KYHC 4V0BA 1KRSA 2PM9A 1C4QA 2V1CC 4L6TB 3J81c 4DV4Q 1HNXL 4L63B 4DV1L 1X3EA 1Q16A 1V8QA 3GQBA 1TWFH 4LMQD 4IUVA 5LHY1 1D5XC 3J7ZC 1VQ5Z 1Q822 4XDXA 4QJFA 1WOCA 4B3MQ 3S16I 4A3KI 5EBDA 5C4XH 4TRDA 1I6HI 4QF4A 2JA6G 3I70A 4YIJA 2JEBI 4DAMA 3I8ZA 4HGZA 4A3IG 1GUTA 1WYDA 4RVFA 1JB7A 3T1YQ 2BOSA 2ZT9C 1LO5D 1X54A 1B4OA 1SMXA 1XTCD 1KQSA 3HOYG 4X65L 2M6NA 5KEEA 3JAMi 3H3VH 3M3YI 4FO2A 4DUZL 1Q812 1KNAA 1NSNS 3H94A 1S40A 2YYZA 3CMAZ 3K7AH 3S1QI 2UXDQ 4A4IA 2EYPA 1S5CD 1TVXA 1IW7C 3I4LA 5C44H 3P20A 2E2IB 3NDIA 2O5JC 1E2WA 2FXQA 2E2JH 3OPOA 4DAPA 2JIMA 4RVGA 4P74A 1VQJA 5AJ3Q 4A3IH 1F9RA 1M1K1 1D1KA 1LT6D 3MA2B 2G9DA 2HIVA 4F88A 3ERQA 4BY7B 2M2LA 4B3SQ 3I4MI 5IGDA 1VQFA 2EDGA 4IO9A 2B8FA 3I90A 4R4QA 3IRBA 2F3IA 2AWNA 1VQ91 2D62A 2EJFC 2FINB 4KKTA 3JAMf 3SK6A 3J80c 1PFMA 2RSOA 1CHQD 4FF3A 4IFDH 1NMGA 4Q0FA 1HTLD 4HN7A 2JP1A 1N36L 4QUCA 2JIQA 2JIPA 5FLXf 2MGSA 3F8TA 4HSVA 1AFPA 4QQBX 2K75A 2ZAEB 4Z9CB 3T4NB 5JOBA 4DK6C 1HR0L 2OXPA 3BS1A 2I46A 3U9OA 3E3XA 3TP6A 1UE6A 2K5RA 4XTCS 4HAEA 1MJCA 2JYOA
chains in the Genus database with same CATH topology
2V8IA 1PHJA 4YWLA 2QREB 1VQN1 4JBWA 4OWTB 1VQOA 2E2IH 4LF6Q 2WAQG 3CC21 1B70B 1PH4A 1J5EL 1USPA 2A1AA 4NBGA 4B3TQ 1AH9A 3B6YA 3KF6A 4KHPQ 3TDHB 2JA5I 1TWCH 5C3EI 4DR6Q 1KQSZ 1PFSA 4PZ6A 4A3MG 5IP7G 2IHFA 1WCMI 3A5ZB 4NXMQ 2Y0SA 4LF7Q 2RT9A 1J6QA 2VNUD 4UPAA 3CCEA 1N34L 4IPCA 1M902 4A76A 1Y1WG 1NE3A 4HIDA 3CME1 1VQHA 1R9TI 3S15I 3PUVA 3RLOA 3HOXH 3HOZG 1VQKA 2I5LX 1K83I 5C0XJ 4UP9A 1SROA 4A3MH 5IP7H 3FP9A 3VDYA 1GKHA 3E0EA 1VQPA 3D6WA 3F2BA 4A3BG 3GTMH 1NJI1 4MRIA 4A3LG 2VUGA 1Y14B 1Y1WH 1CKNA 2ZTDA 2UUAL 4L5RC 3S2DH 1VQBA 5IE8A 4A93G 2ATWA 2D0PA 4JI4L 3I551 1E22A 3CC4A 2IX1A 2R92G 3HOZH 1IBLQ 1EYGA 3GTOH 4NBHA 3CXCY 2ASBA 4QTTA 3PO3G 4DV4L 4POFA 1G6PA 1VCIA 1X3GA 3CPWA 4NBEA 1RQFA 2ZTEA 4QGUA 2R93H 4YY3L 4B3ML 1YEZA 3RZDH 3D0FA 1BVSA 1I50H 4A3KG 4QIWE 2R92H 1Q861 3L0OA 5FLMH 2LIYA 5C0XI 1W2BY 3M7NA 5C4JI 2MFIA 1CKMA 2ZJQA 3PO3H 2Q51A 3U4VA 1VQ7A 4K0KL 3RNUA 5IT9b 3RLFA 4WJ3M 2UXDL 4MH4A 3CCEZ 1E3PA 4QL5A 2O53A 3CC7A 4FDBA 2DE7A 3S16H 5AJ3L 2OOYB 4KI0A 4DKAC 3BU2A 4DR5L 4TVAB 4B3SL 3TEHB 1VQKZ 3KDFA 1HNWQ 2H85A 3I4MG 3M3YH 4L5SA 1Z03A 3VMHA 4MD8A 1VQPZ 1M1KC 3CP0A 3OW2Y 3CF5A 2E5LQ 2CKZB 4DNIA 4A3GI 3IFUA 5FLXc 4JOIC 3VB9A 1GVPA 3ULLA 4HIMA 1C0AA 2OTLA 2W03A 1VQCA 1VQIA 4AYBG 2R6GA 1K8A1 1PH7A 3CPWZ 4IPHA 1D8LA 1JMCA 4B3TL 4MNOA 3PGZA 2QA4A 3IF8A 1ZB8A 3GTLH 4QTUA 5LMUQ 4DR6L 1NMFA 4GS3A 2JA5G 4GLAC 1VQ7Z 5C3EG 1SRUA 1WCMG 3CCS1 3EBEA 4IFDJ 1HZCA 1VQAA 4RS4A 1QVGA 3CC7Z 3VTNA 3GDEA 4JI0L 1WJJA 4E31A 3ER0A 2DE6A 3PIOA 1Q7Y1 4R4CA 2N49A 2UUBQ 1GD7A 1X3FA 1OXVA 2JA5H 3BG1B 5C3EH 5BR8L 1XJVA 3K81C 2HU9A 3K7AI 3RR5A 5GAEC 1WCMH 2K5VA 3J81f 1V43A 2K14A 2ES2A 5C44I 1IL2A 2Y0SE 4GNXC 1HJPA 2QRDB 2OTJA 3GD7A 1LQLA 1N8R2 1R9TH 1HNZQ 4JI2Q 3I2ZA 2OTLZ 4LFAQ 1NJIC 1YZ6A 4P75A 3J80i 4LWCA 1YIT1 4IFDI 1U5KA 4DR2Q 1X3WA 3UDIA 4KHZA 3KF6B 4A3JH 2OZKA 5M3MG 2QA4Z 1YNXA 2WB1G 1S3OA 4LF8L 4GN4B 4LFBL 5C0XG 4GN5A 2E2II 1T9HA 1V1QA 2E9HA 1LTLA 1NY4A 1Q86C 1SE8A 3J80f 3G6EA 1QUQA 3MEFA 4BY7I 1QVGZ 1Z02A 1NBWA 2R7FA 3Q87A 2I3CA 4GOPB 5JJKA 1ZB9A 3UE1A 3CW2C 4DUYL 4HJ9A 3HFZB 1SLJA 3CCRA 2HF1A 1YUAA 1VQ6A 2RHSB 1VQP1 1RIPA 2CCZA 4MD9A 5IWAL 3AQQA 1XTDA 1K9M1 1CUKA 1WW9A 1KXLA 2KCTA 2F4VQ 4A3GG 1HZ9A 4YWKA 1XNRQ 2OTJZ 1OXTA 1QZHA 3HOXI 1WFQA 4E2XA 1YHQ1 4OONA 3CD6A 4JI5L 4E2YA 3GTMI 2LSSA 4JV5Q 2UUCL 1E1TA 1PH6A 4BBRI 1Y1WI 3S2DI 3BG0B 2HHHL 3J81j 1K8AC 4A3EI 5IT9c 1XPUA 1FGUA 5LMUL 4NBAA 5LL6f 2B29A 1K731 4ME3A 3S2HH 1TWAI 3ULJA 3D31A 2KCMA 1ASZA 1HH2P 2QEXA 1JJ2A 3FKII 3G6EZ 2K4KA 2R93I 1PH3A 1VQ4Z 3FQQA 5D1OB 3S1NH 4PZ8A 3ULPA 1I50I 3KF8B 2O4HA 1RO4A 3NH8A 1MKHA 5FLMI 2JJQA 5A2Qf 4AQYQ 1VQ6Z 1IZ6A 2N78A 2YADA 4CL1A 1Q7YC 3DLLA 3RN5A 1QVFY 2NVQH 5C44G 1N2FA 5ELNA 3SGIA 1VQMA 1HZBA 1KC81 3K7UC 1YJWA 4LFAL 4NBCA 4OWWB 1S72A 4YCUA 3I7FA 3I56A 3NBHB 4RV9A 2Z6KC 3DM3A 5JEAJ 3CD6Z 2Q2UA 4DR2L 4RVHA 3RZOH 4IFDG 4E2WA 1KD12 1S7MA 2W04A 3F3FC 3LUSA 4YHHQ 5LMNQ 4LFCQ 1XNQQ 4HJAA 3PSIA 4UP7A 4DV7L 3T1HQ 4HH4A 2GTHA 3PV0A 2BA0A 2VS1A 2QEXZ 1N32L 3BJUA 1KHIA 2P3YA 3TS2A 1JJ2Z 1H95A 1VQLA 2UXCL 1K0RA 2B63H 2R7DA 2NZOA 3CCJA 4BY7G 4JI6Q 5H1SE 3GTLI 5E7NA 1XMQL 1QVCA 4JI8Q 2VQFQ 1TFIA 3TE5B 1Q82C 4LF4Q 1RLYA 5GAGC 4NFRA 4GOPC 3LGJA 3CCLA 1PH2A 2RBLA 3I4NI 1FVIA 4BY7H 5GAHC 1VQMZ 1XNRL 3NENA 3KJOA 4A75A 1FJGL 1YJWZ 2AKLA 1S72Z 4OX9L 1K9MC 3CCU1 1UE1A 3HOXG 4A3CI 1BKBA 3I56Z 4C3JH 1SFOI 4QY7A 4DV0L 3KIFA 4IOAA 4JV5L 4HJ7A 4HJ8A 1PH1A 3ICEA 4X64L 3EERA 3D9XA 4BBRG 2DE5A 2ID0A 3G4SA 4DR3Q 1YJ9A 4A3EG 1YI2A 1TWGI 4GNXB 1A8VA 5JJIA 2WFWA 1YIJA 2OWOA 1VQLZ 1YJNA 4BBSH 1VQ41 3UDFA 2UU9L 4A3JI 3FKIG 4BBRH 2BH8A 1K73C 2R93G 2IX0A 5HY6A 3CCJZ 4A3EH 4DR1L 1VQ61 5FLMG 4Y7NH 2H5XA 4NBBA 3ESWA 3IX0A 1TWAH 1VQOZ 3GTGI 1M1K2 2VZAA 2GTIA 3CCLZ 1VQ51 4HJ5A 4TQUS 3FKIH 2A8VA 1FL0A 4XX2A 4X62Q 3T1YL 1PVOA 1NUIA 4IJHA 1C7YA 2GVAA 3NH4A 3GTQH 2V8JA 3G71A 3CMA1 2R7ZI 1K8GA 2JK8A 1KC8C 4H02A 4GLXA 3CCVA 3F1ZA 2YU9I 4L5QA 1X9NA 4JYAQ 5D1PA 3GKQA 5LMNL 4LFCL 4YHHL 3UDXA 5EAYA 3G4SZ 4E33A 1XNQL 4UP8A 1YJ9Z 2QKDA 1YI2Z 4NH1C 4LW1A 3S1RH 2MQHA 4C2MH 4KLKA 4X6AH 1YIJZ 4DR7Q 4LUOA 1HR0W 1TWHH 1YJNZ 1X3ZA 5M5YH 2JA9A 5HGQA 1P8LA 4Y52I 3CC4Z 2AHOB 1A0IA 4MONA 1PA6A 4JI3Q 3S2HI 2BH2A 1IYJB 4LF6L 3P5JB 2PNHA 5JEAG 1Y1VS 4B3RQ 1MJEA 4C3HH 2MNAA 3BZCA 1N33Q 1X56A 2EXDA 1JJGA 3GTJH 3STBC 4P73A 3S1NI 2Q2TA 3I4NG 4KHPL 2PI2A 1KQSY 2NVXI 5IT9f 3G48A 1NJI2 2NVTI 2RPRA 3W5OA 4NXML 3S17I 3UDGA 4LF7L 4A3CG 2UXBQ 1I94Q 3M4OI 4DK1A 2MO1A 2NVQI 1HZAA 1VQEA 3CCVZ 1CKOA 3OTOQ 1LM0A 2I0QA 3I4NH 4DR3L 1OXUA 4JBKA 1WIIA 2Q2HA 1RL2A 3AYHB 2VQEQ 1VQ9A 4DV2Q 5GADC 1N9WA 4DPGA 1AE2A 1E1OA 4DV3Q 4A3CH 2WAQA 1SFOH 4RVDA 1Q862 3RZOI 1E7ZA 4DK3C 1KAWA 2VUMH 1L0WA 4JG2A 4A3JG 4NXNQ 3CCMA 2IT1A 3F3PC 1HNXQ 1IBLL 1VQNA 3PUXA 1LYLA 1TWGH 1VQO1 3CC2A 1EIYB 4R4IA 4LUZA 4C3IH 1USPB 2B63I 2PQAA 4NBFA 4X62L 2DGYA 2LXKA 3STBD 3F2DA 1RO0A 1DL6A 2YTYA 1UE7A 3HOUI 4X65Q 4UY8C 4DR4Q 3RLNA 4JC0A 1L1OA 3CCE1 1VS0A 2R7ZG 4MZ9A 2YTVA 3GTGH 3I07A 4JYAL 5AN9F 1VLAA 2K52A 3CMEA 3E9HA 1Q821 4P72A 2NVYH 1YJ91 3CPFA 1K8A2 1VQK1 3PF4A 1E24A 1VQ9Z 3TREA 1HNWL 4O0AA 3GTKH 3HKZG 2R7ZH 2EGTA 1N36Q 1Q811 2E5LL 1YBYA 4DR7L 1YJN1 2RHQB 2RHBA 1CKNB 2YU9H 3QWUA 1CSQA 3I55A 5M3FG 1HR0Q 1Q46A 3FHWA 5IP9I 1QZGA 3CC41 2Z0SA 4XIGS 1BBWA 1G51A 4APVA 2CQOA 2QRCB 3CCMZ 1ML8A 3CXCA 2I5HA 1VQNZ 2JMOA 5FJ8G 3CC2Z 2PMZA 3CPWY 2CWPA 3TRZA 1J5EQ 1ASYA 4MTNA 2KBNA 1Q7Y2 5J3BA 3KJPA 3GTPH 4DV6Q 4BBSI 4L5TA 1N33L 1IBKQ 5M3FH 2F4MA 3AEVA 1B7YB 2EIFA 1I3QI 3J7A5 1QF8A 1KRTA 1W2BA 4Y7NI 4Y52H 3KIHA 5FJ8H 1VQ71 1N34Q 1YVCA 2M48A 2UXBL 2KPIA 4PMWA 3OTOL 1JJCB 3CC71 1AE3A 3CMEZ 4TNUA 3PO2H 5CM2M 1XPOA 3K0XA 2F52A 2UUBL 3KDFB 2NVXH 3GTQI 2KI7B 1UEBA 3JC66 4YCWA 3CCRZ 1UWVA 2PI2E 2NVTH 3MZKB 2EQSA 1Q1BA 3OW2A 3S17H 4AYBA 3JAMb 4BY1I 2XGTA 3M4OH 4JI4Q 2K5NA 1PYBA 2Q4ZA 1PH8A 3I55Z 1M901 5FLXb 2G2KA 2OOXB 1X65A 2OTL1 4YCVA 1HNZL 4JI2L 3CXCZ 1IBMQ 4A3DI 3S1RI 2WP8J 4RG1A 1VQ8A 4BXXI 1PH5A 4GKJQ 4X6AI 1YHBA 4YY3Q 4HIOA 1EQQA 4GN3B 1TWHI 3F2CA 3KFUA 2B63G 2WAQE 2QA41 1D7QA 2I5MX 3GTMS 1W2BZ 3Q8DA 4K0KQ 3HOUG 2RCNA 1K9M2 4DR4L 4LNQA 1RNIA 1EFWA 4DGLA 2ALYB 3CCSA 4DV5Q 2JA6H 1QVGY 2NZHA 2D0OA 2IZ3A 1A63A 3GTJI 4EX5A 4E30A 4GKKQ 2JNYA 4DR5Q 4LF9Q 1PFTA 3HOYH 1Z47A 2JE6I 1GM5A 3HOUH 3WWVA 2VY3A 2JA8I 2E2HI 4PG3A 3OW2Z 2VW9A 2HQLA 4J15A 2RIQA 3PO3S 2Z6KA 2F4VL 3GCFA 1K732 3NEMA 3PUYA 1CSPA 2OTJ1 4WJ4A 2OQKA 3CCM1 1Q81C 5IP9G 2ZM6Q 2WB1A 3H0GI 4A3FI 2LFUA 1TXYA 1RO2A 1YITA 4DAYB 3U50C 1VQ8Z 1KD1C 3EN2A 2GU2A 2IY5B 4DV6L 2PQAB 1P9NA 1IBKL 2VUMI 3KOJA 3ERSX 4BBSG 2KENA 4P71A 4JBMA 4JCVE 1EOVA 5IP9H 2ZJRA 2N8NA 2JUBA 2V8KA 4POGA 4AH6A 1L1OB 1DGSA 5GROA 2K5HA 2CWAA 3CCSZ 3HKZA 1KC82 3G6E1 1QUQB 4JI0Q 4IPGA 3GO5A 2PMZE 2ZTCA 4GOPA 3CAMA 4IOCA 2QLVB 1I3QH 1Z9FA 5BR8Q 3CCR1 4AQYL 2DUDA 2OQ0A 2BJOA 1QYPA 1X6OA 4R1JA 2MO0A 1XMOQ 3CCQA 3W1BA 5T67A 5ELOA 4E2ZA 4BY1G 1Y1VI 3U58A 2Q2IA 1VQGA 3EEDA 3FQMA 2NVYI 1YHQA 2N3SA 3S1MH 5T64A 2ZJPA 1IBML 4LF5Q 3NDJA 4A3BH 3GTKI 1M90C 1YITZ 1C9OA 5DLQE 3S14H 4GKJL 4OO1I 4A3DG 3CD61 5IY0A 4A3LH 3MZLB 2JA7I 1NP6A 4BXXG 2AKWB 4A93H 4DQYB 2XTIA 1YHAA 2HIXA 4BY1H 1YUKA 3TQYA 4AYBE 4LF8Q 4EWCA 1UE5A 3VMGA 4LFBQ 1K3RA 3T1HL 4X66Q 1I5FA 3K80C 1N8R1 4A3DH 5K36G 1P16A 2QEX1 1Q8KA 1JJ2Y 4BXXH 1Q1EA 4DV5L 3AFQA 1JE5A 3GTPI 1SR3A 1JWHC 4A3KH 1I6HH 5D1OA 4GKKL 2RF4A 2NN6I 4LF9L 3ZJYC 5IYDG 1IXRA 4JI6L 5IYBG 4DUYQ 1W3SA 2JS4A 3JAMc 4EQ5A 4JI8L 5IWAQ 3S1QH 3A0JA 2VQFL 4LF4L 2JA8G 3J81b 3HOWI 1QVFA 3CCQZ 2CFMA 1PH9A 3CQZI 5IYDH 1VQM1 3PO2I 4NPSA 5IYBH 2J6AA 2F4OA 4NOZA 3I4OA 1XPRA 3I4MH 2ZM6L 1YJW1 3H3VJ 3M85A 1S721 1Z01A 1YHQZ 2QR1B 1VQ81 4LUVA 1KL9A 4PZ7A 2PK7A 4JI5Q 3I561 3H0GG 1MIUA 3G71Z 1X0TA 4A3FG 2UUCQ 1A62A 1EWIA 2GVBA 2JA8H 2E2HH 3NELA 2KHJA 2HHHQ 3MXNB 1SN8A 1O7IA 2B3GA 4GLVB 2VUMG 3HOVI 3NH5A 3PCOB 4JI7Q 3J81i 3A74A 3UE0A 4E32A 1BBUA 2YV5A 4JOIA 2HT1A 1TWFI 3VMIA 3H0GH 3PUWA 4OWXB 4A3FH 1OXSC 2WB1E 5C4XI 4O2DA 1PYSB 1VQL1 4OXPA 3M4PA 3AFPA 3J80b 2OCEA 5JJLA 3CCJ1 4JI1Q 4BA1I 2JEAI 1L1OC 4HGYA 3H3VI 2AWOA 2KHIA 4DV1Q 3J7A4 2A19A 2BA1A 1XMOL 1GO3E 2E2JI 3CCL1 2JA6I 1QVFZ 1OXXK 3L2PA 2K50A 4A3II 1OTCA 1EIFA 3S15H 3HOYI 3HKZE 3HKSA 1Y1VG 2JR6A 2GN5A 1WI5A 1K83H 3M9BA 3CCUA 4DUZQ 3NFZA 4LF5L 1KRLA 5LMNW 4BA2I 4OO1G 4JBJA 1V9PA 4HIKA 2JA7G 3W1GA 1U0LA 2C35B 4AIMA 4NBDA 3PUZA 4MD7A 3G4S1 1Y1VH 1ZH1A 2P28A 4DV7Q 5M5WH 1YI21 2Y0SG 1EQRA 4X66L 4GNXA 3H15A 1N32Q 2QGQA 2VF1A 2IZ4A 1G291 3RN2A 5T6BA 2UXCQ 3EIVA 1YIJ1 2JA7H 3S24A 1VQ4A 4NB8A 5M3MH 1NTGA 1N8RC 1PV4A 1KD11 1TWCI 2NN6G 3A5UA 1XMQQ 2VL6A 4RMFA 3L7ZC 5C4JH 5M5XH 5A2Qb 4JI3L 5IYCG 2E8GA 4MXUA 2L15A 3OYYA 3TS0A 2JQOA 1Q12A 1VQ5A 3CCQ1 4B3RL 4S1TA 4IPDA 3HOWG 1LUZA 4R4OA 1L2FA 1FJGQ 4OX9Q 2LXJA 4A3MI 3PO2G 5IP7I 3CCUZ 3CMAA 5IYCH 3E9IA 3G711 2YTXA 4DV0Q 3PIPA 3BZKA 4R4TA 2K3RA 4A3GH 1I94L 1EUJA 4X64Q 3CCV1 3K8AA 3HOWH 3CQZH 3HOZI 3U4ZA 3GTOI 3M4QA 4JI7L 3HOVG 2IHEA 3S1MI 1JT8A 4NB3A 4ALPA 3KLWA 2VQEL 4A3BI 2R6MA 4DV2L 3S14I 3MONA 4A3LI 4NB9A 4DV3L 4A93I 2UU9Q 3RZDI 2AMCB 2UUAQ 5C4XG 5GQOA 2R92I 4JI1L 4DR1Q 1VQDA 3PF5A 3HOVH 1B8AA 3PO3I 4IJLA 1KIXA 4YWMA 4NXNL 1X55A 3KYHC 1KRSA 2PM9A 2V1CC 3J81c 4DV4Q 1HNXL 4DV1L 1X3EA 1TWFH 3J7ZC 1VQ5Z 1Q822 4QJFA 1WOCA 4B3MQ 3S16I 4A3KI 5C4XH 1I6HI 2JA6G 2JEBI 4DAMA 4HGZA 4A3IG 1WYDA 4RVFA 1JB7A 3T1YQ 1X54A 1SMXA 1KQSA 3HOYG 4X65L 2M6NA 3JAMi 3H3VH 4DUZL 3M3YI 1Q812 1S40A 2YYZA 3CMAZ 3K7AH 3S1QI 2UXDQ 4A4IA 5C44H 3NDIA 2FXQA 2E2JH 4RVGA 4P74A 1VQJA 5AJ3Q 4A3IH 1M1K1 2HIVA 4B3SQ 3I4MI 1VQFA 4IO9A 4R4QA 3IRBA 2F3IA 2AWNA 1VQ91 2D62A 3JAMf 3J80c 1NMGA 1N36L 5FLXf 3F8TA 4QQBX 2K75A 2ZAEB 3T4NB 4DK6C 1HR0L 1UE6A 2K5RA 4XTCS 1MJCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PHJ A;  4YWL A;  4JBW A;  4OWT B;  1VQO A;  4LF6 Q;  2E2I H;  2WAQ G;  1B70 B;  1PH4 A;  1J5E L;  1USP A;  2A1A A;  4NBG A;  4B3T Q;  1AH9 A;  3B6Y A;  3KF6 A;  4KHP Q;  2JA5 I;  1TWC H;  5C3E I;  4DR6 Q;  1PFS A;  4PZ6 A;  4A3M G;  5IP7 G;  2IHF A;  1WCM I;  3A5Z B;  4NXM Q;  4LF7 Q;  1J6Q A;  2VNU D;  4UPA A;  3CCE A;  1N34 L;  4IPC A;  4A76 A;  1Y1W G;  1NE3 A;  4HID A;  1VQH A;  1R9T I;  3S15 I;  3PUV A;  3RLO A;  3HOX H;  3HOZ G;  1VQK A;  2I5L X;  1K83 I;  5C0X J;  4UP9 A;  1SRO A;  4A3M H;  5IP7 H;  3FP9 A;  3VDY A;  1GKH A;  3E0E A;  1VQP A;  3D6W A;  3F2B A;  4A3B G;  3GTM H;  4A3L G;  1Y14 B;  1Y1W H;  1CKN A;  2ZTD A;  2UUA L;  4L5R C;  3S2D H;  1VQB A;  5IE8 A;  4A93 G;  2ATW A;  2D0P A;  4JI4 L;  1E22 A;  3CC4 A;  2IX1 A;  2R92 G;  3HOZ H;  1IBL Q;  1EYG A;  3GTO H;  4NBH A;  2ASB A;  4QTT A;  3PO3 G;  4DV4 L;  4POF A;  1G6P A;  1VCI A;  1X3G A;  3CPW A;  4NBE A;  4QGU A;  2ZTE A;  2R93 H;  4YY3 L;  4B3M L;  1YEZ A;  3RZD H;  3D0F A;  1BVS A;  1I50 H;  4A3K G;  4QIW E;  2R92 H;  3L0O A;  5FLM H;  5C0X I;  3M7N A;  5C4J I;  2MFI A;  1CKM A;  2ZJQ A;  3PO3 H;  3U4V A;  1VQ7 A;  4K0K L;  3RNU A;  3RLF A;  4WJ3 M;  2UXD L;  4MH4 A;  1E3P A;  4QL5 A;  3CC7 A;  4FDB A;  2DE7 A;  3S16 H;  5AJ3 L;  4KI0 A;  4DKA C;  3BU2 A;  4DR5 L;  4TVA B;  4B3S L;  3TEH B;  3KDF A;  1HNW Q;  3I4M G;  3M3Y H;  4L5S A;  3VMH A;  1M1K C;  3CP0 A;  3CF5 A;  2E5L Q;  2CKZ B;  4DNI A;  4A3G I;  5FLX c;  4JOI C;  3VB9 A;  1GVP A;  3ULL A;  4HIM A;  1C0A A;  2OTL A;  1VQC A;  1VQI A;  4AYB G;  2R6G A;  1PH7 A;  4IPH A;  1D8L A;  1JMC A;  4B3T L;  4MNO A;  3PGZ A;  2QA4 A;  1ZB8 A;  3GTL H;  4QTU A;  5LMU Q;  4DR6 L;  1NMF A;  4GS3 A;  2JA5 G;  4GLA C;  5C3E G;  1SRU A;  1WCM G;  3EBE A;  4IFD J;  1HZC A;  1VQA A;  1QVG A;  3GDE A;  4JI0 L;  1WJJ A;  3ER0 A;  2DE6 A;  3PIO A;  4R4C A;  2N49 A;  2UUB Q;  1GD7 A;  1X3F A;  1OXV A;  2JA5 H;  5C3E H;  5BR8 L;  1XJV A;  3K81 C;  3K7A I;  3RR5 A;  5GAE C;  1WCM H;  2K5V A;  1V43 A;  2K14 A;  2ES2 A;  5C44 I;  1IL2 A;  2Y0S E;  4GNX C;  1HJP A;  2OTJ A;  3GD7 A;  1LQL A;  1R9T H;  1HNZ Q;  4JI2 Q;  3I2Z A;  4LFA Q;  1NJI C;  1YZ6 A;  4P75 A;  3J80 i;  4LWC A;  4IFD I;  1U5K A;  4DR2 Q;  1X3W A;  3UDI A;  4KHZ A;  3KF6 B;  4A3J H;  5M3M G;  1YNX A;  2WB1 G;  1S3O A;  4LF8 L;  4GN4 B;  4LFB L;  5C0X G;  4GN5 A;  2E2I I;  1T9H A;  1V1Q A;  1LTL A;  1NY4 A;  1Q86 C;  1SE8 A;  3G6E A;  1QUQ A;  3MEF A;  4BY7 I;  1NBW A;  2R7F A;  3Q87 A;  4GOP B;  5JJK A;  1ZB9 A;  3UE1 A;  3CW2 C;  4DUY L;  4HJ9 A;  3HFZ B;  1SLJ A;  3CCR A;  2HF1 A;  1YUA A;  1VQ6 A;  2RHS B;  1RIP A;  2CCZ A;  5IWA L;  3AQQ A;  1XTD A;  1CUK A;  1WW9 A;  1KXL A;  2KCT A;  2F4V Q;  4A3G G;  1HZ9 A;  4YWK A;  1XNR Q;  1OXT A;  1QZH A;  3HOX I;  1WFQ A;  4OON A;  3CD6 A;  4JI5 L;  3GTM I;  2LSS A;  4JV5 Q;  2UUC L;  1E1T A;  1PH6 A;  4BBR I;  1Y1W I;  3S2D I;  2HHH L;  3J81 j;  1K8A C;  4A3E I;  5IT9 c;  1XPU A;  1FGU A;  5LMU L;  4NBA A;  2B29 A;  4ME3 A;  3S2H H;  1TWA I;  3ULJ A;  3D31 A;  2KCM A;  1ASZ A;  1HH2 P;  2QEX A;  1JJ2 A;  3FKI I;  2K4K A;  2R93 I;  1PH3 A;  3S1N H;  4PZ8 A;  3ULP A;  1I50 I;  3KF8 B;  1RO4 A;  1MKH A;  5FLM I;  2JJQ A;  4AQY Q;  1IZ6 A;  2N78 A;  1Q7Y C;  3DLL A;  3RN5 A;  2NVQ H;  5C44 G;  1N2F A;  5ELN A;  3SGI A;  1VQM A;  1HZB A;  3K7U C;  1YJW A;  4LFA L;  4NBC A;  4OWW B;  1S72 A;  4YCU A;  3I7F A;  3I56 A;  3NBH B;  2Z6K C;  3DM3 A;  5JEA J;  2Q2U A;  4DR2 L;  3RZO H;  4IFD G;  3LUS A;  4YHH Q;  5LMN Q;  4LFC Q;  1XNQ Q;  4HJA A;  3PSI A;  4UP7 A;  4DV7 L;  3T1H Q;  3PV0 A;  2BA0 A;  2VS1 A;  1N32 L;  3BJU A;  1KHI A;  2P3Y A;  3TS2 A;  1H95 A;  1VQL A;  2UXC L;  1K0R A;  2B63 H;  2R7D A;  2NZO A;  3CCJ A;  4BY7 G;  4JI6 Q;  5H1S E;  3GTL I;  5E7N A;  1XMQ L;  1QVC A;  4JI8 Q;  2VQF Q;  1TFI A;  1Q82 C;  4LF4 Q;  1RLY A;  5GAG C;  4GOP C;  3LGJ A;  3CCL A;  1PH2 A;  2RBL A;  3I4N I;  1FVI A;  4BY7 H;  5GAH C;  1XNR L;  3NEN A;  3KJO A;  4A75 A;  1FJG L;  2AKL A;  4OX9 L;  1K9M C;  1UE1 A;  3HOX G;  4A3C I;  1BKB A;  4C3J H;  1SFO I;  4QY7 A;  4DV0 L;  4IOA A;  4JV5 L;  4HJ7 A;  4HJ8 A;  1PH1 A;  3ICE A;  4X64 L;  3EER A;  4BBR G;  2DE5 A;  2ID0 A;  3G4S A;  4DR3 Q;  1YJ9 A;  4A3E G;  1YI2 A;  1TWG I;  4GNX B;  1A8V A;  5JJI A;  2WFW A;  1YIJ A;  2OWO A;  1YJN A;  4BBS H;  3UDF A;  2UU9 L;  4A3J I;  3FKI G;  4BBR H;  2BH8 A;  1K73 C;  2R93 G;  2IX0 A;  5HY6 A;  4A3E H;  4DR1 L;  5FLM G;  4Y7N H;  2H5X A;  4NBB A;  3ESW A;  1TWA H;  3GTG I;  2VZA A;  4HJ5 A;  4TQU S;  3FKI H;  2A8V A;  1FL0 A;  4XX2 A;  4X62 Q;  3T1Y L;  1PVO A;  1NUI A;  4IJH A;  1C7Y A;  2GVA A;  3GTQ H;  3G71 A;  2R7Z I;  1K8G A;  2JK8 A;  1KC8 C;  4H02 A;  4GLX A;  3CCV A;  3F1Z A;  2YU9 I;  4L5Q A;  1X9N A;  4JYA Q;  3GKQ A;  5LMN L;  4LFC L;  4YHH L;  3UDX A;  5EAY A;  1XNQ L;  4UP8 A;  4LW1 A;  3S1R H;  2MQH A;  4C2M H;  4KLK A;  4X6A H;  4DR7 Q;  4LUO A;  1HR0 W;  1TWH H;  1X3Z A;  5M5Y H;  2JA9 A;  5HGQ A;  1P8L A;  4Y52 I;  2AHO B;  1A0I A;  1PA6 A;  4JI3 Q;  3S2H I;  2BH2 A;  1IYJ B;  4LF6 L;  2PNH A;  5JEA G;  1Y1V S;  4B3R Q;  1MJE A;  4C3H H;  2MNA A;  3BZC A;  1N33 Q;  1X56 A;  2EXD A;  1JJG A;  3GTJ H;  3STB C;  4P73 A;  3S1N I;  2Q2T A;  3I4N G;  4KHP L;  2PI2 A;  2NVX I;  3G48 A;  2NVT I;  3W5O A;  4NXM L;  3S17 I;  3UDG A;  4LF7 L;  4A3C G;  2UXB Q;  1I94 Q;  3M4O I;  2MO1 A;  2NVQ I;  1HZA A;  1VQE A;  1CKO A;  3OTO Q;  1LM0 A;  2I0Q A;  3I4N H;  4DR3 L;  1OXU A;  4JBK A;  2Q2H A;  1RL2 A;  3AYH B;  2VQE Q;  1VQ9 A;  4DV2 Q;  5GAD C;  1N9W A;  4DPG A;  1AE2 A;  1E1O A;  4DV3 Q;  4A3C H;  1SFO H;  1E7Z A;  3RZO I;  4DK3 C;  1KAW A;  2VUM H;  1L0W A;  4JG2 A;  4A3J G;  4NXN Q;  3CCM A;  2IT1 A;  1HNX Q;  1IBL L;  1VQN A;  3PUX A;  1LYL A;  1TWG H;  3CC2 A;  1EIY B;  4R4I A;  4LUZ A;  4C3I H;  1USP B;  2B63 I;  2PQA A;  4NBF A;  4X62 L;  2DGY A;  2LXK A;  3STB D;  3F2D A;  1DL6 A;  2YTY A;  1UE7 A;  3HOU I;  4X65 Q;  4UY8 C;  4DR4 Q;  3RLN A;  4JC0 A;  1L1O A;  2R7Z G;  1VS0 A;  4MZ9 A;  2YTV A;  3GTG H;  3I07 A;  4JYA L;  1VLA A;  2K52 A;  3CME A;  3E9H A;  4P72 A;  2NVY H;  3CPF A;  3PF4 A;  1E24 A;  1HNW L;  3TRE A;  4O0A A;  3GTK H;  3HKZ G;  2R7Z H;  1N36 Q;  2E5L L;  1YBY A;  4DR7 L;  2RHQ B;  1CKN B;  2YU9 H;  1CSQ A;  3I55 A;  5M3F G;  1HR0 Q;  1Q46 A;  3FHW A;  5IP9 I;  1QZG A;  2Z0S A;  4XIG S;  1BBW A;  1G51 A;  4APV A;  2CQO A;  1ML8 A;  3CXC A;  2I5H A;  5FJ8 G;  2CWP A;  3TRZ A;  1J5E Q;  1ASY A;  4MTN A;  2KBN A;  5J3B A;  3KJP A;  3GTP H;  4DV6 Q;  4BBS I;  4L5T A;  1N33 L;  1IBK Q;  5M3F H;  2F4M A;  3AEV A;  1B7Y B;  2EIF A;  1I3Q I;  3J7A 5;  1KRT A;  1W2B A;  4Y7N I;  4Y52 H;  5FJ8 H;  1N34 Q;  1YVC A;  2UXB L;  2KPI A;  4PMW A;  3OTO L;  1JJC B;  1AE3 A;  3PO2 H;  5CM2 M;  1XPO A;  3K0X A;  2F52 A;  2UUB L;  3KDF B;  2NVX H;  3GTQ I;  3JC6 6;  1UEB A;  4YCW A;  1UWV A;  2PI2 E;  2NVT H;  2EQS A;  1Q1B A;  3OW2 A;  3S17 H;  4BY1 I;  2XGT A;  3M4O H;  4JI4 Q;  2K5N A;  1PYB A;  1PH8 A;  1X65 A;  4YCV A;  1HNZ L;  4JI2 L;  1IBM Q;  4A3D I;  3S1R I;  2WP8 J;  4RG1 A;  1VQ8 A;  4BXX I;  1PH5 A;  4GKJ Q;  4X6A I;  1YHB A;  4YY3 Q;  4HIO A;  1EQQ A;  4GN3 B;  1TWH I;  3F2C A;  3KFU A;  2B63 G;  2WAQ E;  1D7Q A;  2I5M X;  3GTM S;  3Q8D A;  4K0K Q;  3HOU G;  2RCN A;  4DR4 L;  4LNQ A;  1EFW A;  2ALY B;  3CCS A;  4DV5 Q;  2JA6 H;  2NZH A;  2D0O A;  1A63 A;  3GTJ I;  4EX5 A;  4GKK Q;  2JNY A;  4DR5 Q;  4LF9 Q;  1PFT A;  3HOY H;  1Z47 A;  2JE6 I;  1GM5 A;  3HOU H;  3WWV A;  2VY3 A;  2JA8 I;  2E2H I;  4PG3 A;  2VW9 A;  2HQL A;  4J15 A;  3PO3 S;  2Z6K A;  2F4V L;  3GCF A;  3NEM A;  3PUY A;  1CSP A;  4WJ4 A;  2OQK A;  1Q81 C;  5IP9 G;  2ZM6 Q;  3H0G I;  4A3F I;  1TXY A;  1YIT A;  4DAY B;  3U50 C;  1KD1 C;  3EN2 A;  2IY5 B;  4DV6 L;  2PQA B;  1IBK L;  2VUM I;  3KOJ A;  3ERS X;  4BBS G;  2KEN A;  4P71 A;  4JBM A;  4JCV E;  1EOV A;  5IP9 H;  2ZJR A;  2N8N A;  4POG A;  4AH6 A;  1L1O B;  1DGS A;  5GRO A;  2K5H A;  2CWA A;  1QUQ B;  4JI0 Q;  4IPG A;  3GO5 A;  2PMZ E;  2ZTC A;  4GOP A;  3CAM A;  4IOC A;  1I3Q H;  1Z9F A;  5BR8 Q;  4AQY L;  2DUD A;  2OQ0 A;  2BJO A;  1QYP A;  1X6O A;  4R1J A;  2MO0 A;  1XMO Q;  3CCQ A;  3W1B A;  5ELO A;  4BY1 G;  1Y1V I;  3U58 A;  2Q2I A;  1VQG A;  2NVY I;  1YHQ A;  2N3S A;  3S1M H;  2ZJP A;  1IBM L;  4LF5 Q;  4A3B H;  3GTK I;  1M90 C;  1C9O A;  5DLQ E;  3S14 H;  4GKJ L;  4OO1 I;  4A3D G;  5IY0 A;  4A3L H;  2JA7 I;  4BXX G;  2AKW B;  4A93 H;  2XTI A;  1YHA A;  2HIX A;  4BY1 H;  3TQY A;  4AYB E;  4LF8 Q;  1UE5 A;  3VMG A;  4LFB Q;  1K3R A;  3T1H L;  4X66 Q;  1I5F A;  3K80 C;  4A3D H;  5K36 G;  1P16 A;  1Q8K A;  4BXX H;  1Q1E A;  4DV5 L;  3AFQ A;  1JE5 A;  3GTP I;  1SR3 A;  4A3K H;  1I6H H;  4GKK L;  2RF4 A;  2NN6 I;  4LF9 L;  3ZJY C;  5IYD G;  1IXR A;  4JI6 L;  5IYB G;  4DUY Q;  1W3S A;  2JS4 A;  3JAM c;  4EQ5 A;  4JI8 L;  5IWA Q;  3S1Q H;  3A0J A;  2VQF L;  4LF4 L;  2JA8 G;  3HOW I;  1QVF A;  2CFM A;  1PH9 A;  3CQZ I;  5IYD H;  3PO2 I;  4NPS A;  5IYB H;  2J6A A;  2F4O A;  4NOZ A;  3I4O A;  1XPR A;  3I4M H;  3H3V J;  2ZM6 L;  3M85 A;  4LUV A;  1KL9 A;  4PZ7 A;  2PK7 A;  4JI5 Q;  3H0G G;  1MIU A;  4A3F G;  2UUC Q;  1A62 A;  1EWI A;  2GVB A;  2JA8 H;  2E2H H;  3NEL A;  2KHJ A;  2HHH Q;  3MXN B;  1SN8 A;  1O7I A;  2B3G A;  4GLV B;  2VUM G;  3HOV I;  3PCO B;  4JI7 Q;  3J81 i;  3A74 A;  3UE0 A;  1BBU A;  2YV5 A;  4JOI A;  2HT1 A;  1TWF I;  3VMI A;  3H0G H;  3PUW A;  4OWX B;  4A3F H;  1OXS C;  2WB1 E;  5C4X I;  4O2D A;  1PYS B;  4OXP A;  3M4P A;  3AFP A;  2OCE A;  5JJL A;  4JI1 Q;  4BA1 I;  2JEA I;  1L1O C;  3H3V I;  2AWO A;  2KHI A;  4DV1 Q;  2A19 A;  2BA1 A;  1XMO L;  1GO3 E;  2E2J I;  2JA6 I;  1OXX K;  3L2P A;  2K50 A;  4A3I I;  1OTC A;  1EIF A;  3S15 H;  3HOY I;  3HKZ E;  3HKS A;  1Y1V G;  2JR6 A;  2GN5 A;  1WI5 A;  1K83 H;  3M9B A;  3CCU A;  4DUZ Q;  4LF5 L;  5LMN W;  4BA2 I;  4OO1 G;  4JBJ A;  1V9P A;  4HIK A;  2JA7 G;  3W1G A;  1U0L A;  2C35 B;  4AIM A;  4NBD A;  3PUZ A;  1Y1V H;  4DV7 Q;  5M5W H;  2Y0S G;  1EQR A;  4X66 L;  4GNX A;  3H15 A;  1N32 Q;  2QGQ A;  1G29 1;  3RN2 A;  2UXC Q;  3EIV A;  2JA7 H;  3S24 A;  1VQ4 A;  4NB8 A;  5M3M H;  1NTG A;  1N8R C;  1PV4 A;  1TWC I;  2NN6 G;  3A5U A;  1XMQ Q;  2VL6 A;  4RMF A;  3L7Z C;  5C4J H;  5M5X H;  4JI3 L;  5IYC G;  2E8G A;  2L15 A;  3OYY A;  3TS0 A;  2JQO A;  1Q12 A;  1VQ5 A;  4B3R L;  4IPD A;  3HOW G;  1LUZ A;  4R4O A;  1L2F A;  1FJG Q;  4OX9 Q;  2LXJ A;  4A3M I;  3PO2 G;  5IP7 I;  3CMA A;  5IYC H;  3E9I A;  2YTX A;  4DV0 Q;  3PIP A;  3BZK A;  4R4T A;  4A3G H;  1I94 L;  1EUJ A;  4X64 Q;  3K8A A;  3HOW H;  3CQZ H;  3HOZ I;  3U4Z A;  3GTO I;  3M4Q A;  4JI7 L;  3HOV G;  2IHE A;  3S1M I;  1JT8 A;  4NB3 A;  4ALP A;  3KLW A;  2VQE L;  4A3B I;  4DV2 L;  3S14 I;  4A3L I;  4NB9 A;  4DV3 L;  4A93 I;  2UU9 Q;  3RZD I;  2AMC B;  2UUA Q;  5C4X G;  5GQO A;  2R92 I;  4JI1 L;  4DR1 Q;  1VQD A;  3PF5 A;  3HOV H;  1B8A A;  3PO3 I;  4IJL A;  1KIX A;  4YWM A;  4NXN L;  1X55 A;  3KYH C;  1KRS A;  2V1C C;  3J81 c;  4DV4 Q;  1HNX L;  4DV1 L;  1X3E A;  1TWF H;  3J7Z C;  4QJF A;  1WOC A;  4B3M Q;  3S16 I;  4A3K I;  5C4X H;  1I6H I;  2JA6 G;  2JEB I;  4DAM A;  4A3I G;  1WYD A;  1JB7 A;  3T1Y Q;  1X54 A;  1SMX A;  1KQS A;  3HOY G;  4X65 L;  3JAM i;  3H3V H;  3M3Y I;  4DUZ L;  1S40 A;  2YYZ A;  3K7A H;  3S1Q I;  2UXD Q;  4A4I A;  5C44 H;  2FXQ A;  2E2J H;  4P74 A;  1VQJ A;  5AJ3 Q;  4A3I H;  2HIV A;  4B3S Q;  3I4M I;  1VQF A;  4IO9 A;  4R4Q A;  3IRB A;  2F3I A;  2AWN A;  2D62 A;  3J80 c;  1NMG A;  1N36 L;  3F8T A;  4QQB X;  2K75 A;  4DK6 C;  1HR0 L;  1UE6 A;  2K5R A;  4XTC S;  1MJC A; 
#chains in the Genus database with same CATH topology
 2N88 A;  2V8I A;  1PHJ A;  4RHR A;  4YWL A;  4IQZ A;  5D3D A;  2QRE B;  1VQN 1;  3Q0A A;  4JBW A;  4OWT B;  1VQO A;  1WD1 A;  2E2I H;  4LF6 Q;  2WAQ G;  5D14 A;  2L12 A;  3HOX B;  1SE4 A;  3CC2 1;  2PNR C;  4XXE A;  4G7Z C;  2V4D A;  1B70 B;  1EZ8 A;  1PH4 A;  1J5E L;  1LLR D;  1USP A;  2A1A A;  5CYU A;  2WV6 D;  4IUT A;  1HA5 A;  4NBG A;  4B3T Q;  1AH9 A;  1CQF A;  3B6Y A;  3GTM B;  3KF6 A;  4KHP Q;  3TDH B;  2V45 A;  2EOT A;  1ZYR C;  2EYO A;  1Y1W B;  3S2D B;  2JA5 I;  2PZU A;  1TWC H;  5EPJ A;  5C3E I;  4DR6 Q;  1KQS Z;  1PFS A;  4PZ6 A;  5IT9 L;  3VR6 A;  4A3M G;  3R93 A;  2NBF A;  2IHF A;  4G4K A;  5IP7 G;  1WCM I;  3A5Z B;  1IYU A;  4NXM Q;  3HOZ B;  5DAU A;  2Y0S A;  4LF7 Q;  2RT9 A;  1J6Q A;  2VNU D;  4UPA A;  3CCE A;  1N34 L;  4IPC A;  1M90 2;  1YNJ C;  2ZM6 L;  1TWA B;  2AQ1 B;  1IW7 D;  4A76 A;  5KYI A;  1GHK A;  1Y1W G;  1NE3 A;  4HID A;  1ICW A;  3CME 1;  1VQH A;  3FKI B;  1R9T I;  3S15 I;  2R93 B;  3DWQ A;  3NUC A;  3PUV A;  4J8Q A;  1G91 A;  3RLO A;  3HOX H;  3RZD B;  3HOZ G;  1VQK A;  2I5L X;  1K83 I;  2AUK A;  4UP9 A;  5C0X J;  1I50 B;  1SRO A;  1ENF A;  3QIA A;  5IP7 H;  4A3M H;  4QB4 A;  3FP9 A;  2R92 B;  3VDY A;  1GKH A;  3E0E A;  2FJ2 A;  1VQP A;  3TBI B;  3D6W A;  5IT9 E;  3F2B A;  5A35 A;  3PO3 B;  4A3B G;  3GTM H;  1NJI 1;  4DK0 A;  2HDL A;  2Z1C A;  3Q6S A;  2X69 A;  4MRI A;  4A3L G;  2VUG A;  1Y14 B;  4U68 A;  1H9S B;  5FO7 B;  1Y1W H;  1CKN A;  2ZTD A;  2UUA L;  4L5R C;  1UEA B;  1VQB A;  5IE8 A;  3S2D H;  4A93 G;  2ATW A;  2CH4 A;  2D0P A;  4JI4 L;  3I55 1;  1EEF D;  4KY6 A;  4JK1 C;  1RTO A;  1E22 A;  3CC4 A;  2IX1 A;  2R92 G;  3HOZ H;  1TS4 A;  1IBL Q;  1SYG A;  1EYG A;  1CK1 A;  3S16 B;  3GTO H;  4NBH A;  3CXC Y;  2ASB A;  5EKK A;  1STH A;  4QTT A;  1UUP A;  3PO3 G;  5TSS A;  4DV4 L;  2K01 A;  4POF A;  1G6P A;  1WVL A;  3A54 A;  3R2I A;  1VCI A;  2PMZ B;  1X3G A;  3CPW A;  4NBE A;  5I2Y A;  1RQF A;  2ZTE A;  4QGU A;  4C2M B;  2CVR A;  2R93 H;  4YY3 L;  4B3M L;  2LKV A;  1YEZ A;  3M7G A;  3RZD H;  3D0F A;  2XWB B;  5I6W A;  1BVS A;  1I50 H;  4A3K G;  4QIW E;  1MI2 A;  2R92 H;  1Q86 1;  1B3Q A;  4ZLT F;  3L0O A;  2RBM A;  5J39 A;  5FLM H;  2LIY A;  5C0X I;  1W2B Y;  5CV9 A;  3M7N A;  5C4J I;  2MFI A;  1CKM A;  1NCV A;  2F0Q A;  2ZJQ A;  2HCI A;  4KJN A;  3PO3 H;  1FNU A;  2Q51 A;  5KGU A;  3U4V A;  1VQ7 A;  4K0K L;  3K59 A;  3RNU A;  5IT9 b;  1HRJ A;  1B9N A;  4NDX A;  2EY2 A;  3RLF A;  5C6A A;  2UXD L;  4WJ3 M;  2DJF C;  1X3Q A;  4MH4 A;  3CCE Z;  1E3P A;  1NUC A;  4QL5 A;  4ME5 A;  2EE1 A;  2O53 A;  1YNJ D;  3FPU B;  1W6K A;  2SDF A;  4RCN A;  4CKE A;  4DFA A;  1EFI D;  3CC7 A;  4FDB A;  2DE7 A;  2WKD A;  2CW0 C;  3S16 H;  2IV2 X;  5AJ3 L;  1FNV A;  2OOY B;  4KI0 A;  5JPN C;  4DKA C;  2KHS A;  3BU2 A;  4DR5 L;  3J7Y W;  3VA7 A;  4TVA B;  2F0L A;  4JW0 A;  4B3S L;  1W6J A;  3TEH B;  1VQK Z;  1HFN A;  3KDF A;  1HNW Q;  4O1N A;  1SNM A;  2H85 A;  3I4M G;  3M3Y H;  4L5S A;  1Z03 A;  3GTL B;  3VMH A;  4MD8 A;  1VQP Z;  1L0X B;  2RVL A;  1A2T A;  1M1K C;  3CP0 A;  3OW2 Y;  3CF5 A;  1FR3 A;  5J22 A;  2E5L Q;  1IKM A;  2F0T A;  2PW7 A;  2CKZ B;  4FVM A;  5BN4 A;  4DNI A;  4AYB B;  4A3G I;  4XT3 B;  3IFU A;  5FLX c;  3FMC A;  4RH6 A;  3DMU A;  4JOI C;  3VB9 A;  1GVP A;  1D1I A;  3ULL A;  1HFG A;  4HIM A;  1C0A A;  4KY5 A;  4GZY C;  2OTL A;  4ZUJ A;  4EQP A;  3I4N B;  2K32 A;  2W03 A;  1SXT A;  4X3U A;  2KOL A;  1VQC A;  1VQI A;  4AYB G;  2N55 A;  1PRT C;  2R6G A;  1K8A 1;  1PH7 A;  5EPK A;  5EKL A;  3K5L A;  1PDQ A;  3CPW Z;  4I65 A;  5C3E B;  5T1I A;  4IPH A;  1D8L A;  2O4X A;  1JMC A;  4B3T L;  4XQJ A;  4MNO A;  3PGZ A;  2LEX A;  2QA4 A;  3IR7 A;  3IF8 A;  4EGV A;  1ZB8 A;  3BG3 A;  3EJI A;  3C46 A;  3GTL H;  1CQV A;  1SNP A;  1LAB A;  4QTU A;  2F0O A;  5LMU Q;  4DR6 L;  1NMF A;  2B2W C;  4GS3 A;  2JA5 G;  3HG9 A;  4GLA C;  1VQ7 Z;  1B3A A;  5C3E G;  1G2T A;  1SJH D;  1SRU A;  5JEA H;  1R9T B;  5KNC A;  4ZK9 B;  1V1P B;  2F0J A;  1WCM G;  1A3V A;  2NAP A;  3CCS 1;  2JN4 A;  2K5Q A;  1HZC A;  1VQA A;  3EBE A;  4IFD J;  4RS4 A;  4C3I B;  1QVG A;  2F0G A;  3QB3 A;  3WOE A;  1K28 A;  3CC7 Z;  3VTN A;  3GDE A;  4KMU C;  4JI0 L;  1WJJ A;  1SJE D;  4E31 A;  3ER0 A;  4HCS A;  2CW0 D;  2DE6 A;  3PIO A;  1Q7Y 1;  4R4C A;  2N49 A;  2UUB Q;  1GD7 A;  1I6V C;  1X3F A;  1U4R A;  2KVM A;  4A3J B;  1OXV A;  3CU7 A;  2JA5 H;  1HXY D;  3BG1 B;  5C3E H;  5BR8 L;  1XJV A;  3K81 C;  2HU9 A;  2WII B;  3K7A I;  3IFD A;  3NK9 A;  3RR5 A;  3NQT A;  5GAE C;  1WCM H;  2K5V A;  3J81 f;  1E2Z A;  2J4X A;  1V43 A;  2LMC B;  2K14 A;  2ES2 A;  2I07 B;  4RAU C;  1STN A;  5C44 I;  3Q24 A;  2K6A A;  1SNO A;  2K1B A;  2QKI C;  1IL2 A;  2Y0S E;  4GNX C;  1XXG A;  3RUZ A;  2F0I A;  3OMG A;  2QEJ C;  1CZW A;  1Y69 U;  1II3 A;  4NKL A;  1HJP A;  5IGG A;  2QRD B;  1M4V A;  2OTJ A;  3GD7 A;  2IL8 A;  1LQL A;  1N8R 2;  5FOB B;  1R9T H;  1HNZ Q;  4JI2 Q;  2PYK A;  2PO4 A;  2OTL Z;  3I2Z A;  4LFA Q;  1YNN C;  1NJI C;  1RJT A;  3A56 A;  1YZ6 A;  4P75 A;  3J80 i;  4DAY A;  4LWC A;  1YIT 1;  2Z4H A;  4IFD I;  1U5K A;  4DR2 Q;  1X3W A;  5A2Q E;  1WTH A;  3NWS A;  1A2U A;  5F2D A;  4I7Z C;  3UDI A;  2X6L A;  5COR A;  2R7Z B;  4KHZ A;  3KF6 B;  4A3J H;  4B9X A;  1EQV A;  2OZK A;  5M3M G;  2QA4 Z;  1YNX A;  2WB1 G;  2SOB A;  1S3O A;  4LF8 L;  3D8G A;  3HRZ C;  3A7A B;  4GN4 B;  1K8O A;  2A73 B;  1DON A;  4LFB L;  5C0X G;  3LWE A;  3I73 A;  4GN5 A;  2E2I I;  1T9H A;  1V1Q A;  2E9H A;  1IKL A;  1LTL A;  1NY4 A;  3GV6 A;  1Q86 C;  3UI2 A;  1SE8 A;  3J80 f;  3HKZ B;  1LTG D;  3G6E A;  1QUQ A;  3MEF A;  2EYL A;  4BY7 I;  1STA A;  1QVG Z;  1Z02 A;  4DGZ A;  1NBW A;  2WIN B;  5COY A;  4KJO A;  4PMC A;  5CBE E;  2R7F A;  1WTO A;  3Q87 A;  1KDC A;  2I3C A;  4GOP B;  5M3F B;  1BO0 A;  4R8N A;  5JJK A;  1ZB9 A;  3UE1 A;  3CW2 C;  4DUY L;  4HJ9 A;  5C0X H;  3HFZ B;  1SLJ A;  3CCR A;  2HF1 A;  1YUA A;  5I9O A;  1VQ6 A;  2IPK D;  2RHS B;  1ONL A;  3BZD B;  1VQP 1;  2D2C C;  1RIP A;  3HGB A;  3T53 B;  4CKB A;  2CCZ A;  2LS0 1;  4MD9 A;  1LV9 A;  5IWA L;  2L0C A;  3AQQ A;  1KLG D;  1Y8O B;  3S2H B;  1PYW D;  1S5D D;  1XTD A;  1K9M 1;  1CUK A;  1WW9 A;  1CA5 A;  4FYD A;  1KXL A;  2KCT A;  5ISR A;  2F4V Q;  2DNE A;  2AQ2 B;  4K14 A;  4A3G G;  2RDF A;  4NW2 A;  2VPX A;  1HZ9 A;  2KEE A;  4YWK A;  1XNR Q;  4U67 3;  2VPZ A;  2OTJ Z;  1OXT A;  2M00 A;  1TII D;  1QZH A;  3HOX I;  1WFQ A;  3S1N B;  1ILP A;  5HGT A;  1YNN D;  4E2X A;  1YHQ 1;  4HED A;  1TS3 A;  1F2M A;  4OON A;  1BF4 A;  1TU2 B;  4K2L A;  1O7L A;  3CD6 A;  3MFG A;  1EWC A;  4JI5 L;  4E2Y A;  3GTM I;  2LSS A;  4JV5 Q;  2UUC L;  1E1T A;  1PH6 A;  3M4Y A;  1TS2 A;  4BBR I;  4N8X 1;  4RA8 A;  1Y1W I;  3S2D I;  2P5Z X;  3MXG A;  3BG0 B;  5EQ0 A;  3J81 j;  4HCE A;  2HHH L;  3M4O B;  1Q90 A;  1K8A C;  2NVQ B;  4A3E I;  5IT9 c;  2EJG C;  1XPU A;  1FGU A;  5LMU L;  4QMG A;  4NBA A;  5LL6 f;  2B29 A;  1K73 1;  4ME3 A;  3S2H H;  1TWA I;  1PZI D;  1D6E C;  3ULJ A;  3D31 A;  2KCM A;  1AZQ A;  2BDN A;  1ASZ A;  3ND8 A;  3V2T A;  1HH2 P;  2QEX A;  1BCP B;  1VF7 A;  2J0T D;  1TY2 A;  1JJ2 A;  1SEB D;  3FKI I;  1DOM A;  3G6E Z;  2K4K A;  2R93 I;  4LJZ C;  1PH3 A;  1JOO A;  2C5C A;  1VQ4 Z;  3FQQ A;  5D1O B;  3S1N H;  4WOR A;  4PZ8 A;  3ULP A;  1I50 I;  3KF8 B;  3QO2 A;  2O4H A;  3L3O C;  3RZO B;  1RO4 A;  3NH8 A;  1MKH A;  1RD9 D;  2NWG A;  5FLM I;  2JJQ A;  1DOL A;  1WTW A;  2K5W A;  5A2Q f;  1PTO F;  2HDM A;  2PPB C;  4AQY Q;  3TSS A;  1VQ6 Z;  1IZ6 A;  3ZYY X;  3A55 A;  4KD4 A;  3C1F A;  2B2Y A;  2N78 A;  3OWF A;  2YAD A;  4TSS A;  4CL1 A;  4KD3 A;  1Q7Y C;  2EPB A;  1JCK B;  3DLL A;  2CH4 W;  5G3L D;  3RN5 A;  3OWE B;  2F3W A;  1SDF A;  1QVF Y;  2NVQ H;  1JOR A;  2AYD A;  5C44 G;  1BDO A;  1N2F A;  5ELN A;  3SGI A;  1VQM A;  1FDI A;  1HZB A;  4K6D A;  1KC8 1;  1H9R A;  1FDO A;  1SMY C;  3G7L A;  3K7U C;  5EBC A;  3H6M A;  1YJW A;  4NBC A;  4LFA L;  4OWW B;  1S72 A;  2B63 B;  1EQT A;  4YCU A;  3I7F A;  3TDQ A;  3FRP B;  3I56 A;  3NBH B;  4RV9 A;  2Z6K C;  2Q8R E;  3DM3 A;  2A6H C;  5JEA J;  3KUP A;  3CD6 Z;  5DM6 3;  2Q2U A;  4DR2 L;  3ONA B;  1SBB B;  2D9U A;  4RVH A;  3NTI A;  4H7B A;  3RZO H;  4IFD G;  4E2W A;  1KD1 2;  3MXP A;  1STG A;  1S7M A;  2W04 A;  3F3F C;  3LUS A;  1JB3 A;  3VYU A;  4YHH Q;  5LMN Q;  4LFC Q;  3MXN A;  4EQO A;  4V19 0;  3MEH A;  1JC7 A;  1XNQ Q;  3A8K E;  4HJA A;  4G57 A;  3SK4 A;  3T56 B;  3PSI A;  4UP7 A;  5JJZ A;  1ICF B;  4DV7 L;  3T1H Q;  5K5P A;  4HH4 A;  2L4N A;  5FO8 B;  2GTH A;  1H9K A;  3PV0 A;  2BA0 A;  4MHE A;  2VS1 A;  3C1E A;  2QEX Z;  1EYD A;  3MHB A;  1N32 L;  3BJU A;  1KHI A;  2P3Y A;  3TS2 A;  1JJ2 Z;  1H95 A;  1VQL A;  4C3J B;  4H13 C;  2UXC L;  4F87 A;  1K0R A;  1D2B A;  1LT3 D;  2B63 H;  2R7D A;  2NZO A;  3CCJ A;  1PRT B;  4BY7 G;  2J7Z A;  1C48 A;  4JI6 Q;  4RFB A;  5H1S E;  3GTL I;  1KAA A;  2PZW A;  4X3S A;  5E7N A;  1XMQ L;  1QVC A;  2L5T A;  5BN3 A;  4JI8 Q;  3GV3 A;  1TS5 A;  4M8A A;  3VR2 A;  2VQF Q;  2Z8L A;  1TFI A;  3TE5 B;  5ELD A;  1Q82 C;  4C3J G;  4LF4 Q;  3HS0 C;  1RLY A;  2HQE A;  5DM7 3;  5GAG C;  5C4Z A;  4NFR A;  1MHW C;  4GOP C;  1B53 A;  2JXM B;  3LGJ A;  3NWT A;  3CCL A;  1PH2 A;  4KK7 A;  2RBL A;  2VB2 X;  4OHJ A;  3I4N I;  1I4Q A;  1FVI A;  4BY7 H;  5GAH C;  3SHL A;  1VQM Z;  1SYE A;  3DEP A;  1XNR L;  5IGF A;  3NEN A;  4BBS B;  2Z6B A;  3QJY A;  3KJO A;  4A75 A;  4BBR B;  1FJG L;  1YJW Z;  2AKL A;  1SMY D;  1S72 Z;  4OX9 L;  1NAP A;  1K9M C;  4G7O C;  3CCU 1;  1UE1 A;  3HOX G;  2IJ0 A;  4A3C I;  1BKB A;  3I56 Z;  4C3J H;  1AZP A;  4A3E B;  1SSO A;  1SFO I;  4QY7 A;  3OIP A;  3KIF A;  2A6H D;  4Y7N B;  4DV0 L;  4IOA A;  4JV5 L;  3RMH A;  4HJ7 A;  2Q8T A;  3U9S A;  4HJ8 A;  2F1M A;  1PH1 A;  5E1F A;  3ICE A;  4X64 L;  3EER A;  1ENC A;  3D9X A;  2FMM A;  4BBR G;  4PNY A;  2DE5 A;  2ID0 A;  3G4S A;  1EYC A;  4K5V A;  1S5F D;  4DR3 Q;  4ZUI A;  3AB9 A;  4DXF A;  1YJ9 A;  5IOD A;  4A3E G;  1YI2 A;  1TWG I;  4GNX B;  1A8V A;  4ZQ3 A;  5JJI A;  3MAQ A;  5JVH 3;  4LK1 C;  3Q22 A;  2F0N A;  2WFW A;  4H0L C;  2XIW A;  3VR3 A;  1YIJ A;  2OWO A;  3GTQ B;  4R9W A;  1VQL Z;  2XRS D;  1YJN A;  4BBS H;  1VQ4 1;  2RDH A;  3UDF A;  2UU9 L;  4A3J I;  3FKI G;  3IL8 A;  2BH8 A;  4BBR H;  1K73 C;  3E6Z X;  2R93 G;  2IX0 A;  5HY6 A;  3CCJ Z;  1STB A;  1TKW B;  1ML0 D;  4BY1 B;  3E5S A;  1BCP C;  1EU3 A;  1EWH A;  2CHB D;  2NUC A;  4A3E H;  3I91 A;  4DR1 L;  5EKI A;  1VQ6 1;  5FLM G;  4Y7N H;  2QF7 A;  4R8I A;  2V3V A;  5KIX A;  2H5X A;  4EQN A;  4NBB A;  3ESW A;  3IX0 A;  1TWA H;  1EU4 A;  1VQO Z;  1IHZ A;  3GTG I;  4OEL B;  2RCF A;  1M1K 2;  2Z9H A;  2VZA A;  4DU9 A;  2GTI A;  3CCL Z;  3FDT A;  4A3D B;  1VQ5 1;  2EYH A;  4TQU S;  4HJ5 A;  3S1R B;  4DA2 A;  3FKI H;  2A8V A;  3NXW A;  3TP5 A;  2KQ3 A;  1FL0 A;  4XX2 A;  4X62 Q;  3K5M A;  2B2T A;  3DWA A;  3NTH A;  3CHB D;  1TWH B;  2OEO A;  3T1Y L;  4ZKB B;  1PVO A;  1NUI A;  5EPL A;  4IJH A;  2JIO A;  3VYR A;  5M5Y B;  1U9R A;  4DNT B;  1C7Y A;  3NBI A;  1ZYR D;  2GVA A;  3NH4 A;  2EYF A;  4UHV A;  4KTA A;  3GTQ H;  2V8J A;  3G71 A;  3CMA 1;  2R7Z I;  2MPM A;  2KCN A;  1A3T A;  1K8G A;  4RWS C;  2JK8 A;  1KC8 C;  2OT2 A;  3P75 A;  4H02 A;  4GLX A;  1EY8 A;  3Q23 A;  3CCV A;  1PZJ D;  3F1Z A;  2YU9 I;  4L5Q A;  1X9N A;  1B9M A;  1FD7 D;  3KK7 A;  4JYA Q;  3K5O A;  5D1P A;  3GKQ A;  5LMN L;  4LFC L;  4YHH L;  3UDX A;  5EAY A;  3MZ5 A;  3G4S Z;  3NSW A;  4C3H B;  4E33 A;  1XNQ L;  3LNN A;  1QB5 D;  4UP8 A;  1EY5 A;  3GTJ B;  1YJ9 Z;  1GXD C;  2QKD A;  1YI2 Z;  4NH1 C;  1HQR D;  4LW1 A;  1GHJ A;  1GUG A;  3S1R H;  2MQH A;  4C2M H;  4KLK A;  1A6X A;  2AUJ D;  4MIU A;  4X6A H;  3FPP A;  4QIW B;  1YIJ Z;  4WRD A;  3C3L A;  4DR7 Q;  4LUO A;  1HR0 W;  1QXF A;  1TWH H;  1YJN Z;  1X3Z A;  5M5Y H;  2E2H B;  2JA9 A;  5HGQ A;  1CT1 D;  1P8L A;  4Y52 I;  3CC4 Z;  1BCP D;  2AHO B;  2E74 C;  1A0I A;  1STE A;  3CRL C;  4MON A;  1PA6 A;  4JI3 Q;  3S2H I;  1QE6 A;  5K36 H;  2BH2 A;  1IYJ B;  4LF6 L;  3P5J B;  1PLF A;  1XYI A;  2PNH A;  1CA6 A;  1RHP A;  1Y8C A;  5JEA G;  1Y1V S;  1BBX C;  5CMD A;  4B3R Q;  3H0G B;  1MJE A;  2F0M A;  3FVQ A;  4C3H H;  2H1E A;  4A3F B;  2PQE A;  2MNA A;  3I72 A;  3BZC A;  1N33 Q;  5C3W A;  1X56 A;  2EXD A;  3OSO A;  1JJG A;  3EVQ A;  3STB C;  3GTJ H;  1EOT A;  3IKJ A;  4P73 A;  3S1N I;  5DNF A;  4KY7 A;  2A68 C;  1SFO B;  2Q2T A;  3I4N G;  1BOS A;  4KHP L;  2PI2 A;  4KHV A;  3BYT B;  1QNU A;  4FNF A;  1KQS Y;  2VUM B;  1G8Z D;  2NVX I;  1GUS A;  5IT9 f;  3G48 A;  3R2T A;  4X3T A;  1S5B D;  2MUY A;  1NJI 2;  2NVT I;  5DEH A;  3O13 A;  2RPR A;  3TZD A;  3W5O A;  4NXM L;  3S17 I;  3UDG A;  4LF7 L;  4A3C G;  2UXB Q;  1I94 Q;  3M4O I;  2R3Z A;  4DK1 A;  2HCC A;  2MO1 A;  2NVQ I;  1HZA A;  1TWG B;  3CCV Z;  1VQE A;  1CKO A;  1XWE A;  2BCO A;  4IAL A;  3OTO Q;  1LM0 A;  1Q8I A;  2I0Q A;  2D5D A;  4ZKC B;  4P2C B;  3I4N H;  1EY7 A;  1KAB A;  2L55 A;  2K33 A;  4OL7 A;  4DR3 L;  1OXU A;  4JBK A;  1WII A;  2Q2H A;  4N9T A;  1RL2 A;  3AYH B;  4RGO S;  3MWY W;  4N9P A;  4F7X A;  5ELF A;  2VQE Q;  1VQ9 A;  4DV2 Q;  5GAD C;  3FEW X;  1EL0 A;  3BYY B;  1N9W A;  4DPG A;  1AE2 A;  1E1O A;  4DV3 Q;  1PTO B;  3D6C A;  5CC4 A;  2HUG A;  4A3C H;  2F0K A;  1AA6 A;  4C3I G;  3BDO A;  3C2P A;  2WAQ A;  3J7A F;  1SFO H;  4RVD A;  1Q86 2;  3RZO I;  1E7Z A;  1UNS A;  1EY4 A;  4DK3 C;  1DM0 B;  1KAW A;  2E2D C;  2VUM H;  1Z7T A;  1L0W A;  4JG2 A;  3K58 A;  1SNC A;  2F3V A;  1TT2 A;  3GTG B;  2B2V A;  4A3J G;  4NXN Q;  1RF2 D;  2VPW A;  2IT1 A;  3CCM A;  3F3P C;  1HNX Q;  1IBL L;  1VQN A;  3PUX A;  1LYL A;  1MBY A;  1KDB A;  3EFX D;  1TWG H;  1VQO 1;  2NVY B;  3CC2 A;  1EIY B;  5AFW A;  4XYO A;  2XSC A;  4R4I A;  4LUZ A;  3J7A V;  4C3I H;  5JPM C;  1RDP D;  4BS9 A;  1PRT D;  4PQX A;  2B2W A;  1USP B;  3GTK B;  4WJW A;  5I2X A;  2B63 I;  2EY1 A;  2PQA A;  4NBF A;  4X62 L;  2H4O A;  2JA7 B;  2DGY A;  2LXK A;  3STB D;  2XVS A;  3F2D A;  1RO0 A;  1WTV A;  1DL6 A;  1DJR D;  2YTY A;  5E3F A;  1STY A;  1UE7 A;  3HOU I;  4X65 Q;  1HUM A;  3G6J B;  3QOL A;  2YU9 B;  2ZXO A;  1PTO H;  2VXW A;  4UY8 C;  1NNX A;  1F9Q A;  3NE5 B;  3EA6 A;  4DR4 Q;  3RLN A;  4JC0 A;  2Y0S B;  1M8A A;  1C8C A;  3TN2 A;  1L1O A;  2F0P A;  4IUQ A;  5D65 A;  3CCE 1;  1VS0 A;  2LY7 A;  4MZ9 A;  2R7Z G;  2YTV A;  1FYC A;  3GTG H;  3I07 A;  1LAC A;  4JYA L;  3H91 A;  1CTM A;  3DXJ C;  5AN9 F;  1VLA A;  2K52 A;  3D4W A;  3CME A;  4K8I A;  3E9H A;  4F8M A;  4FXD A;  1LT5 D;  1Q82 1;  4P72 A;  3GTP B;  1IYV A;  2NVY H;  1YJ9 1;  3CPF A;  1K8A 2;  5FKA C;  4CJ2 C;  1B2T A;  2NB0 A;  1VQK 1;  5CV6 A;  1JOQ A;  3HP3 A;  3PF4 A;  2FFK B;  1E24 A;  1VQ9 Z;  3TRE A;  1HNW L;  3KLR A;  4O0A A;  3GTK H;  1A3U A;  2A6E C;  3MTS A;  3JAM L;  3HKZ G;  2R7Z H;  4OIK A;  5C5L A;  2EGT A;  2A69 C;  1N36 Q;  1Q81 1;  2E5L L;  1YBY A;  4ULL A;  1YJN 1;  4DR7 L;  2B8G A;  1HCZ A;  2RHQ B;  2RHB A;  1H9S A;  1CKN B;  2YU9 H;  5FLX L;  3QWU A;  1CSQ A;  3I55 A;  5M3F G;  1HR0 Q;  3V96 A;  1Q46 A;  2E75 C;  3FHW A;  5IP9 I;  5JAV A;  1QZG A;  3CC4 1;  2F0U A;  2Z0S A;  2XNA C;  4XIG S;  1BBW A;  1G51 A;  4APV A;  3CQZ B;  2CQO A;  2QRC B;  3CCM Z;  3NPP A;  4ZAI A;  4KN7 C;  1ML8 A;  3CXC A;  2I5H A;  1VQN Z;  3PO2 B;  2IWH A;  4C1N I;  2JMO A;  5FJ8 G;  2L11 A;  3CC2 Z;  2PMZ A;  3CPW Y;  2CWP A;  3HEJ A;  1GJX A;  3TRZ A;  1J5E Q;  1SAP A;  1ASY A;  2NVX B;  4MTN A;  2KBN A;  1Q7Y 2;  3CRK C;  5J3B A;  1LTT D;  3LWU A;  3KJP A;  3GTP H;  5CV5 A;  1K8M A;  4DV6 Q;  4BBS I;  4L5T A;  1ET9 A;  3D2L A;  3JAM E;  1N33 L;  1IBK Q;  2NVT B;  5M3F H;  2F4M A;  3AEV A;  5M9O A;  1B7Y B;  2NN6 H;  2HD3 A;  2KA7 A;  2RSN A;  3R3O A;  2EIF A;  3S17 B;  1BQQ T;  3NP8 A;  1I3Q I;  1FGB D;  3J7A 5;  1QF8 A;  4J6H A;  2EYJ A;  5CV7 A;  5FLX E;  1CFM A;  1KRT A;  3T16 A;  1W2B A;  4HSP A;  5NUC A;  4Y7N I;  4Y52 H;  3KIH A;  2XWJ B;  5FJ8 H;  1VQ7 1;  1N34 Q;  1YVC A;  2M48 A;  3OOC A;  2UXB L;  1LTA D;  2QIL A;  4HTH A;  1F9P A;  2KPI A;  4PMW A;  4Q5V A;  1ENA A;  2B2U A;  4XT1 B;  4IZ8 A;  2F03 A;  3A7L A;  3OTO L;  2MJ8 A;  1JJC B;  4JVZ A;  2F0V A;  3CC7 1;  4RKL A;  2KED A;  1V1O A;  1AE3 A;  5E4X A;  4DNR B;  3CME Z;  4TNU A;  3N52 A;  2L9H A;  1HTP A;  3PO2 H;  5CM2 M;  1XPO A;  5C4X B;  4FF2 A;  3K0X A;  3KLS X;  2F52 A;  1WZN A;  4CGY B;  2UUB L;  4ZYS A;  2Q8I B;  4KN4 C;  3KDF B;  2NVX H;  1KDA A;  3GTQ I;  2KI7 B;  1UEB A;  3JC6 6;  4YCW A;  3CCR Z;  1FNW A;  1UWV A;  2PI2 E;  2NVT H;  4MTK A;  1JQY D;  3MZK B;  2EQS A;  2NYZ D;  1Q1B A;  5LL6 X;  3OW2 A;  2A6E D;  1XX8 A;  3S17 H;  4AYB A;  3JAM b;  2A69 D;  4BY1 I;  1EY6 A;  2XGT A;  3M4O H;  4FF4 A;  4JI4 Q;  2K5N A;  1PYB A;  2Q4Z A;  1PH8 A;  1JWM D;  3I55 Z;  2F4I A;  1M90 1;  1EYA A;  5FLX b;  2JA6 B;  1WTP A;  1O7Y A;  2G2K A;  1PTO C;  2OOX B;  3IFT A;  4A3I B;  1BNZ A;  2BE5 C;  5IGB A;  1X65 A;  2OTL 1;  4K5X A;  4YCV A;  1HNZ L;  3BDC A;  4JI2 L;  1IL8 A;  1F77 A;  3CXC Z;  3I3C A;  4C1N K;  2ENB A;  4IN3 A;  3HOY B;  1IBM Q;  4A3D I;  5JVG 3;  3PQI A;  3S1R I;  2WP8 J;  4RG1 A;  1VQ8 A;  4BXX I;  1PH5 A;  3HOU B;  4GKJ Q;  4X6A I;  1YHB A;  4YY3 Q;  3QG1 A;  4HIO A;  1ET6 A;  1EQQ A;  1GUO A;  4GN3 B;  2NZ1 D;  1TWH I;  4ZRZ A;  3F2C A;  3BVZ A;  3KFU A;  1PMR A;  2A74 C;  4RGM A;  2B63 G;  2XRQ D;  2WAQ E;  2QA4 1;  1AW7 A;  1JWS D;  1D7Q A;  4HMI A;  2I5M X;  3GTM S;  3BVG A;  1W2B Z;  3Q8D A;  4K0K Q;  3HOU G;  2RCN A;  1K9M 2;  5I4D A;  4DR4 L;  1J9O A;  1I4X A;  1SIW A;  1T5X D;  1V1P A;  2RDG A;  4LNQ A;  3VR5 A;  1RNI A;  1EFW A;  4DGL A;  2ALY B;  3CCS A;  1CZG A;  4DV5 Q;  1KLU D;  4K2K A;  2JA6 H;  1QVG Y;  1JE4 A;  2NZH A;  2D0O A;  1VMP A;  2IZ3 A;  1A63 A;  3GTJ I;  1QIL A;  4EX5 A;  1I4H A;  4E30 A;  2WAC A;  4GKK Q;  1AP0 A;  5KNB A;  1SND A;  2JNY A;  4EVO A;  4DR5 Q;  4LF9 Q;  1PFT A;  4UAI A;  4BWG B;  3HOY H;  1Z47 A;  2JE6 I;  1B50 A;  1HHV A;  1GM5 A;  4IUU A;  1QJO A;  2VB3 X;  3HOU H;  1S4Z A;  1DZ1 A;  2F0D A;  3K57 A;  4MN3 A;  3WWV A;  1TWC B;  2QW7 A;  1WTQ A;  2VY3 A;  3WOF A;  3DEO A;  5IIF A;  3S9W A;  1PZK D;  2DY7 A;  2WAQ B;  2JA8 I;  2E2H I;  4PG3 A;  3OW2 Z;  2VW9 A;  2HQL A;  2PW5 A;  2TSS A;  3DM1 A;  4J15 A;  1WTX A;  2EJM A;  3VA5 A;  2RIQ A;  1A15 A;  3PO3 S;  4G7H C;  2Z6K A;  4ID6 A;  2F4V L;  2QDB A;  2WKC A;  3GCF A;  1K73 2;  4HR7 B;  3NEM A;  3PUY A;  1SYF A;  1CSP A;  2OTJ 1;  4WJ4 A;  1SYD A;  2OQK A;  3CCM 1;  1Q81 C;  5IP9 G;  1PTO D;  1MGS A;  2F0E A;  2ZM6 Q;  2BE5 D;  2WB1 A;  3D4R A;  3H0G I;  4A3F I;  2LFU A;  1TXY A;  1RO2 A;  2G9H D;  1I3Q B;  1YIT A;  4DAY B;  4A3M B;  3U50 C;  1VQ8 Z;  2RQX A;  1KD1 C;  3EN2 A;  2GU2 A;  4O42 A;  3VYS A;  3X3M A;  2IY5 B;  4DV6 L;  3KLS A;  2PQA B;  1HUN A;  1P9N A;  1IBK L;  2VUM I;  2X6G A;  3N6R A;  4M1U B;  3KOJ A;  4QUF A;  3ERS X;  4BBS G;  1F2Y A;  2KEN A;  5CV8 A;  4I7A A;  4P71 A;  4JBM A;  4FF1 A;  4JCV E;  2EYM A;  1EOV A;  4DAV A;  1DD2 A;  1HQM C;  2F0F A;  4NMZ A;  5IP9 H;  2ZJR A;  2O2L D;  3SE0 A;  2BDO A;  5J1Z A;  1SYC A;  2N8N A;  3VYT A;  1H9M A;  2SNM A;  3GTO B;  2JUB A;  2V8K A;  4POG A;  4AH6 A;  1MSH A;  2B2T C;  1L1O B;  1DGS A;  5GRO A;  4RHS A;  2K5H A;  2CWA A;  3S1M B;  3CCS Z;  1HPC A;  3W2D A;  3HKZ A;  1KC8 2;  3G6E 1;  4A3B B;  1QUQ B;  4ODG A;  3OHX C;  4JI0 Q;  1SE2 A;  3S14 B;  4IPG A;  3GO5 A;  1ZEQ X;  2PMZ E;  2ZTC A;  2TMP A;  4GOP A;  4A93 B;  1LTI D;  3CAM A;  4IOC A;  3TME A;  2QLV B;  1BCP F;  1I3Q H;  3KBG A;  2QDL A;  1ROD A;  1F2L A;  1LTR D;  1Z9F A;  2EY5 A;  2F0W A;  1ZKO A;  5BR8 Q;  3CCR 1;  1NR2 A;  3W3A A;  3URY A;  1L0Y B;  5C5M A;  4AQY L;  3SK8 A;  4RKB A;  2C9O A;  2DUD A;  2OQ0 A;  2ICE C;  1I4G A;  3ND9 A;  3SEB A;  2RA4 A;  2BJO A;  1QYP A;  3J81 L;  1X6O A;  4KV6 A;  4R1J A;  4XQN A;  2MO0 A;  1XMO Q;  3SR1 A;  3DUZ A;  3CCQ A;  3E0J A;  4PMB A;  3CKI B;  4UDU C;  3W1B A;  5T67 A;  2EY6 A;  5ELO A;  4E2Z A;  4BY1 G;  1Y1V I;  3U58 A;  1QNK A;  2Q2I A;  1VQG A;  3GP7 A;  4CJ0 B;  3H3V C;  3EED A;  3FQM A;  5L37 A;  1E2V A;  2NVY I;  4A3K B;  5C4H A;  1I6H B;  2F0S A;  2M9V A;  3V05 A;  3SXH A;  2N3S A;  1YHQ A;  1ILQ A;  3S1M H;  5T64 A;  3IAY A;  1PFN A;  2ZJP A;  1IBM L;  4LF5 Q;  1QCB D;  3NDJ A;  3MXU A;  4A3B H;  3GTK I;  1M90 C;  1YIT Z;  1C9O A;  5DLQ E;  3S14 H;  4GKJ L;  4OO1 I;  4A3D G;  3CD6 1;  5IY0 A;  3M3Y B;  4A3L H;  3MZL B;  2JA7 I;  1NP6 A;  1EZ6 A;  4BXX G;  2AKW B;  1K0S A;  1CI3 M;  1GUN A;  4A93 H;  4DQY B;  1I4R A;  1TY0 A;  2XTI A;  3TP8 A;  3S1Q B;  1YHA A;  2HIX A;  4BY1 H;  3J81 E;  1YUK A;  2B39 A;  1SYB A;  2K05 A;  3TQY A;  2PZT A;  4AYB E;  4LF8 Q;  4EWC A;  1UE5 A;  3VMG A;  4LFB Q;  1K3B C;  3QWN A;  1K3R A;  3T1H L;  4X66 Q;  1I5F A;  3EQL C;  3K80 C;  1N8R 1;  4A3D H;  3I4M B;  5K36 G;  4KKU A;  1P16 A;  2QEX 1;  1EIH A;  1Q8K A;  1JJ2 Y;  4BXX H;  1Q1E A;  4DV5 L;  3AFQ A;  5FK9 C;  1LTB D;  1JE5 A;  3J80 L;  3GTP I;  1SR3 A;  1JWH C;  4A3K H;  1I6H H;  4C3H G;  5D1O A;  1F2Z A;  4GKK L;  2RF4 A;  3KF8 A;  2NN6 I;  4LF9 L;  1O80 A;  2JA8 B;  5ELC A;  3ZJY C;  5IYD G;  2NTS A;  1IXR A;  4JI6 L;  5IYB G;  4DUY Q;  1ESF A;  1CHP D;  1W3S A;  1J8I A;  2JS4 A;  5T1G A;  3JAM c;  4EQ5 A;  4CDE C;  1RKN A;  4JI8 L;  5IWA Q;  3S1Q H;  3A0J A;  2VQF L;  1PRT F;  4RGN A;  4QCL A;  4LF4 L;  5CV4 A;  3D4D A;  2JA8 G;  3J81 b;  3K6O A;  1G6Z A;  3HOW I;  1QVF A;  1D5Z C;  3CCQ Z;  2ICI A;  2CFM A;  5CGK A;  5I9P A;  2DY8 A;  1H9J A;  1PH9 A;  3CQZ I;  5IYD H;  1VQM 1;  3PO2 I;  2K04 A;  4NPS A;  3J80 E;  4N8F A;  3QR8 A;  5IYB H;  2J6A A;  2NTT A;  1KTK A;  2F4O A;  4NOZ A;  3I4O A;  1XPR A;  1S5E D;  4X3K A;  3I4M H;  1JOK A;  1YJW 1;  3H3V J;  1SE3 A;  2DNC A;  2ZXP A;  1S72 1;  1Z01 A;  1O78 A;  3VR4 A;  4E6I A;  3M85 A;  1RCV D;  3T51 B;  1YHQ Z;  4ABN A;  2QR1 B;  2SNS A;  1OO9 B;  1DCZ A;  2G5D A;  4RCO A;  1VQ8 1;  4LUV A;  1KL9 A;  4PZ7 A;  3NBH A;  2PK7 A;  4DXG A;  3I56 1;  4JI5 Q;  2JA5 B;  2B2V C;  4FP5 D;  3H0G G;  1Z6H A;  1MIU A;  3G71 Z;  1X0T A;  1U4L A;  4A3F G;  2UUC Q;  1A62 A;  1EWI A;  2Z4I A;  2GVB A;  4XYQ A;  2JA8 H;  2CQA A;  2E2H H;  3NEL A;  1WCM B;  1WJ2 A;  1B44 D;  2KHJ A;  5EJW A;  3K0Y A;  1I4P A;  2HHH Q;  1R4P B;  3MC0 B;  5D3I B;  1MSG A;  1RTN A;  3MXN B;  4FXK C;  1SN8 A;  5IGC A;  1O7I A;  2B3G A;  4GLV B;  2VUM G;  5CR3 A;  3HOV I;  3NH5 A;  3PCO B;  1LTS D;  4JI7 Q;  3J81 i;  3A74 A;  4DF7 A;  4CDC C;  4HMJ A;  2KCC A;  3UE0 A;  4E32 A;  1BBU A;  2K03 A;  3S15 B;  2YV5 A;  2K5D A;  4JOI A;  2HT1 A;  1TWF I;  3VMI A;  2MHV A;  3H09 A;  3DWP A;  3H0G H;  3PUW A;  4OWX B;  5LL6 S;  3LX0 A;  1UAP A;  4A3F H;  1K83 B;  2QCP X;  3BDL A;  2F0H A;  1OXS C;  2WB1 E;  5C4X I;  4PV1 C;  4O2D A;  1PYS B;  1VQL 1;  4OXP A;  3M4P A;  4ZCK A;  3AFP A;  1VMC A;  4OIJ A;  3J80 b;  3NTK A;  4CDF C;  2OCE A;  1LT4 D;  2DJG C;  4IUN A;  4OEM B;  5JJL A;  1PFB A;  3CCJ 1;  4JI1 Q;  3PIO 3;  4BA1 I;  2JEA I;  1L1O C;  3R8B A;  4HGY A;  3H3V I;  4KKS A;  1Y8P B;  5A2Q L;  2AWO A;  1DYQ A;  1BR9 A;  4NP5 A;  1Y1V B;  4TKO B;  1BXT A;  1ZXT A;  2KHI A;  4DV1 Q;  1QWY A;  3J7A 4;  2DN8 A;  3F2U A;  3T13 A;  5M5W B;  2A19 A;  2BA1 A;  1XMO L;  1GO3 E;  3P7J A;  2E2J I;  3CCL 1;  2JA6 I;  2SEB D;  3OIQ A;  1QVF Z;  1JIC A;  1OXX K;  1U4P A;  2K50 A;  3L2P A;  4A3I I;  2A5H A;  1CM9 A;  4RGT A;  5I6Y A;  2K28 A;  3D3R A;  1OTC A;  1AN8 A;  1EIF A;  2E76 C;  2JSO A;  3S15 H;  3HOY I;  3HKZ E;  4K5W A;  1SNQ A;  1Y1V G;  3HKS A;  4JPB W;  5M3M B;  2JR6 A;  1PXU A;  2A68 D;  1AEX A;  2GN5 A;  2WB1 B;  1WI5 A;  1K83 H;  3M9B A;  3CCU A;  4DUZ Q;  2PCF B;  3NFZ A;  2RKS A;  4LAA A;  4LF5 L;  3ERO A;  1E0B A;  2ZXR A;  1KRL A;  5C4J B;  1VDZ A;  3SDZ A;  1WTR A;  5LMN W;  5M5X B;  1U4M A;  4BA2 I;  3OW7 A;  4OO1 G;  4JBJ A;  1V9P A;  4HIK A;  3MFY A;  2JA7 G;  3W1G A;  1U0L A;  5HUR A;  5CBA E;  2C35 B;  4AIM A;  4NBD A;  3PUZ A;  1DXM A;  5EGT A;  4MD7 A;  2OF1 A;  3G4S 1;  3T4A C;  4CBV A;  1Y1V H;  3X3N A;  1ZH1 A;  2P28 A;  4DV7 Q;  5M5W H;  1YI2 1;  1TR5 A;  4L8J A;  4FXG C;  2Y0S G;  1EQR A;  4X66 L;  4GNX A;  4XQQ A;  3H15 A;  3ITP A;  2KEC A;  3BVM A;  2QGQ A;  2VF1 A;  4IUP A;  2IZ4 A;  1G29 1;  3WDN A;  1N32 Q;  3RN2 A;  4CKC A;  5T6B A;  5G3L F;  4OO1 H;  2UXC Q;  3EIV A;  1X3P A;  1YIJ 1;  2JA7 H;  4K6L A;  3S24 A;  1VQ4 A;  5ELE A;  3MVV A;  3P1H A;  4C56 C;  4NB8 A;  5BN5 A;  5M3M H;  1JR0 D;  1MD2 D;  3K5N A;  1NTG A;  1NR4 A;  2GA4 B;  1EY9 A;  1GUW A;  2EZV A;  1JWU D;  4A3G B;  1N8R C;  1PV4 A;  3QOJ A;  1D5M C;  1KD1 1;  4DN4 M;  1TWC I;  1EIG A;  2NN6 G;  3A5U A;  1XMQ Q;  2VL6 A;  3TP7 A;  3A8I E;  1QG7 A;  4RMF A;  5KND A;  2IX3 A;  3HOW B;  3L7Z C;  2B2U C;  5C4J H;  1B1Z A;  3AMU A;  5M5X H;  2KJX A;  5A2Q b;  4JI3 L;  2O5I C;  5KRU A;  5IYC G;  2E8G A;  4MXU A;  2K7V A;  2L15 A;  5KYL A;  3L9A X;  3OYY A;  3TS0 A;  3OMC A;  4CJ1 B;  2JQO A;  4H44 C;  1Q12 A;  4ILW A;  1HA6 A;  1VQ5 A;  3CCQ 1;  5IOC A;  3PMF A;  1QOH A;  1VF5 C;  4B3R L;  3TZU A;  2R61 A;  3NQI A;  4S1T A;  4IPD A;  3HOW G;  4K8J A;  4S3S A;  1LUZ A;  1EY0 A;  4R4O A;  2B2Y C;  1L2F A;  4WFN 3;  1FJG Q;  1Y8N B;  1GOZ A;  4OX9 Q;  2LXJ A;  2E7Z A;  4A3M I;  3PO2 G;  5IP7 I;  4IUR A;  1DOK A;  3CCU Z;  4B08 A;  1BUV T;  2AQ3 B;  3RD4 A;  3CMA A;  2FHT A;  5IYC H;  2LFN A;  3E9I A;  3G71 1;  3HOV B;  3AU7 A;  1KNE A;  2YTX A;  4DV0 Q;  2VPY A;  3PIP A;  2EXZ A;  3BZK A;  4R4T A;  3PIP 3;  5IGE A;  2K3R A;  4A3G H;  2L1B A;  1I94 L;  1EUJ A;  1ESR A;  3SVM A;  4X64 Q;  3CCV 1;  1X32 A;  1Q3L A;  5C3X A;  3K8A A;  1TWF B;  3HOW H;  4B9W A;  3CQZ H;  3HZX A;  3HOZ I;  4CDD C;  2IW3 A;  3U4Z A;  3GTO I;  3DHQ A;  3M4Q A;  4CHT B;  3NHH A;  4JI7 L;  1G2S A;  5E4W C;  3HOV G;  2IHE A;  3S1M I;  5FO9 B;  1JT8 A;  4NB3 A;  4ALP A;  1T5E A;  2KUM A;  3KLW A;  5ELB A;  2VQE L;  4A3B I;  2R6M A;  4DV2 L;  1R4Q B;  3S14 I;  4OGQ C;  3MON A;  4A3L I;  4NB9 A;  3SK5 A;  4DV3 L;  1TQO A;  2MP1 A;  4A93 I;  3K7A B;  2UU9 Q;  2JIR A;  3RZD I;  2FMC A;  2XN9 C;  2AMC B;  2UUA Q;  5C4X G;  1EEI D;  5GQO A;  1O7Z A;  2R92 I;  2EVB A;  5C44 B;  4JI1 L;  1F9S A;  1WD0 A;  4DR1 Q;  2E2J B;  1VQD A;  3PF5 A;  3HOV H;  1B8A A;  4J1M A;  3PO3 I;  4IJL A;  1KIX A;  4YWM A;  3A8J E;  3KBX A;  4NXN L;  1X55 A;  3KYH C;  4V0B A;  1KRS A;  2PM9 A;  1C4Q A;  2V1C C;  4L6T B;  3J81 c;  4DV4 Q;  1HNX L;  4L63 B;  4DV1 L;  1X3E A;  1Q16 A;  1V8Q A;  3GQB A;  1TWF H;  4LMQ D;  4IUV A;  5LHY 1;  1D5X C;  3J7Z C;  1VQ5 Z;  1Q82 2;  4XDX A;  4QJF A;  1WOC A;  4B3M Q;  3S16 I;  4A3K I;  5EBD A;  5C4X H;  4TRD A;  1I6H I;  4QF4 A;  2JA6 G;  3I70 A;  4YIJ A;  2JEB I;  4DAM A;  3I8Z A;  4HGZ A;  4A3I G;  1GUT A;  1WYD A;  4RVF A;  1JB7 A;  3T1Y Q;  2BOS A;  2ZT9 C;  1LO5 D;  1X54 A;  1B4O A;  1SMX A;  1XTC D;  1KQS A;  3HOY G;  4X65 L;  2M6N A;  5KEE A;  3JAM i;  3H3V H;  3M3Y I;  4FO2 A;  4DUZ L;  1Q81 2;  1KNA A;  1NSN S;  3H94 A;  1S40 A;  2YYZ A;  3CMA Z;  3K7A H;  3S1Q I;  2UXD Q;  4A4I A;  2EYP A;  1S5C D;  1TVX A;  1IW7 C;  3I4L A;  5C44 H;  3P20 A;  2E2I B;  3NDI A;  2O5J C;  1E2W A;  2FXQ A;  2E2J H;  3OPO A;  4DAP A;  2JIM A;  4RVG A;  4P74 A;  1VQJ A;  5AJ3 Q;  4A3I H;  1F9R A;  1M1K 1;  1D1K A;  1LT6 D;  3MA2 B;  2G9D A;  2HIV A;  4F88 A;  3ERQ A;  4BY7 B;  2M2L A;  4B3S Q;  3I4M I;  5IGD A;  1VQF A;  2EDG A;  4IO9 A;  2B8F A;  3I90 A;  4R4Q A;  3IRB A;  2F3I A;  2AWN A;  1VQ9 1;  2D62 A;  2EJF C;  2FIN B;  4KKT A;  3JAM f;  3SK6 A;  3J80 c;  1PFM A;  2RSO A;  1CHQ D;  4FF3 A;  4IFD H;  1NMG A;  4Q0F A;  1HTL D;  4HN7 A;  2JP1 A;  1N36 L;  4QUC A;  2JIQ A;  2JIP A;  5FLX f;  2MGS A;  3F8T A;  4HSV A;  1AFP A;  4QQB X;  2K75 A;  2ZAE B;  4Z9C B;  3T4N B;  5JOB A;  4DK6 C;  1HR0 L;  2OXP A;  3BS1 A;  2I46 A;  3U9O A;  3E3X A;  3TP6 A;  1UE6 A;  2K5R A;  4XTC S;  4HAE A;  1MJC A;  2JYO A; 
#chains in the Genus database with same CATH homology
 2V8I A;  1PHJ A;  4YWL A;  2QRE B;  1VQN 1;  4JBW A;  4OWT B;  1VQO A;  2E2I H;  4LF6 Q;  2WAQ G;  3CC2 1;  1B70 B;  1PH4 A;  1J5E L;  1USP A;  2A1A A;  4NBG A;  4B3T Q;  1AH9 A;  3B6Y A;  3KF6 A;  4KHP Q;  3TDH B;  2JA5 I;  1TWC H;  5C3E I;  4DR6 Q;  1KQS Z;  1PFS A;  4PZ6 A;  4A3M G;  5IP7 G;  2IHF A;  1WCM I;  3A5Z B;  4NXM Q;  2Y0S A;  4LF7 Q;  2RT9 A;  1J6Q A;  2VNU D;  4UPA A;  3CCE A;  1N34 L;  4IPC A;  1M90 2;  4A76 A;  1Y1W G;  1NE3 A;  4HID A;  3CME 1;  1VQH A;  1R9T I;  3S15 I;  3PUV A;  3RLO A;  3HOX H;  3HOZ G;  1VQK A;  2I5L X;  1K83 I;  5C0X J;  4UP9 A;  1SRO A;  4A3M H;  5IP7 H;  3FP9 A;  3VDY A;  1GKH A;  3E0E A;  1VQP A;  3D6W A;  3F2B A;  4A3B G;  3GTM H;  1NJI 1;  4MRI A;  4A3L G;  2VUG A;  1Y14 B;  1Y1W H;  1CKN A;  2ZTD A;  2UUA L;  4L5R C;  3S2D H;  1VQB A;  5IE8 A;  4A93 G;  2ATW A;  2D0P A;  4JI4 L;  3I55 1;  1E22 A;  3CC4 A;  2IX1 A;  2R92 G;  3HOZ H;  1IBL Q;  1EYG A;  3GTO H;  4NBH A;  3CXC Y;  2ASB A;  4QTT A;  3PO3 G;  4DV4 L;  4POF A;  1G6P A;  1VCI A;  1X3G A;  3CPW A;  4NBE A;  1RQF A;  2ZTE A;  4QGU A;  2R93 H;  4YY3 L;  4B3M L;  1YEZ A;  3RZD H;  3D0F A;  1BVS A;  1I50 H;  4A3K G;  4QIW E;  2R92 H;  1Q86 1;  3L0O A;  5FLM H;  2LIY A;  5C0X I;  1W2B Y;  3M7N A;  5C4J I;  2MFI A;  1CKM A;  2ZJQ A;  3PO3 H;  2Q51 A;  3U4V A;  1VQ7 A;  4K0K L;  3RNU A;  5IT9 b;  3RLF A;  4WJ3 M;  2UXD L;  4MH4 A;  3CCE Z;  1E3P A;  4QL5 A;  2O53 A;  3CC7 A;  4FDB A;  2DE7 A;  3S16 H;  5AJ3 L;  2OOY B;  4KI0 A;  4DKA C;  3BU2 A;  4DR5 L;  4TVA B;  4B3S L;  3TEH B;  1VQK Z;  3KDF A;  1HNW Q;  2H85 A;  3I4M G;  3M3Y H;  4L5S A;  1Z03 A;  3VMH A;  4MD8 A;  1VQP Z;  1M1K C;  3CP0 A;  3OW2 Y;  3CF5 A;  2E5L Q;  2CKZ B;  4DNI A;  4A3G I;  3IFU A;  5FLX c;  4JOI C;  3VB9 A;  1GVP A;  3ULL A;  4HIM A;  1C0A A;  2OTL A;  2W03 A;  1VQC A;  1VQI A;  4AYB G;  2R6G A;  1K8A 1;  1PH7 A;  3CPW Z;  4IPH A;  1D8L A;  1JMC A;  4B3T L;  4MNO A;  3PGZ A;  2QA4 A;  3IF8 A;  1ZB8 A;  3GTL H;  4QTU A;  5LMU Q;  4DR6 L;  1NMF A;  4GS3 A;  2JA5 G;  4GLA C;  1VQ7 Z;  5C3E G;  1SRU A;  1WCM G;  3CCS 1;  3EBE A;  4IFD J;  1HZC A;  1VQA A;  4RS4 A;  1QVG A;  3CC7 Z;  3VTN A;  3GDE A;  4JI0 L;  1WJJ A;  4E31 A;  3ER0 A;  2DE6 A;  3PIO A;  1Q7Y 1;  4R4C A;  2N49 A;  2UUB Q;  1GD7 A;  1X3F A;  1OXV A;  2JA5 H;  3BG1 B;  5C3E H;  5BR8 L;  1XJV A;  3K81 C;  2HU9 A;  3K7A I;  3RR5 A;  5GAE C;  1WCM H;  2K5V A;  3J81 f;  1V43 A;  2K14 A;  2ES2 A;  5C44 I;  1IL2 A;  2Y0S E;  4GNX C;  1HJP A;  2QRD B;  2OTJ A;  3GD7 A;  1LQL A;  1N8R 2;  1R9T H;  1HNZ Q;  4JI2 Q;  3I2Z A;  2OTL Z;  4LFA Q;  1NJI C;  1YZ6 A;  4P75 A;  3J80 i;  4LWC A;  1YIT 1;  4IFD I;  1U5K A;  4DR2 Q;  1X3W A;  3UDI A;  4KHZ A;  3KF6 B;  4A3J H;  2OZK A;  5M3M G;  2QA4 Z;  1YNX A;  2WB1 G;  1S3O A;  4LF8 L;  4GN4 B;  4LFB L;  5C0X G;  4GN5 A;  2E2I I;  1T9H A;  1V1Q A;  2E9H A;  1LTL A;  1NY4 A;  1Q86 C;  1SE8 A;  3J80 f;  3G6E A;  1QUQ A;  3MEF A;  4BY7 I;  1QVG Z;  1Z02 A;  1NBW A;  2R7F A;  3Q87 A;  2I3C A;  4GOP B;  5JJK A;  1ZB9 A;  3UE1 A;  3CW2 C;  4DUY L;  4HJ9 A;  3HFZ B;  1SLJ A;  3CCR A;  2HF1 A;  1YUA A;  1VQ6 A;  2RHS B;  1VQP 1;  1RIP A;  2CCZ A;  4MD9 A;  5IWA L;  3AQQ A;  1XTD A;  1K9M 1;  1CUK A;  1WW9 A;  1KXL A;  2KCT A;  2F4V Q;  4A3G G;  1HZ9 A;  4YWK A;  1XNR Q;  2OTJ Z;  1OXT A;  1QZH A;  3HOX I;  1WFQ A;  4E2X A;  1YHQ 1;  4OON A;  3CD6 A;  4JI5 L;  4E2Y A;  3GTM I;  2LSS A;  4JV5 Q;  2UUC L;  1E1T A;  1PH6 A;  4BBR I;  1Y1W I;  3S2D I;  3BG0 B;  2HHH L;  3J81 j;  1K8A C;  4A3E I;  5IT9 c;  1XPU A;  1FGU A;  5LMU L;  4NBA A;  5LL6 f;  2B29 A;  1K73 1;  4ME3 A;  3S2H H;  1TWA I;  3ULJ A;  3D31 A;  2KCM A;  1ASZ A;  1HH2 P;  2QEX A;  1JJ2 A;  3FKI I;  3G6E Z;  2K4K A;  2R93 I;  1PH3 A;  1VQ4 Z;  3FQQ A;  5D1O B;  3S1N H;  4PZ8 A;  3ULP A;  1I50 I;  3KF8 B;  2O4H A;  1RO4 A;  3NH8 A;  1MKH A;  5FLM I;  2JJQ A;  5A2Q f;  4AQY Q;  1VQ6 Z;  1IZ6 A;  2N78 A;  2YAD A;  4CL1 A;  1Q7Y C;  3DLL A;  3RN5 A;  1QVF Y;  2NVQ H;  5C44 G;  1N2F A;  5ELN A;  3SGI A;  1VQM A;  1HZB A;  1KC8 1;  3K7U C;  1YJW A;  4LFA L;  4NBC A;  4OWW B;  1S72 A;  4YCU A;  3I7F A;  3I56 A;  3NBH B;  4RV9 A;  2Z6K C;  3DM3 A;  5JEA J;  3CD6 Z;  2Q2U A;  4DR2 L;  4RVH A;  3RZO H;  4IFD G;  4E2W A;  1KD1 2;  1S7M A;  2W04 A;  3F3F C;  3LUS A;  4YHH Q;  5LMN Q;  4LFC Q;  1XNQ Q;  4HJA A;  3PSI A;  4UP7 A;  4DV7 L;  3T1H Q;  4HH4 A;  2GTH A;  3PV0 A;  2BA0 A;  2VS1 A;  2QEX Z;  1N32 L;  3BJU A;  1KHI A;  2P3Y A;  3TS2 A;  1JJ2 Z;  1H95 A;  1VQL A;  2UXC L;  1K0R A;  2B63 H;  2R7D A;  2NZO A;  3CCJ A;  4BY7 G;  4JI6 Q;  5H1S E;  3GTL I;  5E7N A;  1XMQ L;  1QVC A;  4JI8 Q;  2VQF Q;  1TFI A;  3TE5 B;  1Q82 C;  4LF4 Q;  1RLY A;  5GAG C;  4NFR A;  4GOP C;  3LGJ A;  3CCL A;  1PH2 A;  2RBL A;  3I4N I;  1FVI A;  4BY7 H;  5GAH C;  1VQM Z;  1XNR L;  3NEN A;  3KJO A;  4A75 A;  1FJG L;  1YJW Z;  2AKL A;  1S72 Z;  4OX9 L;  1K9M C;  3CCU 1;  1UE1 A;  3HOX G;  4A3C I;  1BKB A;  3I56 Z;  4C3J H;  1SFO I;  4QY7 A;  4DV0 L;  3KIF A;  4IOA A;  4JV5 L;  4HJ7 A;  4HJ8 A;  1PH1 A;  3ICE A;  4X64 L;  3EER A;  3D9X A;  4BBR G;  2DE5 A;  2ID0 A;  3G4S A;  4DR3 Q;  1YJ9 A;  4A3E G;  1YI2 A;  1TWG I;  4GNX B;  1A8V A;  5JJI A;  2WFW A;  1YIJ A;  2OWO A;  1VQL Z;  1YJN A;  4BBS H;  1VQ4 1;  3UDF A;  2UU9 L;  4A3J I;  3FKI G;  4BBR H;  2BH8 A;  1K73 C;  2R93 G;  2IX0 A;  5HY6 A;  3CCJ Z;  4A3E H;  4DR1 L;  1VQ6 1;  5FLM G;  4Y7N H;  2H5X A;  4NBB A;  3ESW A;  3IX0 A;  1TWA H;  1VQO Z;  3GTG I;  1M1K 2;  2VZA A;  2GTI A;  3CCL Z;  1VQ5 1;  4HJ5 A;  4TQU S;  3FKI H;  2A8V A;  1FL0 A;  4XX2 A;  4X62 Q;  3T1Y L;  1PVO A;  1NUI A;  4IJH A;  1C7Y A;  2GVA A;  3NH4 A;  3GTQ H;  2V8J A;  3G71 A;  3CMA 1;  2R7Z I;  1K8G A;  2JK8 A;  1KC8 C;  4H02 A;  4GLX A;  3CCV A;  3F1Z A;  2YU9 I;  4L5Q A;  1X9N A;  4JYA Q;  5D1P A;  3GKQ A;  5LMN L;  4LFC L;  4YHH L;  3UDX A;  5EAY A;  3G4S Z;  4E33 A;  1XNQ L;  4UP8 A;  1YJ9 Z;  2QKD A;  1YI2 Z;  4NH1 C;  4LW1 A;  3S1R H;  2MQH A;  4C2M H;  4KLK A;  4X6A H;  1YIJ Z;  4DR7 Q;  4LUO A;  1HR0 W;  1TWH H;  1YJN Z;  1X3Z A;  5M5Y H;  2JA9 A;  5HGQ A;  1P8L A;  4Y52 I;  3CC4 Z;  2AHO B;  1A0I A;  4MON A;  1PA6 A;  4JI3 Q;  3S2H I;  2BH2 A;  1IYJ B;  4LF6 L;  3P5J B;  2PNH A;  5JEA G;  1Y1V S;  4B3R Q;  1MJE A;  4C3H H;  2MNA A;  3BZC A;  1N33 Q;  1X56 A;  2EXD A;  1JJG A;  3GTJ H;  3STB C;  4P73 A;  3S1N I;  2Q2T A;  3I4N G;  4KHP L;  2PI2 A;  1KQS Y;  2NVX I;  5IT9 f;  3G48 A;  1NJI 2;  2NVT I;  2RPR A;  3W5O A;  4NXM L;  3S17 I;  3UDG A;  4LF7 L;  4A3C G;  2UXB Q;  1I94 Q;  3M4O I;  4DK1 A;  2MO1 A;  2NVQ I;  1HZA A;  1VQE A;  3CCV Z;  1CKO A;  3OTO Q;  1LM0 A;  2I0Q A;  3I4N H;  4DR3 L;  1OXU A;  4JBK A;  1WII A;  2Q2H A;  1RL2 A;  3AYH B;  2VQE Q;  1VQ9 A;  4DV2 Q;  5GAD C;  1N9W A;  4DPG A;  1AE2 A;  1E1O A;  4DV3 Q;  4A3C H;  2WAQ A;  1SFO H;  4RVD A;  1Q86 2;  3RZO I;  1E7Z A;  4DK3 C;  1KAW A;  2VUM H;  1L0W A;  4JG2 A;  4A3J G;  4NXN Q;  3CCM A;  2IT1 A;  3F3P C;  1HNX Q;  1IBL L;  1VQN A;  3PUX A;  1LYL A;  1TWG H;  1VQO 1;  3CC2 A;  1EIY B;  4R4I A;  4LUZ A;  4C3I H;  1USP B;  2B63 I;  2PQA A;  4NBF A;  4X62 L;  2DGY A;  2LXK A;  3STB D;  3F2D A;  1RO0 A;  1DL6 A;  2YTY A;  1UE7 A;  3HOU I;  4X65 Q;  4UY8 C;  4DR4 Q;  3RLN A;  4JC0 A;  1L1O A;  3CCE 1;  1VS0 A;  2R7Z G;  4MZ9 A;  2YTV A;  3GTG H;  3I07 A;  4JYA L;  5AN9 F;  1VLA A;  2K52 A;  3CME A;  3E9H A;  1Q82 1;  4P72 A;  2NVY H;  1YJ9 1;  3CPF A;  1K8A 2;  1VQK 1;  3PF4 A;  1E24 A;  1VQ9 Z;  3TRE A;  1HNW L;  4O0A A;  3GTK H;  3HKZ G;  2R7Z H;  2EGT A;  1N36 Q;  1Q81 1;  2E5L L;  1YBY A;  4DR7 L;  1YJN 1;  2RHQ B;  2RHB A;  1CKN B;  2YU9 H;  3QWU A;  1CSQ A;  3I55 A;  5M3F G;  1HR0 Q;  1Q46 A;  3FHW A;  5IP9 I;  1QZG A;  3CC4 1;  2Z0S A;  4XIG S;  1BBW A;  1G51 A;  4APV A;  2CQO A;  2QRC B;  3CCM Z;  1ML8 A;  3CXC A;  2I5H A;  1VQN Z;  2JMO A;  5FJ8 G;  3CC2 Z;  2PMZ A;  3CPW Y;  2CWP A;  3TRZ A;  1J5E Q;  1ASY A;  4MTN A;  2KBN A;  1Q7Y 2;  5J3B A;  3KJP A;  3GTP H;  4DV6 Q;  4BBS I;  4L5T A;  1N33 L;  1IBK Q;  5M3F H;  2F4M A;  3AEV A;  1B7Y B;  2EIF A;  1I3Q I;  3J7A 5;  1QF8 A;  1KRT A;  1W2B A;  4Y7N I;  4Y52 H;  3KIH A;  5FJ8 H;  1VQ7 1;  1N34 Q;  1YVC A;  2M48 A;  2UXB L;  2KPI A;  4PMW A;  3OTO L;  1JJC B;  3CC7 1;  1AE3 A;  3CME Z;  4TNU A;  3PO2 H;  5CM2 M;  1XPO A;  3K0X A;  2F52 A;  2UUB L;  3KDF B;  2NVX H;  3GTQ I;  2KI7 B;  1UEB A;  3JC6 6;  4YCW A;  3CCR Z;  1UWV A;  2PI2 E;  2NVT H;  3MZK B;  2EQS A;  1Q1B A;  3OW2 A;  3S17 H;  4AYB A;  3JAM b;  4BY1 I;  2XGT A;  3M4O H;  4JI4 Q;  2K5N A;  1PYB A;  2Q4Z A;  1PH8 A;  3I55 Z;  1M90 1;  5FLX b;  2G2K A;  2OOX B;  1X65 A;  2OTL 1;  4YCV A;  1HNZ L;  4JI2 L;  3CXC Z;  1IBM Q;  4A3D I;  3S1R I;  2WP8 J;  4RG1 A;  1VQ8 A;  4BXX I;  1PH5 A;  4GKJ Q;  4X6A I;  1YHB A;  4YY3 Q;  4HIO A;  1EQQ A;  4GN3 B;  1TWH I;  3F2C A;  3KFU A;  2B63 G;  2WAQ E;  2QA4 1;  1D7Q A;  2I5M X;  3GTM S;  1W2B Z;  3Q8D A;  4K0K Q;  3HOU G;  2RCN A;  1K9M 2;  4DR4 L;  4LNQ A;  1RNI A;  1EFW A;  4DGL A;  2ALY B;  3CCS A;  4DV5 Q;  2JA6 H;  1QVG Y;  2NZH A;  2D0O A;  2IZ3 A;  1A63 A;  3GTJ I;  4EX5 A;  4E30 A;  4GKK Q;  2JNY A;  4DR5 Q;  4LF9 Q;  1PFT A;  3HOY H;  1Z47 A;  2JE6 I;  1GM5 A;  3HOU H;  3WWV A;  2VY3 A;  2JA8 I;  2E2H I;  4PG3 A;  3OW2 Z;  2VW9 A;  2HQL A;  4J15 A;  2RIQ A;  3PO3 S;  2Z6K A;  2F4V L;  3GCF A;  1K73 2;  3NEM A;  3PUY A;  1CSP A;  2OTJ 1;  4WJ4 A;  2OQK A;  3CCM 1;  1Q81 C;  5IP9 G;  2ZM6 Q;  2WB1 A;  3H0G I;  4A3F I;  2LFU A;  1TXY A;  1RO2 A;  1YIT A;  4DAY B;  3U50 C;  1VQ8 Z;  1KD1 C;  3EN2 A;  2GU2 A;  2IY5 B;  4DV6 L;  2PQA B;  1P9N A;  1IBK L;  2VUM I;  3KOJ A;  3ERS X;  4BBS G;  2KEN A;  4P71 A;  4JBM A;  4JCV E;  1EOV A;  5IP9 H;  2ZJR A;  2N8N A;  2JUB A;  2V8K A;  4POG A;  4AH6 A;  1L1O B;  1DGS A;  5GRO A;  2K5H A;  2CWA A;  3CCS Z;  3HKZ A;  1KC8 2;  3G6E 1;  1QUQ B;  4JI0 Q;  4IPG A;  3GO5 A;  2PMZ E;  2ZTC A;  4GOP A;  3CAM A;  4IOC A;  2QLV B;  1I3Q H;  1Z9F A;  5BR8 Q;  3CCR 1;  4AQY L;  2DUD A;  2OQ0 A;  2BJO A;  1QYP A;  1X6O A;  4R1J A;  2MO0 A;  1XMO Q;  3CCQ A;  3W1B A;  5T67 A;  5ELO A;  4E2Z A;  4BY1 G;  1Y1V I;  3U58 A;  2Q2I A;  1VQG A;  3EED A;  3FQM A;  2NVY I;  1YHQ A;  2N3S A;  3S1M H;  5T64 A;  2ZJP A;  1IBM L;  4LF5 Q;  3NDJ A;  4A3B H;  3GTK I;  1M90 C;  1YIT Z;  1C9O A;  5DLQ E;  3S14 H;  4GKJ L;  4OO1 I;  4A3D G;  3CD6 1;  5IY0 A;  4A3L H;  3MZL B;  2JA7 I;  1NP6 A;  4BXX G;  2AKW B;  4A93 H;  4DQY B;  2XTI A;  1YHA A;  2HIX A;  4BY1 H;  1YUK A;  3TQY A;  4AYB E;  4LF8 Q;  4EWC A;  1UE5 A;  3VMG A;  4LFB Q;  1K3R A;  3T1H L;  4X66 Q;  1I5F A;  3K80 C;  1N8R 1;  4A3D H;  5K36 G;  1P16 A;  2QEX 1;  1Q8K A;  1JJ2 Y;  4BXX H;  1Q1E A;  4DV5 L;  3AFQ A;  1JE5 A;  3GTP I;  1SR3 A;  1JWH C;  4A3K H;  1I6H H;  5D1O A;  4GKK L;  2RF4 A;  2NN6 I;  4LF9 L;  3ZJY C;  5IYD G;  1IXR A;  4JI6 L;  5IYB G;  4DUY Q;  1W3S A;  2JS4 A;  3JAM c;  4EQ5 A;  4JI8 L;  5IWA Q;  3S1Q H;  3A0J A;  2VQF L;  4LF4 L;  2JA8 G;  3J81 b;  3HOW I;  1QVF A;  3CCQ Z;  2CFM A;  1PH9 A;  3CQZ I;  5IYD H;  1VQM 1;  3PO2 I;  4NPS A;  5IYB H;  2J6A A;  2F4O A;  4NOZ A;  3I4O A;  1XPR A;  3I4M H;  2ZM6 L;  1YJW 1;  3H3V J;  3M85 A;  1S72 1;  1Z01 A;  1YHQ Z;  2QR1 B;  1VQ8 1;  4LUV A;  1KL9 A;  4PZ7 A;  2PK7 A;  4JI5 Q;  3I56 1;  3H0G G;  1MIU A;  3G71 Z;  1X0T A;  4A3F G;  2UUC Q;  1A62 A;  1EWI A;  2GVB A;  2JA8 H;  2E2H H;  3NEL A;  2KHJ A;  2HHH Q;  3MXN B;  1SN8 A;  1O7I A;  2B3G A;  4GLV B;  2VUM G;  3HOV I;  3NH5 A;  3PCO B;  4JI7 Q;  3J81 i;  3A74 A;  3UE0 A;  4E32 A;  1BBU A;  2YV5 A;  4JOI A;  2HT1 A;  1TWF I;  3VMI A;  3H0G H;  3PUW A;  4OWX B;  4A3F H;  1OXS C;  2WB1 E;  5C4X I;  4O2D A;  1PYS B;  1VQL 1;  4OXP A;  3M4P A;  3AFP A;  3J80 b;  2OCE A;  5JJL A;  3CCJ 1;  4JI1 Q;  4BA1 I;  2JEA I;  1L1O C;  4HGY A;  3H3V I;  2AWO A;  2KHI A;  4DV1 Q;  3J7A 4;  2A19 A;  2BA1 A;  1XMO L;  1GO3 E;  2E2J I;  3CCL 1;  2JA6 I;  1QVF Z;  1OXX K;  3L2P A;  2K50 A;  4A3I I;  1OTC A;  1EIF A;  3S15 H;  3HOY I;  3HKZ E;  3HKS A;  1Y1V G;  2JR6 A;  2GN5 A;  1WI5 A;  1K83 H;  3M9B A;  3CCU A;  4DUZ Q;  3NFZ A;  4LF5 L;  1KRL A;  5LMN W;  4BA2 I;  4OO1 G;  4JBJ A;  1V9P A;  4HIK A;  2JA7 G;  3W1G A;  1U0L A;  2C35 B;  4AIM A;  4NBD A;  3PUZ A;  4MD7 A;  3G4S 1;  1Y1V H;  1ZH1 A;  2P28 A;  4DV7 Q;  5M5W H;  1YI2 1;  2Y0S G;  1EQR A;  4X66 L;  4GNX A;  3H15 A;  1N32 Q;  2QGQ A;  2VF1 A;  2IZ4 A;  1G29 1;  3RN2 A;  5T6B A;  2UXC Q;  3EIV A;  1YIJ 1;  2JA7 H;  3S24 A;  1VQ4 A;  4NB8 A;  5M3M H;  1NTG A;  1N8R C;  1PV4 A;  1KD1 1;  1TWC I;  2NN6 G;  3A5U A;  1XMQ Q;  2VL6 A;  4RMF A;  3L7Z C;  5C4J H;  5M5X H;  5A2Q b;  4JI3 L;  5IYC G;  2E8G A;  4MXU A;  2L15 A;  3OYY A;  3TS0 A;  2JQO A;  1Q12 A;  1VQ5 A;  3CCQ 1;  4B3R L;  4S1T A;  4IPD A;  3HOW G;  1LUZ A;  4R4O A;  1L2F A;  1FJG Q;  4OX9 Q;  2LXJ A;  4A3M I;  3PO2 G;  5IP7 I;  3CCU Z;  3CMA A;  5IYC H;  3E9I A;  3G71 1;  2YTX A;  4DV0 Q;  3PIP A;  3BZK A;  4R4T A;  2K3R A;  4A3G H;  1I94 L;  1EUJ A;  4X64 Q;  3CCV 1;  3K8A A;  3HOW H;  3CQZ H;  3HOZ I;  3U4Z A;  3GTO I;  3M4Q A;  4JI7 L;  3HOV G;  2IHE A;  3S1M I;  1JT8 A;  4NB3 A;  4ALP A;  3KLW A;  2VQE L;  4A3B I;  2R6M A;  4DV2 L;  3S14 I;  3MON A;  4A3L I;  4NB9 A;  4DV3 L;  4A93 I;  2UU9 Q;  3RZD I;  2AMC B;  2UUA Q;  5C4X G;  5GQO A;  2R92 I;  4JI1 L;  4DR1 Q;  1VQD A;  3PF5 A;  3HOV H;  1B8A A;  3PO3 I;  4IJL A;  1KIX A;  4YWM A;  4NXN L;  1X55 A;  3KYH C;  1KRS A;  2PM9 A;  2V1C C;  3J81 c;  4DV4 Q;  1HNX L;  4DV1 L;  1X3E A;  1TWF H;  3J7Z C;  1VQ5 Z;  1Q82 2;  4QJF A;  1WOC A;  4B3M Q;  3S16 I;  4A3K I;  5C4X H;  1I6H I;  2JA6 G;  2JEB I;  4DAM A;  4HGZ A;  4A3I G;  1WYD A;  4RVF A;  1JB7 A;  3T1Y Q;  1X54 A;  1SMX A;  1KQS A;  3HOY G;  4X65 L;  2M6N A;  3JAM i;  3H3V H;  4DUZ L;  3M3Y I;  1Q81 2;  1S40 A;  2YYZ A;  3CMA Z;  3K7A H;  3S1Q I;  2UXD Q;  4A4I A;  5C44 H;  3NDI A;  2FXQ A;  2E2J H;  4RVG A;  4P74 A;  1VQJ A;  5AJ3 Q;  4A3I H;  1M1K 1;  2HIV A;  4B3S Q;  3I4M I;  1VQF A;  4IO9 A;  4R4Q A;  3IRB A;  2F3I A;  2AWN A;  1VQ9 1;  2D62 A;  3JAM f;  3J80 c;  1NMG A;  1N36 L;  5FLX f;  3F8T A;  4QQB X;  2K75 A;  2ZAE B;  3T4N B;  4DK6 C;  1HR0 L;  1UE6 A;  2K5R A;  4XTC S;  1MJC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...