1L1OC

Structure of the human replication protein a (rpa) trimerization core
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
178
structure length
173
Chain Sequence
NTNWKTLYEVKSENLGQGDKPDYFSSVATVVYLRKENCMYQACPTQDCNKKVIDQQNGLYRCEKCDTEFPNFKYRMILSVNIADFQENQWVTCFQESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFRSFIFRVRVKVETYIKATVMDVKPVDYREYGRRLVMSIRRSALM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Replication protein A 14 kDa subunit
publication title Structure of the RPA trimerization core and its role in the multistep DNA-binding mechanism of RPA.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 173
sequence length 178
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08646 Rep_fac-A_C Replication factor-A C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1l1oC02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1l1oC01
4Y52H 4GNXC 4X64L 2D0PA 3KJOA 3F2CA 2I5MX 2UXBQ 2IHFA 3B6YA 4DV3L 2KCTA 1R9TH 2PNHA 5M3MH 4A3CH 4OO1I 4QQBX 3PO2H 4ALPA 1N32L 4NBFA 2ATWA 2E2JI 1Z9FA 4OXPA 2N78A 3I56A 2J6AA 1D7QA 4NPSA 4IFDG 1IZ6A 5DLQE 4PZ7A 3T1HQ 1VQCA 2JQOA 2UUBL 3S17H 3CP0A 4EX5A 2Z0SA 1YJWA 2B63G 5C4JI 1JJGA 1CKNB 2HQLA 1J5EL 5FLMI 2NVTH 4LFBQ 3H0GI 2BH2A 3STBC 2WFWA 1XMOL 3M9BA 4JI6Q 1U5KA 1SMXA 4HJAA 4QTUA 3RZDI 4X65L 3HOXI 5IP9H 4LFCQ 2VZAA 4A3BI 1FL0A 3S1NH 4A76A 3D6WA 3CD6A 2V1CC 2Y0SE 4IJHA 2DE7A 1ML8A 4DR6Q 2UXCQ 3M3YH 4DUZQ 5IYDH 1VQ4A 1YBYA 4P72A 1P16A 1UE5A 3VMGA 1SR3A 5JJKA 3ULLA 3UE0A 1YJ9A 1YUAA 1IXRA 5H1SE 3GTQH 4JCVE 2LSSA 4A3DH 2NN6G 3PV0A 1L1OB 2DGYA 3M85A 4A3GI 1KRTA 2PK7A 2YTXA 3LUSA 2F4VQ 2MO1A 1X3WA 1QVGA 1NTGA 4LF7Q 2YTVA 2UUAL 5GAGC 4IPDA 3PUWA 4PZ8A 4TVAB 5BR8L 4BY1H 4BBSG 2GN5A 1PYSB 2K5RA 3CCEA 1VCIA 2ZM6L 3PO3G 2RHSB 3EERA 1DGSA 5HGQA 4K0KQ 3J80c 1EIFA 3VB9A 3S16I 4DV2Q 3HOVH 1PH6A 4RMFA 5IP7G 1HNWL 1O7IA 1XPOA 1Q7YC 1SFOH 1VQDA 1OXXK 5M3FG 3PUXA 4YCWA 5LMNL 4AQYQ 4DAMA 1VQPA 1Z47A 3T1YQ 2YU9H 4X66L 2PQAB 1CKNA 1YHBA 5IYCG 4WJ3M 4IOCA 1VQNA 2ID0A 4DV6L 3I07A 2JA7H 4DR7L 4B3MQ 5FLXc 4DKAC 2K4KA 4IFDJ 5C4XI 4UP7A 3RLOA 3GDEA 2VQEQ 4A93G 2KPIA 3KLWA 2NN6I 1MIUA 2UXDL 2IX0A 2JE6I 4IO9A 1TWGI 2VUMG 3H15A 3I4MG 4OWWB 4IOAA 1C7YA 4UPAA 1VQFA 1VQLA 3HOZG 4A3IH 4BA2I 1TWAH 4GKJL 4NXNQ 4R4QA 1KRSA 1XTDA 1NMGA 1JJCB 2WAQE 4DV5Q 3PO3I 3PUZA 1I3QH 1VQGA 1XNQQ 2IHEA 3S14H 1WJJA 1VLAA 2JA8I 1MKHA 1IBLL 1HZ9A 2HIXA 3J7A5 3G4SA 1PH9A 4QL5A 1SE8A 4XIGS 4DAYB 2JA9A 4DR4L 1L1OA 1B8AA 3CCRA 3MXNB 4GOPC 4OX9L 3GTPI 1HNXL 2VY3A 3S2HH 3TQYA 1KIXA 2R93I 4LW1A 4PG3A 3GD7A 1I6HI 4NBGA 4GLVB 2LXJA 1GO3E 4GN3B 5FJ8H 2JA5G 1NUIA 4JI7L 2MO0A 2R92G 2N49A 1WCMI 3UE1A 1IBMQ 3GTMI 4POGA 3K80C 4B3RL 1IYJB 2AKLA 4A3LG 4OWXB 1KD1C 1TWFH 3GTOI 3JC66 4NB3A 4POFA 4A75A 1XPRA 3FKIG 4DK6C 2VUMI 4JG2A 3I4MI 2ALYB 2R7ZH 1PVOA 2JNYA 1YI2A 4JV5L 1OXVA 2OWOA 4LFBL 3G71A 4C2MH 1FJGL 1Y1VG 1LQLA 4HIDA 2E8GA 4JI4Q 4DR2L 1BBUA 4GS3A 1HR0W 2UUCQ 4YWMA 3K7AH 5CM2M 1SROA 1HH2P 5AJ3L 1P8LA 3NENA 4BBRG 3S1MI 3NBHB 2RF4A 1Y1WG 3I4NG 1E1OA 3I55A 2YTYA 4AYBE 1PH1A 3RLNA 2CWPA 1RL2A 1XJVA 4HJ8A 2GVBA 4FDBA 3U4ZA 4GLXA 3CMEA 2WP8J 4BY7G 4LF8L 2NZHA 1W3SA 1TWCI 4B3TL 4XX2A 2JA5I 1HR0L 2E2JH 4JOIC 2R92I 3G48A 4LWCA 1Y14B 2K5NA 1X55A 4JI0L 2MQHA 1KXLA 4R1JA 2OCEA 3W5OA 3PUVA 5LMUQ 3PUYA 2CQOA 1CUKA 3AFPA 3GTKI 4P71A 3CF5A 1VQEA 3KF6B 4JI8Q 4DR1L 3SGIA 2FXQA 1AE3A 4A3JH 3G6EA 4A3KH 2AWOA 1VQIA 2GVAA 4IPGA 1YHAA 1Y1VI 5IWAL 3H3VI 1PFTA 2UU9Q 2ZTEA 3CPFA 4DV4Q 1DL6A 1B70B 5M3MG 2CKZB 3UDXA 4A3CG 3PO2G 3L0OA 3HOXH 1UE7A 3KF8B 4JI3Q 4A3BH 4BBRI 3GCFA 3PIPA 3OW2A 3CC2A 3I4NI 2PI2E 4AQYL 4A3MI 4QGUA 2NVYI 1WFQA 1EUJA 2K5HA 2IY5B 1N34L 5GAEC 3HOWG 1N33Q 1U0LA 3KJPA 2A19A 1CSPA 1VQ5A 1NBWA 2Y0SG 2Q2UA 1QZGA 4DR5L 2E5LL 2Q2TA 1K83H 4P75A 3AYHB 4A3FG 2WB1G 4YY3L 1M1KC 4JI2Q 3RNUA 1QYPA 4Y7NI 4LF6L 3CMAA 4A3GH 1PV4A 1YZ6A 4MNOA 4HIOA 1I94Q 4JYAQ 1N9WA 5IP9G 4JBJA 3S1RI 1USPB 4JOIA 1K8GA 3K7UC 4HIMA 3RR5A 3H3VJ 2BA1A 4HJ5A 3TRZA 5JEAJ 4X62Q 4LUVA 3HOUH 3TS2A 4AH6A 1XMQQ 1RIPA 2HHHQ 4AIMA 1TWHH 5C3EH 1X3ZA 2R6GA 4LF9Q 4IPCA 1OTCA 5IYDG 2XGTA 3S16H 1WOCA 3PO2I 3S15I 4KHPL 3GTJI 3PCOB 1YEZA 1V43A 3U50C 3TS0A 4A3DG 1QUQB 3PF4A 1KQSA 3BJUA 4GNXA 1ASYA 3Q8DA 4H02A 3KDFB 3HOWI 1EQRA 2AWNA 1BVSA 3M4OH 4IFDI 3S17I 1V9PA 1LUZA 1Q8KA 5JJIA 2NVTI 5LMNW 4R4CA 2B63I 5C4XH 4A3FI 1VQAA 2ZTDA 2IX1A 4LFAQ 3NELA 2VQFQ 4NXMQ 2K5VA 1HNZL 1CKMA 1QVFA 1UE1A 1YVCA 1H95A 2OQKA 1CKOA 1X6OA 1TXYA 2DUDA 3IRBA 1G291 5IP9I 2VNUD 3DLLA 1QVCA 3S1NI 1EWIA 4LF5Q 3OTOL 2E2II 4LF4Q 2F3IA 3M3YI 4DV1L 4X64Q 3ULPA 3PO3H 2QEXA 1A63A 1XNRL 1N36L 4DV3Q 5IT9c 1IBKL 1VQHA 1GD7A 2JA8H 1N32Q 2JA7G 4BXXG 5HY6A 1GM5A 1JMCA 3E9IA 3CCJA 4DV0L 4DV7L 2E2HH 5JJLA 1OXSC 3M4QA 5C44H 2BJOA 2R93H 1UWVA 1K3RA 4O0AA 1AE2A 2VW9A 2F52A 1VQ9A 1D8LA 3PGZA 1KC8C 1YNXA 4A3IG 1HZAA 1WCMH 3GTMH 1J5EQ 3CCLA 3HOYH 4DK3C 2H5XA 1YIJA 4PZ6A 1XMOQ 3GTOH 3EN2A 5LMUL 1UEBA 4HJ7A 4BBSI 3K0XA 4DPGA 4YHHL 4GOPB 3VMIA 1LM0A 4JI1Q 4X65Q 4JI8L 1GKHA 2Q2IA 1WYDA 3ER0A 2NZOA 1X54A 4YCVA 2NVXH 1GVPA 1FGUA 5IP7I 2JR6A 2LXKA 2UU9L 3I4OA 1Q86C 4L5RC 1PH2A 2NVQH 5C0XJ 2YU9I 3ICEA 3NEMA 2UXBL 4C3HH 3GTLI 2PMZE 3MEFA 4GKKQ 1WW9A 4JI3L 5FJ8G 1VQ7A 1E24A 3J81j 2A1AA 3U4VA 2R7DA 4A3EH 1PHJA 4BXXI 1NJIC 4KHZA 1RLYA 2JEAI 2JA6G 1A62A 4A93I 4NBEA 5M5XH 3T1HL 2R7ZG 1VQJA 4AYBG 1TWCH 1PYBA 3PSIA 2R92H 4A3II 4TQUS 2A8VA 2UUAQ 4LUZA 4X6AH 1S72A 5BR8Q 3HOZI 1VQKA 5ELOA 3S2DI 4JI6L 2VS1A 3E9HA 2PQAA 2CWAA 2ZM6Q 1L0WA 4KLKA 1KHIA 5JEAG 3W1GA 3GTKH 4NBCA 1ASZA 1JB7A 3S14I 3GTGH 4LFCL 1XMQL 1HNWQ 3S1QH 5GADC 1Y1VH 4LF9L 4DR6L 4NB9A 2ZJQA 2UXCL 3UDGA 4DUZL 2OTLA 2K14A 3L2PA 4NBHA 4DR3Q 1VQOA 5GQOA 1PA6A 4DV6Q 2YYZA 4A3MH 4DR7Q 3E0EA 2NVYH 3A74A 4APVA 4EQ5A 2RHQB 4GOPA 3D31A 1I50I 2JA6I 4A3LI 2N8NA 2UXDQ 4NOZA 4OWTB 1EYGA 4NBDA 2F4VL 3ZJYC 1FVIA 5IYBH 1Q12A 1YITA 3FKII 5C4JH 4A3JG 4LF7L 4A3KG 4OONA 3ESWA 3K81C 1I5FA 5FLMH 3CQZI 1VS0A 3H0GH 2YV5A 2KHJA 4NXML 4GKJQ 4GLAC 3PF5A 3PO3S 1X3EA 3J81i 1L2FA 2D62A 3HOXG 4YCUA 2ZTCA 2QA4A 4K0KL 3RZDH 3S1RH 4A3BG 1PH3A 2D0OA 4DV2L 1K73C 4IPHA 3BZCA 1IBLQ 2B3GA 3HKZE 4LF4L 4BA1I 1X3FA 4A4IA 3U58A 1X65A 3RZOI 4DR4Q 2KENA 1Y1WI 2EQSA 1PH4A 5IY0A 4OX9Q 3CCSA 3RN2A 2B29A 3T1YL 1HNXQ 5J3BA 1PH7A 2BA0A 4LNQA 3S15H 3GTJH 1SN8A 1A0IA 3GTMS 4JI7Q 4BY7I 3CC7A 4L5QA 4B3ML 1C0AA 2MNAA 4B3RQ 4IJLA 2VQEL 3ERSX 1M90C 2K50A 3DM3A 4A3GG 1EQQA 4L5TA 3HOWH 2F4MA 2EIFA 3A0JA 2C35B 3K8AA 2JEBI 3F2DA 4JV5Q 3UDFA 1NMFA 4MZ9A 3CCQA 1XPUA 2RCNA 3HOUG 3L7ZC 2B63H 4A3JI 4A3KI 1OXUA 1FJGQ 4A3FH 3J7ZC 2KBNA 3HKSA 3HFZB 5GAHC 5C3EG 4NXNL 3PIOA 4C3IH 4P73A 3KFUA 4DR2Q 1BKBA 1PH5A 3VMHA 4Y52I 4DV5L 2KHIA 4JI1L 3GKQA 1PFSA 2KCMA 3EBEA 5AJ3Q 1XNQL 1Q1BA 1A8VA 1R9TI 5C0XG 1SLJA 4A3CI 1X56A 4JI5Q 2E2IH 2I0QA 1QZHA 2P3YA 2JK8A 3CPWA 3F2BA 4DUYQ 2WB1E 3JAMi 4GKKL 2OTJA 3KF6A 1VQMA 1W2BA 4HJ9A 2L15A 4LF8Q 4B3TQ 1YJNA 2CFMA 1HR0Q 5C4XG 1K83I 1BBWA 4QJFA 3D0FA 1IBML 1MJEA 4BY1G 4JI0Q 1YHQA 4QY7A 3CCVA 1VQBA 1NY4A 4JBMA 3GO5A 1TWGH 2N3SA 3F1ZA 2Q2HA 1KL9A 3HOVG 2F4OA 1RO4A 4B3SQ 2DE6A 4DR1Q 2CCZA 1Q1EA 3HOUI 1Y1VS 4DNIA 1L1OC 1TWHI 5C3EI 4JI4L 3Q87A 4BBSH 5IWAQ 3CXCA 4RG1A 1VQ6A 1CSQA 2UUCL 4MTNA 1Q81C 1Q82C 1S40A 2JA8G 4HIKA 1C9OA 1N8RC 5C0XI 4QIWE 5IP7H 1G51A 2EXDA 3M4PA 5C44G 3GTQI 2WAQG 5M3FH 2ES2A 2R93G 3A5ZB 1N34Q 3GTPH 4A3DI 1OXTA 1IL2A 3GTLH 4JBWA 2HIVA 4DR3L 2QGQA 3M4OI 1USPA 4XTCS 1S3OA 3RLFA 4WJ4A 1WCMG 1I6HH 5IYCH 3HOYG 2UUBQ 4BXXH 1KAWA 4DR5Q 1V1QA 1Q46A 2E5LQ 4MH4A 3CAMA 4O2DA 3TEHB 4YY3Q 2R7FA 5M5YH 4BY1I 4LF6Q 1PH8A 5M5WH 1JJ2A 1HJPA 1EIYB 4A93H 1NE3A 1K9MC 5ELNA 2MFIA 4R4OA 5E7NA 2VUMH 2HT1A 3I4MH 3HOVI 1SRUA 3M7NA 1QUQA 3EIVA 5K36G 3HOZH 4ME3A 5EAYA 2HF1A 1WI5A 1SFOI 3S2DH 3ULJA 4L5SA 3UDIA 3FHWA 3KDFA 4JC0A 4DV4L 4J15A 3CW2C 3AEVA 3A5UA 2ZJPA 4A3EG 2AHOB 3I7FA 3S1MH 3AFQA 3WWVA 4KHPQ 1E7ZA 3STBD 2ASBA 2RBLA 2JA7I 3RN5A 2E2HI 3S24A 1K8AC 4UY8C 3CCMA 4UP8A 1J6QA 2Z6KC 4YWKA 3KOJA 5C44I 3J80i 1LYLA 1N33L 1EOVA 4NBAA 3J81c 4KI0A 2I5LX 3I2ZA 1N2FA 3HOYI 4GN4B 1X3GA 3BZKA 2DE5A 2JA5H 2AMCB 4JI2L 2AKWB 1JT8A 1I50H 1TWAI 5GROA 4NBBA 2JA6H 4PMWA 4A3LH 3CC4A 1JE5A 1HNZQ 1K0RA 1I94L 2ZJRA 4JYAL 1I3QI 3LGJA 3FKIH 1LTLA 1HZCA 4QTTA 2NVXI 1HZBA 2XTIA 3CQZH 4X62L 3FP9A 3OTOQ 1E22A 2HHHL 1UE6A 2JJQA 4YWLA 2NVQI 3H3VH 4DV1Q 2JS4A 5LMNQ 3CCUA 3F8TA 1G6PA 1N36Q 1XNRQ 3S2HI 4JBKA 4X66Q 4OO1G 1E3PA 1IBKQ 4JI5L 2VL6A 4A3EI 4BBRH 4A3MG 1TFIA 4NB8A 3RZOH 4DUYL 2K52A 1Y1WH 1B7YB 3KYHC 3I4NH 1E1TA 4P74A 4DV0Q 4DV7Q 1VQ8A 2BH8A 2PI2A 1TWFI 1AH9A 1ZB9A 1X9NA 5IYBG 3AQQA 3HKZG 1EFWA 3TREA 4BY7H 2R7ZI 5FLMG 3H0GG 4X6AI 3OYYA 2Z6KA 3W1BA 4Y7NH 2I5HA 4LFAL 2VQFL 1MJCA 3BU2A 5IE8A 4R4TA 4GNXB 3K7AI 4YHHQ 2OQ0A 3JAMc 2K75A 3GTGI 1T9HA 4GN5A 4B3SL 3VDYA 1ZB8A 4LUOA 3S1QI 4C3JH 2IT1A 4R4IA 4UP9A 4LF5L
chains in the Genus database with same CATH superfamily
1TIID 2SDFA 4U673 1EYAA 4Y52H 2IWHA 4GNXC 4X64L 2V3VA 1G2TA 2D0PA 3KJOA 3F2CA 2I5MX 4G4KA 2Q8TA 1JJ2Y 2IHFA 3B6YA 2UXBQ 3SK4A 4DV3L 2ZXRA 3HRZC 2KCTA 1R9TH 4FF2A 2PNHA 1RCVD 1JWHC 5M3MH 4A3CH 4OO1I 4QQBX 3PO2H 2IPKD 2X6LA 4ALPA 1PFMA 4ZKCB 1M1K1 1N32L 4NBFA 4KJOA 1A3VA 1L0YB 5M3FB 1VQ4Z 2ATWA 3GTPB 1PDQA 2EYPA 2E2JI 2OTJZ 1Z9FA 3L9AX 2K3RA 3GTLB 3OHXC 3NSWA 5D1PA 4PNYA 3TBIB 4OXPA 3VR6A 4HGYA 2N78A 3I56A 2QLVB 1JQYD 3MC0B 2A74C 2J6AA 3NXWA 1D7QA 4NPSA 1I6HB 1FNVA 2CW0D 1LTRD 5KYLA 4IFDG 1IZ6A 3EFXD 5AFWA 1CA6A 1L0XB 3QIAA 3NH5A 2XWJB 2ICEC 5DLQE 1W6JA 4PZ7A 3T1HQ 1I4GA 1VQCA 2JQOA 3D4DA 4DN4M 1FYCA 1RNIA 4PQXA 3VR3A 2UUBL 3S17H 1T5EA 3CP0A 4EX5A 2Z0SA 5M5YB 1YNNC 1YJWA 2B63G 4FXDA 5M5WB 5C4JI 1Y69U 2EXZA 1JJGA 1CKNB 2HQLA 2HQEA 1JOOA 1J5EL 5FLMI 1EQVA 2NVTH 4A93B 4LFBQ 4KTAA 3H0GI 2BH2A 5JOBA 3STBC 2D9UA 3K59A 1EIHA 2WFWA 1XMOL 3M9BA 1QVGZ 4JI6Q 2RVLA 2LFNA 2VUMB 1U5KA 1SMXA 2PQEA 2F0SA 3I4MB 2Z8LA 2KQ3A 2E74C 1QB5D 3BG3A 4R8IA 5COYA 3JAME 3FPPA 4HJAA 4QTUA 2B2WA 4ZKBB 3SK8A 3RZDI 3OSOA 1ZXTA 2PZTA 3HOZB 4X65L 3L3OC 3P20A 3QWNA 3S2DB 4DF7A 5KNCA 3KLRA 3CCL1 3HOXI 5IP9H 4LFCQ 4KMUC 1PFBA 1LTSD 2VZAA 3CXCZ 1VQ6Z 4A3BI 1FL0A 2K5WA 4RFBA 3S1NH 2B2UC 2KCNA 4A76A 3TP5A 2B8FA 4EGVA 1IL8A 3D6WA 3BS1A 1M1K2 3CD6A 4C56C 2V1CC 2Y0SE 3SXHA 4IJHA 2DE7A 3EJIA 4I65A 1ML8A 4DR6Q 4B08A 3H94A 2UXCQ 3VYTA 1EY4A 1JOQA 2EYLA 3M3YH 1XTCD 2EZVA 1TS5A 4MD8A 1KDBA 3S1MB 4DUZQ 3MAQA 2JMOA 5IYDH 1HCZA 1VQ4A 1YBYA 1LLRD 4P72A 2O4XA 4KV6A 1P16A 1UE5A 1VQPZ 2CQAA 5C0XH 2G2KA 3VMGA 1SR3A 5ELCA 1F9QA 2PPBC 1H9SB 5JJKA 3ULLA 3UE0A 1YJ9A 1CK1A 1MI2A 1OO9B 1YUAA 1EIGA 1IXRA 3FDTA 4HH4A 5H1SE 3GTQH 4JCVE 2ZAEB 2LSSA 5FLXL 3TE5B 4ULLA 2NN6G 4A3DH 4KKSA 3TN2A 2MP1A 3DXJC 3PV0A 1L1OB 2DGYA 1S5DD 1GUWA 1LV9A 4A3GI 1TWCB 1KRTA 3M85A 1VQ71 2PK7A 1CZGA 2YTXA 2JA5B 3LUSA 2F4VQ 1DOMA 2IJ0A 1JOKA 2MO1A 3NBIA 1Q90A 3BYYB 1EY5A 1X3WA 1QVGA 4X3UA 1I50B 1NTGA 4LF7Q 2DNCA 1X0TA 2YTVA 3G6JB 4WORA 2JA6B 3IFUA 3SE0A 2UUAL 1MSGA 1IW7C 5GAGC 1SNCA 4IPDA 3PUWA 4PZ8A 2M2LA 4TVAB 3V96A 5BR8L 4BY1H 2KVMA 4BBSG 4ZRZA 1VQLZ 3GTKB 3EROA 2GN5A 2NWGA 2JUBA 1PYSB 3FKIB 1TR5A 2K5RA 1B9NA 3CCEA 2OZKA 4EWCA 1VCIA 1VF5C 2ZM6L 3PO3G 2RHSB 4ZUJA 4XXEA 4CKEA 3M7GA 3CQZB 4CDFC 5LHY1 3EERA 3P75A 1DGSA 4XQJA 3H6MA 5HGQA 3J80c 4K0KQ 1EIFA 3X3MA 3VB9A 3S16I 1AEXA 3J80f 1K28A 2QCPX 4DV2Q 4KHVA 3HOVH 1GUNA 4HTHA 1PH6A 4RMFA 2MPMA 1Y1VB 5IP7G 2F0TA 5J1ZA 1O7IA 1HNWL 1XPOA 1Q7YC 1SFOH 2B2TC 4J1MA 1VQDA 2XWBB 1OXXK 4QUCA 4H44C 5M3FG 1DM0B 1JICA 1C48A 5T67A 2WKDA 3PUXA 1MD2D 3SVMA 4KD3A 4YCWA 5LMNL 4AQYQ 2F0DA 1X32A 4DAMA 1KC81 1VQPA 1STGA 1Z47A 2OEOA 3T1YQ 2PW7A 4BBRB 4CDDC 1WTRA 4EQNA 4X66L 2YU9H 5K5PA 1EY7A 2PQAB 1CKNA 1LTID 2NTSA 1O78A 5IT9f 3RZOB 2M48A 1YHBA 1ZYRD 3CCMZ 5IYCG 1Y1WB 4WJ3M 2PM9A 3I4NB 1ML0D 2PMZA 3E3XA 5F2DA 3NDJA 3H3VC 4IOCA 1VQNA 3BG1B 3IAYA 3ONAB 4RCNA 1A3TA 2ID0A 4QB4A 4DV6L 2XRQD 3M4YA 3I07A 2JA7H 1ET9A 4DR7L 3IFTA 5FLXc 2FFKB 4HR7B 4KKTA 4DKAC 4B3MQ 1LTGD 1NR2A 2K4KA 3CCU1 5FLXf 4IFDJ 5C4XI 4UP7A 3RLOA 3GDEA 2EY5A 2VQEQ 5D1OA 4IALA 2XRSD 4A93G 2KPIA 1SYBA 3MZLB 2OTL1 2LIYA 3KLWA 3NE5B 4FF1A 2NN6I 1HFNA 4BY7B 2Z9HA 1FGBD 1MIUA 5J22A 2UXDL 4MTKA 2IX0A 3I8ZA 4E32A 2JE6I 1ENCA 4IO9A 1TWGI 1BDOA 4M1UB 2VUMG 3T51B 3A56A 3WOFA 3H15A 3WDNA 1Y8CA 1STEA 4BS9A 2A5HA 3I4MG 4OWWB 4IOAA 1C7YA 2JXMB 2PCFB 4UPAA 1STYA 4TSSA 3HGBA 4Y7NB 1VQFA 1BNZA 1VQLA 3CC4Z 3HOZG 1VQ81 1DXMA 2M00A 4A3IH 4BA2I 1Q861 1BCPF 2F0PA 2L1BA 1B53A 1QNKA 5LL6f 1YI2Z 4XDXA 1TWAH 4GKJL 3G71Z 3K0YA 4NXNQ 4R4QA 1KRSA 1XTDA 1NMGA 2CW0C 1A6XA 5DEHA 1JJCB 1KABA 2WAQE 3J80E 4DV5Q 3PQIA 3PO3I 3Q6SA 2YADA 3PUZA 4UDUC 4C3JB 3I70A 1I3QH 3T16A 2A6ED 4H7BA 3K5NA 1KC82 1YIT1 1VQGA 1XNQQ 2IHEA 3S14H 2GA4B 3U9OA 1NJI1 1WJJA 2W04A 4GZYC 3J7AF 1VLAA 2LFUA 4CHTB 1V1PB 2JA8I 3D4RA 1MKHA 4N9TA 1IBLL 1HZ9A 1AN8A 2HIXA 3J7A5 3Q24A 3G4SA 1PH9A 4CL1A 4QL5A 1STNA 1SE8A 4XIGS 2FJ2A 4DAYB 2JA9A 4DR4L 2R61A 3P5JB 1L1OA 2EE1A 1B8AA 3CCRA 3MXNB 4GOPC 5M3MB 4IN3A 3CRKC 4OX9L 3GTPI 3PO2B 5IGEA 5IT9E 1HNXL 1K0SA 4DAPA 2QA41 1Y8PB 2QEJC 2VY3A 3S15B 3S2HH 3TQYA 1KIXA 3D8GA 2R93I 4LW1A 4PG3A 2QKIC 3GD7A 1LTAD 1I6HI 4NBGA 4GLVB 2LXJA 1GO3E 4GN3B 5FJ8H 4N8FA 2JA5G 1NUIA 5IIFA 1AZQA 4JI7L 2MO0A 2R92G 2NTTA 1NNXA 2N49A 4ABNA 3CMEZ 5FLXE 1WCMI 3UE1A 3DWQA 4FXKC 2QF7A 1IBMQ 3GTMI 5EGTA 4POGA 3K80C 3TDHB 4B3RL 3A55A 1IYJB 1RTNA 2HD3A 2AKLA 4A3LG 3CCS1 3HOWB 4ILWA 4OWXB 1Q862 1KD1C 1TWFH 3S17B 3GTOI 3JC66 3R8BA 2F1MA 4NB3A 4F87A 4POFA 1F2LA 3QG1A 5I4DA 4A75A 4MD9A 4J6HA 2NVTB 4CGYB 1EY8A 4YIJA 2Y0SB 1XPRA 3FKIG 4DK6C 2VUMI 4JG2A 1B2TA 2E75C 3I4MI 2ALYB 3IFDA 2J7ZA 2JNYA 4DGLA 1YI2A 2R7ZH 1PVOA 4JV5L 1HA5A 4A3FB 1OXVA 2OWOA 4LFBL 2RSOA 3G71A 1SJHD 1DOLA 4C2MH 3A8IE 5JAVA 3I561 3I91A 2V8KA 4S3SA 2FINB 4G57A 4C3IB 1FJGL 1NJI2 1Y1VG 1CTMA 1LQLA 4IUTA 2DNEA 1H9KA 3SK5A 4HIDA 2E8GA 4JI4Q 5M9OA 4DR2L 1BBUA 4DNRB 4GS3A 1PTOH 1HR0W 2UUCQ 4YWMA 3K7AH 2DY7A 5CM2M 1SROA 1YJW1 3S1NB 5CBAE 2LY7A 4ZUIA 1HH2P 5AJ3L 1CI3M 1RODA 1P8LA 4RVGA 3NENA 4JW0A 4BBRG 3CCQ1 3GP7A 3S1MI 3HS0C 2E2IB 4TKOB 3NBHB 1ILPA 2CVRA 3GV3A 3TSSA 2RF4A 1J8IA 1Y1WG 1ET6A 3NFZA 2VB3X 3M3YB 3I4NG 1E1OA 2EYOA 1RJTA 2LS01 3I55A 2YTYA 1QVGY 5TSSA 4AYBE 1Y8NB 2XVSA 1PH1A 1HHVA 3RLNA 5LL6X 2JYOA 2CWPA 4IUNA 3HKZA 1V8QA 4B9WA 1G8ZD 1RL2A 2JIQA 1XJVA 3HG9A 2R3ZA 3CC2Z 5D3IB 3DUZA 4HJ8A 2GVBA 3SHLA 4FDBA 3U4ZA 4GLXA 2VPXA 1VDZA 1F9RA 1EEFD 2F0MA 3CMEA 4WRDA 2EYHA 2WP8J 2XSCA 2ENBA 4OO1H 4BY7G 1BCPB 1SNQA 2F3WA 1G2SA 2KI7B 3CXCY 5ELDA 1GUGA 1PMRA 3NQIA 1SAPA 1ILQA 3QR8A 3GTQB 2C9OA 4LF8L 1JWSD 1W3SA 2NZHA 1TWCI 2SOBA 3I4LA 4HN7A 4B3TL 4A3DB 4XX2A 2JA5I 1HR0L 2E2JH 2ICIA 4JOIC 1K3BC 3RMHA 2R92I 1UUPA 3G48A 4LWCA 4EQPA 5C4HA 5JVH3 1Y14B 2B8GA 2K5NA 1VQ5Z 1X55A 4JI0L 2MQHA 1EYDA 5BN5A 1KXLA 4JVZA 1QILA 3HZXA 2GU2A 1VQ41 4R1JA 2OCEA 3W5OA 1CA5A 3I90A 2L4NA 2OTJ1 3PUVA 1K731 5LMUQ 3C2PA 3PUYA 1B9MA 2F0WA 2CQOA 2E2DC 1CUKA 1V1PA 3AFPA 3GTKI 4QIWB 2AQ2B 4CJ1B 4P71A 5CV6A 2HUGA 5EPLA 3CF5A 1ZYRC 1VQEA 3KF6B 3C46A 1PTOD 1K8OA 5A2Qb 4C3JG 4JI8Q 5KYIA 4DR1L 3SGIA 1ENFA 3MXNA 4V0BA 3IL8A 2FXQA 1M4VA 1AE3A 2O53A 1X3PA 4A3JH 1RKNA 3G6EA 3VA7A 4A3KH 2AWOA 1VQIA 1EY6A 1F9PA 2GVAA 4IPGA 1YHAA 1Y1VI 2WINB 3T4NB 2B2YC 5CV4A 5IWAL 2IZ4A 4KN7C 3H3VI 1PFTA 2UU9Q 2ZTEA 3CPFA 4DV4Q 1WTOA 1QJOA 1DL6A 1B70B 5M3MG 2CKZB 3UDXA 1SFOB 4A3CG 4DFAA 3CD6Z 3L0OA 3PO2G 4PMCA 2K5QA 3HOXH 1CZWA 1UE7A 1SE2A 2PZUA 3KF8B 4JI3Q 4BBRI 4A3BH 3FEWX 3NH8A 3GCFA 3PIPA 2NBFA 3OW2A 3CC2A 3GV6A 4ZQ3A 3MFYA 1Z03A 3I4NI 1ESFA 2YU9B 2NUCA 3J7YW 1QOHA 2PI2E 4AQYL 4A3MI 4RHRA 4QGUA 2A6HD 3K6OA 2NVYI 1VQ61 4XYQA 1WFQA 5G3LD 2JP1A 1EUJA 2K5HA 4RVFA 2IY5B 1N34L 4DU9A 5EBDA 2N55A 3OIPA 3EQLC 5GAEC 3HOWG 2K04A 1N33Q 1Y8OB 2WB1A 1YJ9Z 1U0LA 3KJPA 3F2UA 1KQSZ 1RHPA 2A19A 2H1EA 2JA7B 2AQ3B 1RF2D 1E0BA 2A6EC 1CSPA 1K732 1VQ5A 1Z01A 1NBWA 1KAAA 2Y0SG 5CORA 2Q2UA 1QZGA 1W6KA 2EVBA 3I3CA 4DR5L 4IUQA 2E5LL 2Q2TA 1CM9A 3N6RA 5I6YA 1K83H 2JN4A 4P75A 5KRUA 3AYHB 4A3FG 1VQP1 1NUCA 2KA7A 2IW3A 2WB1G 4YY3L 1M1KC 1TY0A 4JI2Q 2H4OA 1LACA 1QYPA 4Y7NI 1HPCA 3RNUA 4LF6L 1HRJA 2F3VA 3VYSA 2DY8A 4C3IG 2A68D 2FMCA 1Q8IA 2EYFA 4JPBW 1S5BD 2VUGA 3CMAA 4A3GH 3AB9A 2OOXB 2VXWA 2F0LA 3T53B 1PV4A 4A3IB 1YZ6A 4MNOA 4HIOA 1I94Q 5I9OA 4DXFA 2Q8RE 4JYAQ 3KLSA 1N9WA 5IP9G 3Q0AA 4JBJA 3S1RI 1ICWA 5ELFA 1HXYD 1USPB 4JOIA 4RGOS 1TWAB 1K8GA 3CCEZ 1LTBD 3K7UC 4HIMA 5KEEA 3RR5A 3J80L 2F0JA 1BO0A 5C4ZA 3H3VJ 2BA1A 1KTKA 3NWSA 4HJ5A 3TRZA 5JEAJ 4X62Q 4LUVA 5C5LA 5FKAC 3HOUH 3TS2A 4AH6A 4MONA 1XMQQ 1QG7A 1RIPA 2HHHQ 4AIMA 1M902 2B2VC 2AUJD 3GQBA 1NAPA 1TWHH 5C3EH 1X3ZA 2R6GA 4LF9Q 4IQZA 4BWGB 3S14B 2F03A 4IPCA 1OTCA 3EA6A 4M8AA 1BR9A 5IYDG 2RDFA 4Q5VA 2K5DA 2RSNA 4CKBA 1G6ZA 2XGTA 5LL6S 1VQL1 3S16H 1YUKA 5EPJA 2O2LD 1WOCA 1JB3A 3URYA 3PO2I 1WD0A 2QEXZ 3S15I 3GTJI 3K5OA 3PCOB 5IT9L 4KHPL 5T1IA 2VB2X 2F0NA 4E30A 1YEZA 2P5ZX 1V43A 5D3DA 2EYMA 3BG0B 3LWUA 3U50C 3S2HB 1JC7A 3TS0A 3P7JA 4A3DG 1QUQB 3PF4A 4UAIA 1SE4A 1KQSA 2CHBD 3BJUA 4GNXA 1VQNZ 3NQTA 1TT2A 1ASYA 3CCJZ 3Q8DA 4H02A 2F4IA 3KDFB 3HOWI 1EQRA 4DAVA 2AWNA 3DHQA 1BVSA 4IZ8A 3M4OH 4IFDI 3S17I 1V9PA 4K5WA 1LUZA 3A8KE 4DK1A 1Q8KA 3HP3A 2VPYA 5JJIA 2NVTI 5LMNW 1EL0A 1TWFB 1VQ9Z 4PMBA 4R4CA 3CCM1 3BDCA 2B63I 5C4XH 3NH4A 2HU9A 4A3FI 1VQAA 2NYZD 2ZTDA 2VPWA 5JPMC 2NN6H 4K6DA 1IYUA 2R7ZB 2IX1A 5HGTA 3C1FA 4LFAQ 3NELA 2VQFQ 4NXMQ 2K5VA 1STBA 2TSSA 1CKMA 1HNZL 1QVFA 1YIJZ 4AYBB 4C2MB 1N8R1 1NP6A 1UE1A 1YVCA 1H95A 2OQKA 1CKOA 5J39A 1X6OA 5T64A 1TXYA 4XQQA 2DUDA 3IRBA 5KNBA 1G291 5IP9I 1GHJA 4ZAIA 3DLLA 2VNUD 1K8MA 1NR4A 1QVCA 3S1NI 4XYOA 1EWIA 5CV9A 2GTIA 1AZPA 1PTOB 4XT1B 2DN8A 3K7AB 2LEXA 1F2ZA 4LF5Q 3OTOL 4E6IA 2F0QA 5E3FA 2E2II 4LF4Q 1A2TA 1KLGD 3CC41 3KBGA 1VF7A 2F3IA 3M3YI 2E9HA 1WZNA 1WJ2A 5EPKA 4DV1L 2O5JC 4X64Q 2MUYA 3ULPA 3PO3H 3O13A 2QEXA 1YI21 3G4SZ 5FO8B 3K5MA 1C4QA 2EY6A 1A63A 1N36L 1XNRL 3G711 4DV3Q 3OIQA 5KIXA 1FDIA 5IT9c 1IBKL 3CCRZ 1VQHA 1GD7A 3BVMA 2JA8H 4I7AA 4E2ZA 1NCVA 1N32Q 4U68A 1PTOC 2JA7G 4BXXG 2Q51A 5HY6A 1STAA 2QDBA 2B2UA 1GM5A 2PZWA 1STHA 1IKLA 1JMCA 4F88A 1SE3A 4FYDA 3E9IA 3CCJA 4DV0L 2RPRA 1K9M1 4DV7L 2E2HH 5JJLA 2EJMA 1OXSC 3M4QA 3ZYYX 5C44H 2K05A 5EQ0A 2K1BA 4K5XA 2BJOA 5CBEE 2R93H 2Q4ZA 1Q812 1Q822 1CT1D 1K3RA 1UWVA 4LMQD 1AE2A 4O0AA 2VW9A 2F52A 2E2JB 1VQ9A 1D8LA 2RT9A 3PGZA 1KC8C 3R93A 1YNXA 1I4RA 4OHJA 4A3IG 1N8R2 1HZAA 1WCMH 2PO4A 5BN4A 3PIP3 3GTMH 1J5EQ 3CCLA 2DJFC 3HOYH 1F77A 3FPUB 4DK3C 2FMMA 2IV2X 2H5XA 1YIJA 3MWYW 3OW2Y 4PZ6A 2EY1A 1TKWB 1H9RA 3Q22A 1XMOQ 2A6HC 3GTOH 3CME1 3EN2A 5LMUL 3ERQA 1XYIA 1UEBA 1TS4A 4HJ7A 4BBSI 1S72Z 3K0XA 5C3WA 4DPGA 4NW2A 1VQKZ 4YHHL 1CHPD 1MGSA 4GOPB 5A2QL 3VMIA 1LM0A 4A3JB 4JI1Q 4X65Q 4A3KB 3A7LA 1GKHA 2Q2IA 3D6CA 1WYDA 4JI8L 4DGZA 1GUTA 3ER0A 2NZOA 1ZH1A 1H9SA 2F0HA 1K8A1 1X54A 4CJ2C 4YCVA 2NVXH 2OF1A 1GVPA 2KUMA 2DJGC 2F0KA 1FGUA 1SNMA 3DWPA 3LNNA 3MEHA 5IP7I 5K36H 2QR1B 4MN3A 2JR6A 2LXKA 2VF1A 4K6LA 1U4MA 4DXGA 2UU9L 3I4OA 4DQYB 1Q86C 4L5RC 1U4PA 1PH2A 3HOXB 2A68C 2NVQH 5C0XJ 4OGQC 1R9TB 4A3BB 3NTKA 2YU9I 3ICEA 1K9M2 3NEMA 2UXBL 3MA2B 4C3HH 2JIOA 3I55Z 1FD7D 3GTLI 2PMZE 3MEFA 1E2ZA 4GKKQ 2Z6BA 5CGKA 1WW9A 4H13C 4JI3L 5FJ8G 1VQ7A 1E24A 3MXPA 2K6AA 3NTIA 3SK6A 3J81j 1II3A 2F0GA 2A1AA 3U4VA 2R7DA 3AMUA 1DYQA 2RKSA 4A3EH 2RHBA 4RGNA 4N9PA 1PHJA 4BXXI 2B2TA 2D2CC 1B50A 2J4XA 3A54A 1NJIC 5EBCA 1VQOZ 4HAEA 4KHZA 1HA6A 2HDLA 1MHWC 1RLYA 4Z9CB 2JEAI 1I6VC 1GHKA 1WTWA 2JA6G 4FP5D 3OPOA 2KEEA 3J7A4 4NDXA 4RVDA 4E31A 1A62A 2V8JA 2MHVA 4A93I 4NBEA 3J81f 5M5XH 3N52A 3T1HL 2R7ZG 4MRIA 1K83B 1U4LA 3TP6A 1J9OA 3CC21 1Z7TA 1VQJA 4C1NK 4AYBG 1TWCH 1JORA 1PYBA 3PSIA 2R92H 4A3II 2F0EA 4TQUS 1GOZA 4KJNA 2A8VA 2UUAQ 4LUZA 4X6AH 4RKBA 4CBVA 5EKLA 1S72A 2F0OA 4A3GB 2KJXA 5BR8Q 1KLUD 3HOZI 4K14A 4RKLA 1K8A2 1VQKA 5ELOA 3S2DI 1JWMD 4DA2A 4JI6L 2VS1A 4C1NI 3E9HA 4V190 2PQAA 1U9RA 2CWAA 4X3TA 1LT3D 1VQ51 2AQ1B 2K32A 2SEBD 1KHIA 1KQSY 4KLKA 1L0WA 3W1GA 5JEAG 2ZM6Q 3GTKH 5A2Qf 2HCCA 1WTXA 4NBCA 3G6EZ 1IHZA 2K03A 1ASZA 1JB7A 1QNUA 1X3QA 1S5ED 3S14I 4EVOA 3HOUB 3GTGH 1PRTD 4JK1C 4RH6A 4LFCL 1SDFA 2J0TD 1KNAA 1D2BA 1TWHB 1RQFA 5C3EB 1XMQL 1HNWQ 3S1QH 2BE5D 1FDOA 2OXPA 4KD4A 3BDOA 1QXFA 1PXUA 5GADC 2V45A 4K5VA 1Y1VH 4LF9L 3S16B 4DR6L 4NB9A 1SXTA 4P2CB 2ZJQA 4OIKA 1PZKD 2UXCL 1EU4A 4WJWA 4ZLTF 3UDGA 3OW2Z 1BOSA 4DUZL 2OTLA 3T4AC 5I6WA 2K14A 3L2PA 1SYDA 4NBHA 5BN3A 1EYCA 2F0IA 3TP7A 5CMDA 4DR3Q 1VQOA 2MJ8A 4QCLA 3NK9A 4K8IA 3KK7A 5GQOA 3A8JE 3NWTA 4UHVA 1B1ZA 3BZDB 1PA6A 3CD61 3J81b 5JPNC 4DV6Q 2GTHA 3I73A 1YNJD 2YYZA 4A3MH 4DR7Q 3E0EA 2A69D 2NVYH 2NAPA 3MZKB 3A74A 4RAUC 4APVA 1SIWA 4EQ5A 2RHQB 3NDIA 2ZXPA 3D31A 5D14A 4GOPA 3M4OB 3CC7Z 1D1IA 1I50I 2PNRC 2JA6I 4A3LI 2SNMA 2RCFA 2N8NA 4R8NA 1D6EC 2M9VA 2UXDQ 4NOZA 4OWTB 2L11A 2B2WC 5FOBB 1A3UA 1EYGA 4NH1C 4NBDA 2F4VL 2EGTA 4N8X1 5CR3A 5C4XB 3ZJYC 1FVIA 5IYBH 1UNSA 1PFNA 4EQOA 1Q12A 1I4PA 3CU7A 2V8IA 2K7VA 2QREB 4X3KA 1YITA 3FKII 1SYCA 4BY1B 1YJ91 4KN4C 5C4JH 4A3JG 3EEDA 4LF7L 2AYDA 3CMAZ 2CH4A 2K01A 4A3KG 4OONA 3ESWA 3K81C 1I5FA 4DAYA 4H0LC 5FLMH 5DM73 1SJED 1PLFA 1SNDA 3CKIB 2JIMA 3CQZI 1EQTA 1VS0A 3H0GH 5E4WC 2L5TA 2YV5A 1Z02A 2KHJA 4NXML 4GKJQ 4GLAC 3PF5A 5A2QE 1KDAA 1SYEA 3PO3S 4FXGC 1X3EA 3J81i 1L2FA 1WTVA 1D1KA 4KK7A 3BVZA 1ZEQX 3OMGA 3HOVB 2RIQA 1CFMA 2D62A 3HOXG 3JAMf 4YCUA 2ZTCA 2QA4A 4K0KL 3RZDH 3S1RH 4A3BG 4J8QA 1PH3A 2D0OA 4DV2L 1K73C 4IPHA 2BOSA 3BZCA 2LMCB 5IGCA 4NKLA 4L63B 2B3GA 1IBLQ 1EEID 1HTLD 3HKZE 4LF4L 3D2LA 1AA6A 4KKUA 1LT5D 3PO3B 4BA1I 5IGDA 1QWYA 1X3FA 5L37A 3MFGA 4A4IA 3E6ZX 1M901 1A15A 4TRDA 3U58A 1DJRD 3RZOI 1X65A 4ODGA 2KENA 4DR4Q 1DZ1A 1Y1WI 3QOJA 3CCE1 4IUPA 1WTPA 2BDOA 2EQSA 1PH4A 5IY0A 4OX9Q 1HQMC 3CCSA 3RN2A 2JA8B 2B29A 5CC4A 2Y0SA 3T1YL 1HNXQ 1JR0D 2HDMA 1PTOF 3CRLC 1D5ZC 3CPWZ 5J3BA 3OWFA 4KY7A 1PH7A 2BA0A 1HUNA 4LNQA 3S15H 3GTJH 1SN8A 1A0IA 3GTMS 2E2HB 4JI7Q 3OWEB 3EVQA 4BY7I 5NUCA 1G91A 3CC7A 5C3XA 4L5QA 1VQMZ 2A73B 5C44B 1AW7A 1W2BZ 2WAQB 4B3ML 1C0AA 2R93B 5FK9C 1EZ6A 2MNAA 4B3RQ 2ZT9C 4X3SA 2QEX1 1SNPA 1B4OA 3SDZA 4IJLA 2VQEL 3ERSX 2XN9C 1M90C 4NP5A 4E2WA 1YJNZ 2K50A 4K2KA 3BYTB 3DM3A 2RDHA 1EQQA 4A3GG 1B3QA 2F0FA 4CJ0B 2OOYB 1WCMB 4L5TA 3HOWH 1YHQZ 3GTMB 2F4MA 4R9WA 3HOYB 2EIFA 4IFDH 3A0JA 5DNFA 5KNDA 2H85A 4MXUA 1FR3A 2C35B 1GUOA 3E0JA 3NBHA 3K8AA 2JEBI 1VQN1 2R6MA 2JIPA 3CCVZ 1QCBD 1EWHA 3F2DA 4JV5Q 3UDFA 1M8AA 1WTQA 3SEBA 1NMFA 3CCJ1 4MZ9A 3GTOB 3CCQA 1XPUA 1QE6A 2RCNA 3HOUG 3L7ZC 1QVFZ 5G3LF 2B63H 4A3JI 2PMZB 5EKKA 3ITPA 4I7ZC 4A3KI 1OXUA 2Z1CA 3D4WA 3JAMb 1FJGQ 4A3FH 5ISRA 1XX8A 2KBNA 3HKSA 3J7ZC 3NTHA 3HFZB 5GAHC 5C3EG 4S1TA 4NXNL 3PIOA 4OL7A 2QDLA 1VQ91 3W3AA 4C3IH 4P73A 1SMYD 4DR2Q 3KFUA 1BKBA 3RUZA 1PH5A 1I3QB 3VMHA 5D1OB 4Y52I 4KY5A 3VYUA 1TY2A 4DV5L 2KHIA 4JI1L 3GKQA 1PFSA 2KCMA 3EBEA 2NVXB 3FRPB 2EPBA 2EYJA 5AJ3Q 5HURA 1XNQL 1F9SA 1Q1BA 1A8VA 1R9TI 2ZXOA 2K28A 3TP8A 5C0XG 1YIJ1 1SLJA 3R2TA 4A3CI 3VA5A 1BF4A 4FF3A 2MGSA 1X56A 4JI5Q 1PRTB 2NVQB 2E2IH 2I0QA 1NSNS 1QZHA 2P3YA 4C3HB 1O80A 3DEPA 2JK8A 3CPWA 3F2BA 4DUYQ 2WB1E 2B2YA 1A2UA 2W03A 3JAMi 4QUFA 4GKKL 4A3EB 4FVMA 2QW7A 2OTJA 3AU7A 3V05A 1LT4D 3FMCA 3KF6A 1KNEA 2KEDA 1BXTA 4RWSC 1VQMA 1S5FD 1W2BA 2RA4A 3NPPA 1EZ8A 4HJ9A 2QRDB 4O42A 1I4HA 1UEAB 1RDPD 2L15A 3QJYA 1PRTC 3D3RA 3G4S1 4HMJA 4LF8Q 1Q3LA 4B3TQ 1YJNA 2CFMA 1HR0Q 5C4XG 1K83I 1BBWA 4QJFA 3D0FA 1IBML 4OELB 3TMEA 2F0VA 1MJEA 2BE5C 4IUVA 3CCR1 1TVXA 4RVHA 2Z4HA 4CKCA 4BY1G 5M5XB 4JI0Q 4XT3B 1YHQA 4IURA 3U9SA 2QRCB 5CV5A 5C5MA 1B3AA 4QY7A 3MONA 3KUPA 1Q811 1Q821 3CCVA 1VQBA 1NY4A 1TU2B 4RS4A 3CCLZ 2D5DA 4LAAA 2R92B 2K33A 2QKDA 4JBMA 3GO5A 1TWGH 2N3SA 1KRLA 3F1ZA 2Q2HA 1LO5D 3KF8A 1Q7Y1 1JJ2Z 1KL9A 4ID6A 2I07B 3H09A 1S5CD 1FNWA 3HOVG 1E2VA 2F4OA 2WV6D 3ND9A 4WJ4A 1RO4A 4B3SQ 3IX0A 2AUKA 4ZCKA 2DE6A 4DR1Q 2CCZA 3VYRA 1Q1EA 2Z4IA 3HOUI 1Y1VS 2I3CA 1RD9D 2V4DA 1YNJC 4DNIA 3DEOA 2XNAC 3F3PC 1L1OC 1CHQD 2A69C 4G7HC 1JE4A 1TWHI 5C3EI 4JI4L 3Q87A 2NB0A 4BBSH 5IWAQ 3GTGB 4G7ZC 3CXCA 4RG1A 1SYFA 3MZ5A 3LWEA 1CSQA 2UUCL 1VQ6A 1DOKA 4MIUA 4MTNA 1Q81C 1Q82C 1S40A 3S1QB 4RCOA 2JA8G 4RA8A 1ONLA 3KLSX 4HIKA 2WAQA 1S721 1C9OA 1WIIA 3T56B 1N8RC 4WFN3 4Q0FA 3QB3A 1VQK1 3OOCA 2NZ1D 5C0XI 3D9XA 2F0UA 2VPZA 1RO2A 3MHBA 2BCOA 4QIWE 5IP7H 1G51A 1SNOA 3UI2A 5IGBA 4NFRA 2TMPA 3V2TA 1VQ7Z 1UAPA 3OW7A 5ELEA 2EXDA 5T6BA 3M4PA 3K57A 2B2VA 2L0CA 1ZKOA 5C44G 1E2WA 5ELBA 3GTQI 5AN9F 2WAQG 1BCPD 3DWAA 3VR2A 5M3FH 3A5ZB 2ES2A 2R93G 1H9JA 1N34Q 3GTPH 4A3DI 1OXTA 1IL2A 3GTLH 3HEJA 4FNFA 4JBWA 3S9WA 4F8MA 2HIVA 1R4QB 4DR3L 2QGQA 4QMGA 3M4OI 1USPA 1PYWD 3TZUA 4XTCS 3WOEA 1DD2A 2EY2A 4A3MB 1S3OA 3RLFA 2EJFC 1WCMG 1BQQT 1TQOA 3I72A 3NHHA 4RGTA 3J81L 1I6HH 2NVYB 4G7OC 3MVVA 1WD1A 5IYCH 3HOYG 1LT6D 3FQQA 3I551 2UUBQ 4BXXH 1KAWA 3VR4A 4DR5Q 2KCCA 4DNTB 1V1QA 1Q7Y2 1Q46A 1S7MA 2E5LQ 4MH4A 1TS2A 4LJZC 3CAMA 4OIJA 5E4XA 3T13A 5A35A 3MTSA 4O2DA 3TEHB 4YY3Q 2OT2A 2E76C 4NMZA 2R7FA 5M5YH 4F7XA 4BY1I 4LF6Q 1PH8A 5M5WH 3H91A 1JJ2A 1HJPA 1EIYB 2G9HD 3HKZB 4A93H 2EDGA 1NE3A 1VQO1 1K9MC 5ELNA 3K5LA 5C4JB 1WVLA 1BUVT 2MFIA 3R2IA 4QF4A 4R4OA 1XWEA 4HMIA 5E7NA 2LKVA 2VUMH 3H0GB 1EOTA 2HT1A 4MD7A 3I4MH 2EOTA 3HOVI 1SRUA 1IYVA 2PYKA 4HGZA 3C1EA 4O1NA 1D5MC 3M7NA 3MXUA 1QUQA 3BDLA 3J80b 3EIVA 3HOZH 5K36G 4ME3A 5EAYA 2HF1A 1O7LA 1WI5A 1SFOI 2B39A 3S2DH 3ULJA 1B44D 2O4HA 1JWUD 4L5SA 3RZDB 2KHSA 3S1RB 1AFPA 3UDIA 1P9NA 5KGUA 3FHWA 1Q16A 4IUUA 3KDFA 1HTPA 4C3HG 2CH4W 4JC0A 4LK1C 4DV4L 2I46A 5EKIA 4J15A 3FVQA 3CW2C 3QWUA 3AEVA 1CQFA 3A5UA 2ZJPA 4L8JA 1YNND 1GXDC 4A3EG 2L9HA 2AHOB 3I7FA 3S1MH 3CCUZ 3AFQA 3QO2A 2EJGC 2N88A 4K8JA 3WWVA 4KHPQ 2PW5A 1QF8A 3G6E1 1E7ZA 5IT9b 1ESRA 2XIWA 1FNUA 2OTLZ 1KD11 4FF4A 3STBD 2ASBA 2RBLA 4HSVA 2JA7I 1CQVA 3RN5A 2E2HI 3S24A 1K8AC 4UY8C 3CCMA 1LTTD 2IL8A 4UP8A 3PIO3 1J6QA 1HUMA 2Z6KC 4YWKA 3KOJA 2FHTA 4AYBA 3GTJB 1WTHA 5C44I 3J80i 1SMYC 1LYLA 1PZJD 1HFGA 2SNSA 5FLXb 1N33L 1EOVA 3DM1A 4NBAA 5I9PA 1TS3A 1VQ8Z 3J81c 4KI0A 4OEMB 1MBYA 1DONA 1ICFB 1O7YA 3W2DA 5DM63 1V1OA 3FQMA 5E1FA 3TZDA 3G7LA 2I5LX 3I2ZA 4L6TB 1DCZA 2KOLA 5IODA 1N2FA 3HOYI 4GN4B 1X3GA 3BZKA 2DE5A 3E5SA 4FO2A 4RV9A 2JA5H 5CV8A 1H9MA 3SR1A 4E2XA 4DK0A 2AMCB 3LX0A 3DMUA 1F2YA 2C5CA 4JI2L 4RHSA 4ZYSA 3IKJA 2AKWB 5IOCA 1JT8A 1Z6HA 1ENAA 1I50H 1TWAI 5GROA 4NBBA 4PMWA 2JA6H 4A3LH 1YITZ 2IZ3A 5D65A 3CPWY 5JVG3 3CC4A 1JE5A 3VR5A 3BVGA 1HNZQ 1SSOA 2BDNA 1K0RA 2B63B 1I94L 4B9XA 1C8CA 2ZJRA 3CC71 4JYAL 2WB1B 1I3QI 3LGJA 3FKIH 1IKMA 1O7ZA 1LTLA 3CHBD 3JAML 1HZCA 1U4RA 4QTTA 1W2BY 2NVXI 1HZBA 2XTIA 1LABA 3CQZH 2G9DA 4X62L 1RO0A 3FP9A 2P28A 3NP8A 2HCIA 5JJZA 3OTOQ 2QA4Z 1HQRD 1GUSA 1E22A 4KY6A 1D5XC 2HHHL 1UE6A 3RD4A 4RGMA 1I4QA 2JJQA 5DAUA 3CMA1 4K2LA 2KECA 1KD12 4YWLA 2NVQI 1EWCA 4CDCC 2M6NA 3H3VH 4DV1Q 2L55A 2JS4A 3R3OA 3CCUA 4PV1C 5JEAH 5LMNQ 1SYGA 3F8TA 1G6PA 2RBMA 1N36Q 3S2HI 1EU3A 1XNRQ 1JCKB 4JBKA 4X66Q 4OO1G 3MXGA 1E3PA 1IBKQ 4JI5L 3C3LA 1QVFY 2VL6A 4A3EI 5IGGA 5IGFA 5T1GA 3CCSZ 5C6AA 1I4XA 4BBRH 1PZID 4A3MG 1TFIA 1IW7D 5I2XA 4NB8A 2X6GA 4TNUA 5FO9B 3RZOH 4DUYL 2E7ZA 2K52A 1Y1WH 4HSPA 2G5DA 1B7YB 3KYHC 3I4NH 3X3NA 1E1TA 4P74A 4DV0Q 4DV7Q 2X69A 2IX3A 1VQ8A 2BH8A 5I2YA 2L12A 3QOLA 3P1HA 4MHEA 2Q8IB 2PI2A 2JIRA 3NUCA 1TWFI 3J81E 1AH9A 1PRTF 3J7AV 1ZB9A 1X9NA 5IYBG 3KIHA 4HEDA 3AQQA 1MSHA 3I56Z 2JSOA 3OMCA 3HKZG 4ZK9B 4E2YA 1EFWA 3TREA 1SBBB 5FO7B 1XXGA 4CDEC 1GJXA 4BY7H 2R7ZI 1T5XD 1EFID 3TDQA 5FLMG 1SEBD 3IR7A 3KBXA 3H0GG 3K58A 4X6AI 1AP0A 4HCEA 3OYYA 2Z6KA 3W1BA 2QILA 1YJWZ 1TWGB 2RDGA 2RQXA 4Y7NH 2I5HA 3A7AB 2WACA 1VQM1 4LFAL 1BCPC 2VQFL 1MJCA 3CCQZ 3PMFA 3BU2A 5IE8A 4R4TA 5CV7A 1VMPA 4GNXB 1KDCA 4E33A 3K7AI 4YHHQ 3ND8A 1S4ZA 3IF8A 3VTNA 2OQ0A 1YJN1 3JAMc 2K75A 2WKCA 3GTGI 1T9HA 4GN5A 4B3SL 4HCSA 5EJWA 1R4PB 1BBXC 1EY9A 3KIFA 2WIIB 3VDYA 4ME5A 2O5IC 1ZB8A 3F3FC 1EY0A 1YHQ1 3Q23A 5CYUA 4LUOA 4BBSB 3S1QI 4C3JH 2IT1A 4R4IA 4XQNA 4UP9A 4LF5L 3CCV1 1RTOA 1F2MA 1VMCA
chains in the Genus database with same CATH topology
4Y52H 4GNXC 4X64L 2D0PA 3KJOA 3F2CA 2I5MX 2UXBQ 1JJ2Y 2IHFA 3B6YA 4DV3L 2KCTA 1R9TH 2PNHA 5M3MH 1JWHC 4A3CH 4OO1I 4QQBX 3PO2H 4ALPA 1M1K1 1N32L 4NBFA 1VQ4Z 2ATWA 2E2JI 2OTJZ 1Z9FA 2K3RA 5D1PA 4OXPA 4HGYA 2N78A 3I56A 2QLVB 2J6AA 1D7QA 4NPSA 4IFDG 1IZ6A 3NH5A 5DLQE 4PZ7A 3T1HQ 1VQCA 2JQOA 1RNIA 2UUBL 3S17H 3CP0A 4EX5A 2Z0SA 1YJWA 2B63G 5C4JI 1JJGA 1CKNB 2HQLA 1J5EL 5FLMI 2NVTH 4LFBQ 3H0GI 2BH2A 3STBC 2WFWA 1XMOL 3M9BA 1QVGZ 4JI6Q 1U5KA 1SMXA 4HJAA 4QTUA 3RZDI 4X65L 3CCL1 3HOXI 5IP9H 4LFCQ 2VZAA 3CXCZ 1VQ6Z 4A3BI 1FL0A 3S1NH 4A76A 3D6WA 1M1K2 3CD6A 2V1CC 2Y0SE 4IJHA 2DE7A 1ML8A 4DR6Q 2UXCQ 3M3YH 4MD8A 4DUZQ 2JMOA 5IYDH 1VQ4A 1YBYA 4P72A 1P16A 1UE5A 1VQPZ 2G2KA 3VMGA 1SR3A 5JJKA 3ULLA 3UE0A 1YJ9A 1YUAA 1IXRA 4HH4A 5H1SE 3GTQH 4JCVE 2ZAEB 2LSSA 3TE5B 4A3DH 2NN6G 3PV0A 1L1OB 2DGYA 3M85A 4A3GI 1KRTA 1VQ71 2PK7A 2YTXA 3LUSA 2F4VQ 2MO1A 1X3WA 1QVGA 1NTGA 4LF7Q 2YTVA 1X0TA 3IFUA 2UUAL 5GAGC 4IPDA 3PUWA 4PZ8A 4TVAB 5BR8L 4BY1H 4BBSG 1VQLZ 2GN5A 2JUBA 1PYSB 2K5RA 3CCEA 2OZKA 4EWCA 1VCIA 2ZM6L 3PO3G 2RHSB 3EERA 1DGSA 5HGQA 4K0KQ 3J80c 1EIFA 3VB9A 3S16I 3J80f 4DV2Q 3HOVH 1PH6A 4RMFA 5IP7G 1O7IA 1HNWL 1XPOA 1Q7YC 1SFOH 1VQDA 1OXXK 5M3FG 5T67A 3PUXA 4YCWA 5LMNL 4AQYQ 4DAMA 1KC81 1VQPA 1Z47A 3T1YQ 2YU9H 4X66L 2PQAB 1CKNA 5IT9f 2M48A 1YHBA 3CCMZ 5IYCG 4WJ3M 2PM9A 2PMZA 3NDJA 4IOCA 1VQNA 3BG1B 2ID0A 4DV6L 3I07A 2JA7H 4DR7L 4B3MQ 5FLXc 4DKAC 2K4KA 3CCU1 5FLXf 4IFDJ 5C4XI 4UP7A 3RLOA 3GDEA 2VQEQ 5D1OA 4A93G 2KPIA 3MZLB 2OTL1 2LIYA 3KLWA 2NN6I 1MIUA 2UXDL 2IX0A 4E32A 2JE6I 4IO9A 1TWGI 2VUMG 3H15A 3I4MG 4OWWB 4IOAA 1C7YA 4UPAA 1VQFA 1VQLA 3CC4Z 3HOZG 1VQ81 4A3IH 4BA2I 1Q861 5LL6f 1YI2Z 1TWAH 4GKJL 3G71Z 4NXNQ 4R4QA 1KRSA 1XTDA 1NMGA 1JJCB 2WAQE 4DV5Q 3PO3I 2YADA 3PUZA 1I3QH 1KC82 1YIT1 1VQGA 1XNQQ 2IHEA 3S14H 1NJI1 1WJJA 2W04A 1VLAA 2LFUA 2JA8I 1MKHA 1IBLL 1HZ9A 2HIXA 3J7A5 3G4SA 1PH9A 4CL1A 4QL5A 1SE8A 4XIGS 4DAYB 2JA9A 4DR4L 3P5JB 1L1OA 1B8AA 3CCRA 3MXNB 4GOPC 4OX9L 3GTPI 1HNXL 2QA41 2VY3A 3S2HH 3TQYA 1KIXA 2R93I 4LW1A 4PG3A 3GD7A 1I6HI 4NBGA 4GLVB 2LXJA 1GO3E 4GN3B 5FJ8H 2JA5G 1NUIA 4JI7L 2MO0A 2R92G 2N49A 3CMEZ 1WCMI 3UE1A 1IBMQ 3GTMI 4POGA 3K80C 3TDHB 4B3RL 1IYJB 2AKLA 4A3LG 3CCS1 4OWXB 1Q862 1KD1C 1TWFH 3GTOI 3JC66 4NB3A 4POFA 4A75A 4MD9A 1XPRA 3FKIG 4DK6C 2VUMI 4JG2A 3I4MI 2ALYB 2R7ZH 2JNYA 4DGLA 1YI2A 1PVOA 4JV5L 1OXVA 2OWOA 4LFBL 3G71A 4C2MH 3I561 2V8KA 1FJGL 1NJI2 1Y1VG 1LQLA 4HIDA 2E8GA 4JI4Q 4DR2L 1BBUA 4GS3A 1HR0W 2UUCQ 4YWMA 3K7AH 5CM2M 1SROA 1YJW1 1HH2P 5AJ3L 1P8LA 4RVGA 3NENA 4BBRG 3CCQ1 3S1MI 3NBHB 2RF4A 1Y1WG 3NFZA 3I4NG 1E1OA 3I55A 2YTYA 1QVGY 4AYBE 1PH1A 3RLNA 2CWPA 3HKZA 1RL2A 1XJVA 3CC2Z 4HJ8A 2GVBA 4FDBA 3U4ZA 4GLXA 3CMEA 2WP8J 4BY7G 2KI7B 3CXCY 4LF8L 2NZHA 1W3SA 1TWCI 4B3TL 4XX2A 2JA5I 1HR0L 2E2JH 4JOIC 2R92I 3G48A 4LWCA 1Y14B 2K5NA 1VQ5Z 1X55A 4JI0L 2MQHA 1KXLA 2GU2A 1VQ41 4R1JA 2OCEA 3W5OA 3PUVA 2OTJ1 1K731 5LMUQ 3PUYA 2CQOA 1CUKA 3AFPA 3GTKI 4P71A 3CF5A 1VQEA 3KF6B 5A2Qb 4JI8Q 4DR1L 3SGIA 2FXQA 1AE3A 2O53A 4A3JH 3G6EA 4A3KH 2AWOA 1VQIA 2GVAA 4IPGA 1YHAA 1Y1VI 3T4NB 5IWAL 2IZ4A 3H3VI 1PFTA 2UU9Q 2ZTEA 3CPFA 4DV4Q 1DL6A 1B70B 5M3MG 2CKZB 3UDXA 4A3CG 3PO2G 3CD6Z 3L0OA 3HOXH 1UE7A 3KF8B 4JI3Q 4A3BH 4BBRI 3NH8A 3GCFA 3PIPA 3OW2A 3CC2A 1Z03A 3I4NI 2PI2E 4AQYL 4A3MI 4QGUA 2NVYI 1VQ61 1WFQA 1EUJA 2K5HA 4RVFA 2IY5B 1N34L 5GAEC 3HOWG 1N33Q 2WB1A 1YJ9Z 1U0LA 3KJPA 1KQSZ 2A19A 1CSPA 1K732 1VQ5A 1Z01A 1NBWA 2Y0SG 2Q2UA 1QZGA 4DR5L 2E5LL 2Q2TA 1K83H 4P75A 3AYHB 4A3FG 1VQP1 2WB1G 4YY3L 1M1KC 4JI2Q 3RNUA 1QYPA 4Y7NI 4LF6L 2VUGA 3CMAA 4A3GH 2OOXB 1PV4A 1YZ6A 4MNOA 4HIOA 1I94Q 4JYAQ 1N9WA 5IP9G 4JBJA 3S1RI 1USPB 4JOIA 1K8GA 3CCEZ 3K7UC 4HIMA 3RR5A 3H3VJ 2BA1A 4HJ5A 3TRZA 5JEAJ 4X62Q 4LUVA 3HOUH 3TS2A 4AH6A 4MONA 1XMQQ 1RIPA 2HHHQ 4AIMA 1M902 1TWHH 5C3EH 1X3ZA 2R6GA 4LF9Q 4IPCA 1OTCA 5IYDG 2XGTA 1VQL1 3S16H 1YUKA 1WOCA 3PO2I 2QEXZ 3S15I 3GTJI 3PCOB 4KHPL 4E30A 1YEZA 1V43A 3BG0B 3U50C 3TS0A 4A3DG 1QUQB 3PF4A 1KQSA 3BJUA 4GNXA 1VQNZ 1ASYA 3CCJZ 3Q8DA 4H02A 3KDFB 3HOWI 1EQRA 2AWNA 1BVSA 3M4OH 4IFDI 3S17I 1V9PA 1LUZA 4DK1A 1Q8KA 5JJIA 2NVTI 5LMNW 1VQ9Z 4R4CA 3CCM1 2B63I 5C4XH 3NH4A 2HU9A 4A3FI 1VQAA 2ZTDA 2IX1A 4LFAQ 3NELA 2VQFQ 4NXMQ 2K5VA 1HNZL 1CKMA 1QVFA 1YIJZ 1N8R1 1NP6A 1UE1A 1YVCA 1H95A 2OQKA 1CKOA 1X6OA 5T64A 1TXYA 2DUDA 3IRBA 1G291 5IP9I 2VNUD 3DLLA 1QVCA 3S1NI 1EWIA 2GTIA 4LF5Q 3OTOL 2E2II 4LF4Q 3CC41 2F3IA 3M3YI 2E9HA 4DV1L 4X64Q 3ULPA 3PO3H 2QEXA 1YI21 3G4SZ 1A63A 1N36L 1XNRL 3G711 4DV3Q 5IT9c 1IBKL 3CCRZ 1VQHA 1GD7A 2JA8H 4E2ZA 1N32Q 2JA7G 4BXXG 2Q51A 5HY6A 1GM5A 1JMCA 3E9IA 3CCJA 4DV0L 2RPRA 1K9M1 4DV7L 2E2HH 5JJLA 1OXSC 3M4QA 5C44H 2BJOA 2R93H 2Q4ZA 1Q812 1Q822 1UWVA 1K3RA 4O0AA 1AE2A 2VW9A 2F52A 1VQ9A 1D8LA 2RT9A 3PGZA 1KC8C 1YNXA 4A3IG 1N8R2 1HZAA 1WCMH 3GTMH 1J5EQ 3CCLA 3HOYH 4DK3C 2H5XA 1YIJA 3OW2Y 4PZ6A 1XMOQ 3GTOH 3CME1 3EN2A 5LMUL 1UEBA 4HJ7A 4BBSI 1S72Z 3K0XA 4DPGA 1VQKZ 4YHHL 4GOPB 3VMIA 1LM0A 4JI1Q 4X65Q 4JI8L 1GKHA 2Q2IA 1WYDA 3ER0A 2NZOA 1ZH1A 1K8A1 1X54A 4YCVA 2NVXH 1GVPA 1FGUA 5IP7I 2QR1B 2JR6A 2LXKA 2VF1A 2UU9L 3I4OA 4DQYB 1Q86C 4L5RC 1PH2A 2NVQH 5C0XJ 2YU9I 3ICEA 1K9M2 3NEMA 2UXBL 4C3HH 3I55Z 3GTLI 2PMZE 3MEFA 4GKKQ 1WW9A 4JI3L 5FJ8G 1VQ7A 1E24A 3J81j 2A1AA 3U4VA 2R7DA 4A3EH 2RHBA 1PHJA 4BXXI 1NJIC 1VQOZ 4KHZA 1RLYA 2JEAI 2JA6G 3J7A4 4RVDA 4E31A 1A62A 2V8JA 4A93I 4NBEA 3J81f 5M5XH 3T1HL 2R7ZG 4MRIA 3CC21 1VQJA 4AYBG 1TWCH 1PYBA 3PSIA 2R92H 4A3II 4TQUS 2A8VA 2UUAQ 4LUZA 4X6AH 1S72A 5BR8Q 3HOZI 1K8A2 1VQKA 5ELOA 3S2DI 4JI6L 2VS1A 3E9HA 2PQAA 2CWAA 1VQ51 2ZM6Q 1L0WA 4KLKA 1KHIA 1KQSY 5JEAG 3W1GA 3GTKH 5A2Qf 4NBCA 3G6EZ 1ASZA 1JB7A 3S14I 3GTGH 4LFCL 1RQFA 1XMQL 1HNWQ 3S1QH 5GADC 1Y1VH 4LF9L 4DR6L 4NB9A 2ZJQA 2UXCL 3UDGA 3OW2Z 4DUZL 2OTLA 2K14A 3L2PA 4NBHA 4DR3Q 1VQOA 5GQOA 1PA6A 3CD61 3J81b 4DV6Q 2GTHA 2YYZA 4A3MH 4DR7Q 3E0EA 2NVYH 3MZKB 3A74A 4APVA 4EQ5A 2RHQB 3NDIA 4GOPA 3D31A 3CC7Z 1I50I 2JA6I 4A3LI 2N8NA 2UXDQ 4NOZA 4OWTB 1EYGA 4NH1C 4NBDA 2F4VL 2EGTA 3ZJYC 1FVIA 5IYBH 1Q12A 2V8IA 2QREB 1YITA 3FKII 1YJ91 5C4JH 4A3JG 3EEDA 4LF7L 3CMAZ 4A3KG 4OONA 3ESWA 3K81C 1I5FA 5FLMH 3CQZI 1VS0A 3H0GH 2YV5A 1Z02A 2KHJA 4NXML 4GKJQ 4GLAC 3PF5A 3PO3S 1X3EA 3J81i 1L2FA 2RIQA 2D62A 3HOXG 3JAMf 4YCUA 2ZTCA 2QA4A 4K0KL 3RZDH 3S1RH 4A3BG 1PH3A 2D0OA 4DV2L 1K73C 4IPHA 3BZCA 1IBLQ 2B3GA 3HKZE 4LF4L 4BA1I 1X3FA 4A4IA 1M901 3U58A 1X65A 3RZOI 4DR4Q 2KENA 1Y1WI 3CCE1 2EQSA 1PH4A 5IY0A 4OX9Q 3CCSA 3RN2A 2B29A 2Y0SA 3T1YL 1HNXQ 3CPWZ 5J3BA 1PH7A 2BA0A 4LNQA 3S15H 3GTJH 1SN8A 1A0IA 3GTMS 4JI7Q 4BY7I 3CC7A 4L5QA 1VQMZ 1W2BZ 4B3ML 1C0AA 2MNAA 4B3RQ 2QEX1 4IJLA 2VQEL 3ERSX 1M90C 4E2WA 1YJNZ 2K50A 3DM3A 4A3GG 1EQQA 2OOYB 4L5TA 3HOWH 1YHQZ 2F4MA 2EIFA 3A0JA 2H85A 4MXUA 2C35B 3K8AA 2JEBI 1VQN1 2R6MA 3CCVZ 3F2DA 4JV5Q 3UDFA 1NMFA 3CCJ1 4MZ9A 3CCQA 1XPUA 2RCNA 3HOUG 3L7ZC 1QVFZ 2B63H 4A3JI 4A3KI 1OXUA 3JAMb 1FJGQ 4A3FH 3J7ZC 2KBNA 3HKSA 3HFZB 5GAHC 5C3EG 4S1TA 4NXNL 3PIOA 1VQ91 4C3IH 4P73A 3KFUA 4DR2Q 1BKBA 1PH5A 3VMHA 5D1OB 4Y52I 4DV5L 2KHIA 4JI1L 3GKQA 1PFSA 2KCMA 3EBEA 5AJ3Q 1XNQL 1Q1BA 1A8VA 1R9TI 5C0XG 1YIJ1 1SLJA 4A3CI 1X56A 4JI5Q 2E2IH 2I0QA 1QZHA 2P3YA 2JK8A 3CPWA 3F2BA 4DUYQ 2WB1E 2W03A 3JAMi 4GKKL 2OTJA 3KF6A 1VQMA 1W2BA 4HJ9A 2QRDB 2L15A 3G4S1 4LF8Q 4B3TQ 1YJNA 2CFMA 1HR0Q 5C4XG 1K83I 1BBWA 4QJFA 3D0FA 1IBML 1MJEA 3CCR1 4RVHA 4BY1G 4JI0Q 1YHQA 2QRCB 4QY7A 3MONA 1Q811 1Q821 3CCVA 1VQBA 1NY4A 4RS4A 3CCLZ 2QKDA 4JBMA 3GO5A 1TWGH 2N3SA 1KRLA 3F1ZA 2Q2HA 1Q7Y1 1JJ2Z 1KL9A 3HOVG 2F4OA 1RO4A 4B3SQ 3IX0A 2DE6A 4DR1Q 2CCZA 1Q1EA 3HOUI 1Y1VS 2I3CA 4DNIA 3F3PC 1L1OC 1TWHI 5C3EI 4JI4L 3Q87A 4BBSH 5IWAQ 3CXCA 4RG1A 1VQ6A 1CSQA 2UUCL 4MTNA 1Q81C 1Q82C 1S40A 2JA8G 4HIKA 2WAQA 1S721 1C9OA 1WIIA 1N8RC 1VQK1 5C0XI 3D9XA 1RO2A 4QIWE 5IP7H 1G51A 4NFRA 1VQ7Z 2EXDA 5T6BA 3M4PA 5C44G 3GTQI 5AN9F 2WAQG 5M3FH 2ES2A 2R93G 3A5ZB 1N34Q 3GTPH 4A3DI 1OXTA 1IL2A 3GTLH 4JBWA 2HIVA 4DR3L 2QGQA 3M4OI 1USPA 4XTCS 1S3OA 3RLFA 4WJ4A 1WCMG 1I6HH 5IYCH 3HOYG 3FQQA 3I551 2UUBQ 4BXXH 1KAWA 4DR5Q 1V1QA 1Q7Y2 1Q46A 1S7MA 2E5LQ 4MH4A 3CAMA 4O2DA 3TEHB 4YY3Q 2R7FA 5M5YH 4BY1I 4LF6Q 1PH8A 5M5WH 1JJ2A 1HJPA 1EIYB 4A93H 1NE3A 1VQO1 1K9MC 5ELNA 2MFIA 4R4OA 5E7NA 2VUMH 2HT1A 4MD7A 3I4MH 3HOVI 1SRUA 4HGZA 3M7NA 1QUQA 3EIVA 3J80b 5K36G 3HOZH 4ME3A 5EAYA 2HF1A 1WI5A 1SFOI 3S2DH 3ULJA 2O4HA 4L5SA 3UDIA 1P9NA 3FHWA 3KDFA 4JC0A 4DV4L 4J15A 3CW2C 3QWUA 3AEVA 3A5UA 2ZJPA 4A3EG 2AHOB 3I7FA 3S1MH 3CCUZ 3AFQA 3WWVA 4KHPQ 1QF8A 3G6E1 1E7ZA 5IT9b 2OTLZ 1KD11 3STBD 2ASBA 2RBLA 2JA7I 3RN5A 2E2HI 3S24A 1K8AC 4UY8C 3CCMA 4UP8A 1J6QA 2Z6KC 4YWKA 3KOJA 4AYBA 5C44I 3J80i 1LYLA 5FLXb 1N33L 1EOVA 4NBAA 1VQ8Z 3J81c 4KI0A 3FQMA 2I5LX 3I2ZA 1N2FA 3HOYI 4GN4B 1X3GA 3BZKA 2DE5A 4RV9A 2JA5H 4E2XA 2AMCB 4JI2L 2AKWB 1JT8A 1I50H 1TWAI 5GROA 4NBBA 4PMWA 2JA6H 4A3LH 1YITZ 2IZ3A 3CPWY 3CC4A 1JE5A 1HNZQ 1K0RA 1I94L 2ZJRA 3CC71 4JYAL 1I3QI 3LGJA 3FKIH 1LTLA 1HZCA 4QTTA 1W2BY 2NVXI 1HZBA 2XTIA 3CQZH 4X62L 1RO0A 3FP9A 2P28A 3OTOQ 2QA4Z 1E22A 2HHHL 1UE6A 2JJQA 3CMA1 4YWLA 1KD12 2NVQI 2M6NA 3H3VH 4DV1Q 2JS4A 5LMNQ 3CCUA 3F8TA 1G6PA 1N36Q 1XNRQ 3S2HI 4JBKA 4X66Q 4OO1G 1E3PA 1IBKQ 4JI5L 1QVFY 2VL6A 4A3EI 3CCSZ 4BBRH 4A3MG 1TFIA 4NB8A 4TNUA 3RZOH 4DUYL 2K52A 1Y1WH 1B7YB 3KYHC 3I4NH 1E1TA 4P74A 4DV0Q 4DV7Q 1VQ8A 2BH8A 2PI2A 1TWFI 1AH9A 1ZB9A 1X9NA 5IYBG 3KIHA 3AQQA 3I56Z 3HKZG 4E2YA 1EFWA 3TREA 4BY7H 2R7ZI 5FLMG 3H0GG 4X6AI 3OYYA 2Z6KA 3W1BA 1YJWZ 4Y7NH 2I5HA 1VQM1 4LFAL 2VQFL 1MJCA 3CCQZ 3BU2A 5IE8A 4R4TA 4GNXB 4E33A 3K7AI 4YHHQ 2OQ0A 3IF8A 3VTNA 1YJN1 3JAMc 2K75A 3GTGI 1T9HA 4GN5A 4B3SL 3KIFA 3VDYA 1ZB8A 3F3FC 1YHQ1 4LUOA 3S1QI 4C3JH 2IT1A 4R4IA 4UP9A 4LF5L 3CCV1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y52 H;  4GNX C;  4X64 L;  2D0P A;  3KJO A;  3F2C A;  2I5M X;  2UXB Q;  2IHF A;  3B6Y A;  4DV3 L;  2KCT A;  1R9T H;  2PNH A;  5M3M H;  4A3C H;  4OO1 I;  4QQB X;  3PO2 H;  4ALP A;  1N32 L;  4NBF A;  2ATW A;  2E2J I;  1Z9F A;  4OXP A;  2N78 A;  3I56 A;  2J6A A;  1D7Q A;  4NPS A;  4IFD G;  1IZ6 A;  5DLQ E;  4PZ7 A;  3T1H Q;  1VQC A;  2JQO A;  2UUB L;  3S17 H;  3CP0 A;  4EX5 A;  2Z0S A;  1YJW A;  2B63 G;  5C4J I;  1JJG A;  1CKN B;  2HQL A;  1J5E L;  5FLM I;  2NVT H;  4LFB Q;  3H0G I;  2BH2 A;  3STB C;  2WFW A;  1XMO L;  3M9B A;  4JI6 Q;  1U5K A;  1SMX A;  4HJA A;  4QTU A;  3RZD I;  4X65 L;  3HOX I;  5IP9 H;  4LFC Q;  2VZA A;  4A3B I;  1FL0 A;  3S1N H;  4A76 A;  3D6W A;  3CD6 A;  2V1C C;  2Y0S E;  4IJH A;  2DE7 A;  1ML8 A;  4DR6 Q;  2UXC Q;  3M3Y H;  4DUZ Q;  5IYD H;  1VQ4 A;  1YBY A;  4P72 A;  1P16 A;  1UE5 A;  3VMG A;  1SR3 A;  5JJK A;  3ULL A;  3UE0 A;  1YJ9 A;  1YUA A;  1IXR A;  5H1S E;  3GTQ H;  4JCV E;  2LSS A;  4A3D H;  2NN6 G;  3PV0 A;  1L1O B;  2DGY A;  3M85 A;  4A3G I;  1KRT A;  2PK7 A;  2YTX A;  3LUS A;  2F4V Q;  2MO1 A;  1X3W A;  1QVG A;  1NTG A;  4LF7 Q;  2YTV A;  2UUA L;  5GAG C;  4IPD A;  3PUW A;  4PZ8 A;  4TVA B;  5BR8 L;  4BY1 H;  4BBS G;  2GN5 A;  1PYS B;  2K5R A;  3CCE A;  1VCI A;  2ZM6 L;  3PO3 G;  2RHS B;  3EER A;  1DGS A;  5HGQ A;  4K0K Q;  3J80 c;  1EIF A;  3VB9 A;  3S16 I;  4DV2 Q;  3HOV H;  1PH6 A;  4RMF A;  5IP7 G;  1HNW L;  1O7I A;  1XPO A;  1Q7Y C;  1SFO H;  1VQD A;  1OXX K;  5M3F G;  3PUX A;  4YCW A;  5LMN L;  4AQY Q;  4DAM A;  1VQP A;  1Z47 A;  3T1Y Q;  2YU9 H;  4X66 L;  2PQA B;  1CKN A;  1YHB A;  5IYC G;  4WJ3 M;  4IOC A;  1VQN A;  2ID0 A;  4DV6 L;  3I07 A;  2JA7 H;  4DR7 L;  4B3M Q;  5FLX c;  4DKA C;  2K4K A;  4IFD J;  5C4X I;  4UP7 A;  3RLO A;  3GDE A;  2VQE Q;  4A93 G;  2KPI A;  3KLW A;  2NN6 I;  1MIU A;  2UXD L;  2IX0 A;  2JE6 I;  4IO9 A;  1TWG I;  2VUM G;  3H15 A;  3I4M G;  4OWW B;  4IOA A;  1C7Y A;  4UPA A;  1VQF A;  1VQL A;  3HOZ G;  4A3I H;  4BA2 I;  1TWA H;  4GKJ L;  4NXN Q;  4R4Q A;  1KRS A;  1XTD A;  1NMG A;  1JJC B;  2WAQ E;  4DV5 Q;  3PO3 I;  3PUZ A;  1I3Q H;  1VQG A;  1XNQ Q;  2IHE A;  3S14 H;  1WJJ A;  1VLA A;  2JA8 I;  1MKH A;  1IBL L;  1HZ9 A;  2HIX A;  3J7A 5;  3G4S A;  1PH9 A;  4QL5 A;  1SE8 A;  4XIG S;  4DAY B;  2JA9 A;  4DR4 L;  1L1O A;  1B8A A;  3CCR A;  3MXN B;  4GOP C;  4OX9 L;  3GTP I;  1HNX L;  2VY3 A;  3S2H H;  3TQY A;  1KIX A;  2R93 I;  4LW1 A;  4PG3 A;  3GD7 A;  1I6H I;  4NBG A;  4GLV B;  2LXJ A;  1GO3 E;  4GN3 B;  5FJ8 H;  2JA5 G;  1NUI A;  4JI7 L;  2MO0 A;  2R92 G;  2N49 A;  1WCM I;  3UE1 A;  1IBM Q;  3GTM I;  4POG A;  3K80 C;  4B3R L;  1IYJ B;  2AKL A;  4A3L G;  4OWX B;  1KD1 C;  1TWF H;  3GTO I;  3JC6 6;  4NB3 A;  4POF A;  4A75 A;  1XPR A;  3FKI G;  4DK6 C;  2VUM I;  4JG2 A;  3I4M I;  2ALY B;  2R7Z H;  1PVO A;  2JNY A;  1YI2 A;  4JV5 L;  1OXV A;  2OWO A;  4LFB L;  3G71 A;  4C2M H;  1FJG L;  1Y1V G;  1LQL A;  4HID A;  2E8G A;  4JI4 Q;  4DR2 L;  1BBU A;  4GS3 A;  1HR0 W;  2UUC Q;  4YWM A;  3K7A H;  5CM2 M;  1SRO A;  1HH2 P;  5AJ3 L;  1P8L A;  3NEN A;  4BBR G;  3S1M I;  3NBH B;  2RF4 A;  1Y1W G;  3I4N G;  1E1O A;  3I55 A;  2YTY A;  4AYB E;  1PH1 A;  3RLN A;  2CWP A;  1RL2 A;  1XJV A;  4HJ8 A;  2GVB A;  4FDB A;  3U4Z A;  4GLX A;  3CME A;  2WP8 J;  4BY7 G;  4LF8 L;  2NZH A;  1W3S A;  1TWC I;  4B3T L;  4XX2 A;  2JA5 I;  1HR0 L;  2E2J H;  4JOI C;  2R92 I;  3G48 A;  4LWC A;  1Y14 B;  2K5N A;  1X55 A;  4JI0 L;  2MQH A;  1KXL A;  4R1J A;  2OCE A;  3W5O A;  3PUV A;  5LMU Q;  3PUY A;  2CQO A;  1CUK A;  3AFP A;  3GTK I;  4P71 A;  3CF5 A;  1VQE A;  3KF6 B;  4JI8 Q;  4DR1 L;  3SGI A;  2FXQ A;  1AE3 A;  4A3J H;  3G6E A;  4A3K H;  2AWO A;  1VQI A;  2GVA A;  4IPG A;  1YHA A;  1Y1V I;  5IWA L;  3H3V I;  1PFT A;  2UU9 Q;  2ZTE A;  3CPF A;  4DV4 Q;  1DL6 A;  1B70 B;  5M3M G;  2CKZ B;  3UDX A;  4A3C G;  3PO2 G;  3L0O A;  3HOX H;  1UE7 A;  3KF8 B;  4JI3 Q;  4A3B H;  4BBR I;  3GCF A;  3PIP A;  3OW2 A;  3CC2 A;  3I4N I;  2PI2 E;  4AQY L;  4A3M I;  4QGU A;  2NVY I;  1WFQ A;  1EUJ A;  2K5H A;  2IY5 B;  1N34 L;  5GAE C;  3HOW G;  1N33 Q;  1U0L A;  3KJP A;  2A19 A;  1CSP A;  1VQ5 A;  1NBW A;  2Y0S G;  2Q2U A;  1QZG A;  4DR5 L;  2E5L L;  2Q2T A;  1K83 H;  4P75 A;  3AYH B;  4A3F G;  2WB1 G;  4YY3 L;  1M1K C;  4JI2 Q;  3RNU A;  1QYP A;  4Y7N I;  4LF6 L;  3CMA A;  4A3G H;  1PV4 A;  1YZ6 A;  4MNO A;  4HIO A;  1I94 Q;  4JYA Q;  1N9W A;  5IP9 G;  4JBJ A;  3S1R I;  1USP B;  4JOI A;  1K8G A;  3K7U C;  4HIM A;  3RR5 A;  3H3V J;  2BA1 A;  4HJ5 A;  3TRZ A;  5JEA J;  4X62 Q;  4LUV A;  3HOU H;  3TS2 A;  4AH6 A;  1XMQ Q;  1RIP A;  2HHH Q;  4AIM A;  1TWH H;  5C3E H;  1X3Z A;  2R6G A;  4LF9 Q;  4IPC A;  1OTC A;  5IYD G;  2XGT A;  3S16 H;  1WOC A;  3PO2 I;  3S15 I;  4KHP L;  3GTJ I;  3PCO B;  1YEZ A;  1V43 A;  3U50 C;  3TS0 A;  4A3D G;  1QUQ B;  3PF4 A;  1KQS A;  3BJU A;  4GNX A;  1ASY A;  3Q8D A;  4H02 A;  3KDF B;  3HOW I;  1EQR A;  2AWN A;  1BVS A;  3M4O H;  4IFD I;  3S17 I;  1V9P A;  1LUZ A;  1Q8K A;  5JJI A;  2NVT I;  5LMN W;  4R4C A;  2B63 I;  5C4X H;  4A3F I;  1VQA A;  2ZTD A;  2IX1 A;  4LFA Q;  3NEL A;  2VQF Q;  4NXM Q;  2K5V A;  1HNZ L;  1CKM A;  1QVF A;  1UE1 A;  1YVC A;  1H95 A;  2OQK A;  1CKO A;  1X6O A;  1TXY A;  2DUD A;  3IRB A;  1G29 1;  5IP9 I;  2VNU D;  3DLL A;  1QVC A;  3S1N I;  1EWI A;  4LF5 Q;  3OTO L;  2E2I I;  4LF4 Q;  2F3I A;  3M3Y I;  4DV1 L;  4X64 Q;  3ULP A;  3PO3 H;  2QEX A;  1A63 A;  1XNR L;  1N36 L;  4DV3 Q;  5IT9 c;  1IBK L;  1VQH A;  1GD7 A;  2JA8 H;  1N32 Q;  2JA7 G;  4BXX G;  5HY6 A;  1GM5 A;  1JMC A;  3E9I A;  3CCJ A;  4DV0 L;  4DV7 L;  2E2H H;  5JJL A;  1OXS C;  3M4Q A;  5C44 H;  2BJO A;  2R93 H;  1UWV A;  1K3R A;  4O0A A;  1AE2 A;  2VW9 A;  2F52 A;  1VQ9 A;  1D8L A;  3PGZ A;  1KC8 C;  1YNX A;  4A3I G;  1HZA A;  1WCM H;  3GTM H;  1J5E Q;  3CCL A;  3HOY H;  4DK3 C;  2H5X A;  1YIJ A;  4PZ6 A;  1XMO Q;  3GTO H;  3EN2 A;  5LMU L;  1UEB A;  4HJ7 A;  4BBS I;  3K0X A;  4DPG A;  4YHH L;  4GOP B;  3VMI A;  1LM0 A;  4JI1 Q;  4X65 Q;  4JI8 L;  1GKH A;  2Q2I A;  1WYD A;  3ER0 A;  2NZO A;  1X54 A;  4YCV A;  2NVX H;  1GVP A;  1FGU A;  5IP7 I;  2JR6 A;  2LXK A;  2UU9 L;  3I4O A;  1Q86 C;  4L5R C;  1PH2 A;  2NVQ H;  5C0X J;  2YU9 I;  3ICE A;  3NEM A;  2UXB L;  4C3H H;  3GTL I;  2PMZ E;  3MEF A;  4GKK Q;  1WW9 A;  4JI3 L;  5FJ8 G;  1VQ7 A;  1E24 A;  3J81 j;  2A1A A;  3U4V A;  2R7D A;  4A3E H;  1PHJ A;  4BXX I;  1NJI C;  4KHZ A;  1RLY A;  2JEA I;  2JA6 G;  1A62 A;  4A93 I;  4NBE A;  5M5X H;  3T1H L;  2R7Z G;  1VQJ A;  4AYB G;  1TWC H;  1PYB A;  3PSI A;  2R92 H;  4A3I I;  4TQU S;  2A8V A;  2UUA Q;  4LUZ A;  4X6A H;  1S72 A;  5BR8 Q;  3HOZ I;  1VQK A;  5ELO A;  3S2D I;  4JI6 L;  2VS1 A;  3E9H A;  2PQA A;  2CWA A;  2ZM6 Q;  1L0W A;  4KLK A;  1KHI A;  5JEA G;  3W1G A;  3GTK H;  4NBC A;  1ASZ A;  1JB7 A;  3S14 I;  3GTG H;  4LFC L;  1XMQ L;  1HNW Q;  3S1Q H;  5GAD C;  1Y1V H;  4LF9 L;  4DR6 L;  4NB9 A;  2ZJQ A;  2UXC L;  3UDG A;  4DUZ L;  2OTL A;  2K14 A;  3L2P A;  4NBH A;  4DR3 Q;  1VQO A;  5GQO A;  1PA6 A;  4DV6 Q;  2YYZ A;  4A3M H;  4DR7 Q;  3E0E A;  2NVY H;  3A74 A;  4APV A;  4EQ5 A;  2RHQ B;  4GOP A;  3D31 A;  1I50 I;  2JA6 I;  4A3L I;  2N8N A;  2UXD Q;  4NOZ A;  4OWT B;  1EYG A;  4NBD A;  2F4V L;  3ZJY C;  1FVI A;  5IYB H;  1Q12 A;  1YIT A;  3FKI I;  5C4J H;  4A3J G;  4LF7 L;  4A3K G;  4OON A;  3ESW A;  3K81 C;  1I5F A;  5FLM H;  3CQZ I;  1VS0 A;  3H0G H;  2YV5 A;  2KHJ A;  4NXM L;  4GKJ Q;  4GLA C;  3PF5 A;  3PO3 S;  1X3E A;  3J81 i;  1L2F A;  2D62 A;  3HOX G;  4YCU A;  2ZTC A;  2QA4 A;  4K0K L;  3RZD H;  3S1R H;  4A3B G;  1PH3 A;  2D0O A;  4DV2 L;  1K73 C;  4IPH A;  3BZC A;  1IBL Q;  2B3G A;  3HKZ E;  4LF4 L;  4BA1 I;  1X3F A;  4A4I A;  3U58 A;  1X65 A;  3RZO I;  4DR4 Q;  2KEN A;  1Y1W I;  2EQS A;  1PH4 A;  5IY0 A;  4OX9 Q;  3CCS A;  3RN2 A;  2B29 A;  3T1Y L;  1HNX Q;  5J3B A;  1PH7 A;  2BA0 A;  4LNQ A;  3S15 H;  3GTJ H;  1SN8 A;  1A0I A;  3GTM S;  4JI7 Q;  4BY7 I;  3CC7 A;  4L5Q A;  4B3M L;  1C0A A;  2MNA A;  4B3R Q;  4IJL A;  2VQE L;  3ERS X;  1M90 C;  2K50 A;  3DM3 A;  4A3G G;  1EQQ A;  4L5T A;  3HOW H;  2F4M A;  2EIF A;  3A0J A;  2C35 B;  3K8A A;  2JEB I;  3F2D A;  4JV5 Q;  3UDF A;  1NMF A;  4MZ9 A;  3CCQ A;  1XPU A;  2RCN A;  3HOU G;  3L7Z C;  2B63 H;  4A3J I;  4A3K I;  1OXU A;  1FJG Q;  4A3F H;  3J7Z C;  2KBN A;  3HKS A;  3HFZ B;  5GAH C;  5C3E G;  4NXN L;  3PIO A;  4C3I H;  4P73 A;  3KFU A;  4DR2 Q;  1BKB A;  1PH5 A;  3VMH A;  4Y52 I;  4DV5 L;  2KHI A;  4JI1 L;  3GKQ A;  1PFS A;  2KCM A;  3EBE A;  5AJ3 Q;  1XNQ L;  1Q1B A;  1A8V A;  1R9T I;  5C0X G;  1SLJ A;  4A3C I;  1X56 A;  4JI5 Q;  2E2I H;  2I0Q A;  1QZH A;  2P3Y A;  2JK8 A;  3CPW A;  3F2B A;  4DUY Q;  2WB1 E;  3JAM i;  4GKK L;  2OTJ A;  3KF6 A;  1VQM A;  1W2B A;  4HJ9 A;  2L15 A;  4LF8 Q;  4B3T Q;  1YJN A;  2CFM A;  1HR0 Q;  5C4X G;  1K83 I;  1BBW A;  4QJF A;  3D0F A;  1IBM L;  1MJE A;  4BY1 G;  4JI0 Q;  1YHQ A;  4QY7 A;  3CCV A;  1VQB A;  1NY4 A;  4JBM A;  3GO5 A;  1TWG H;  2N3S A;  3F1Z A;  2Q2H A;  1KL9 A;  3HOV G;  2F4O A;  1RO4 A;  4B3S Q;  2DE6 A;  4DR1 Q;  2CCZ A;  1Q1E A;  3HOU I;  1Y1V S;  4DNI A;  1L1O C;  1TWH I;  5C3E I;  4JI4 L;  3Q87 A;  4BBS H;  5IWA Q;  3CXC A;  4RG1 A;  1VQ6 A;  1CSQ A;  2UUC L;  4MTN A;  1Q81 C;  1Q82 C;  1S40 A;  2JA8 G;  4HIK A;  1C9O A;  1N8R C;  5C0X I;  4QIW E;  5IP7 H;  1G51 A;  2EXD A;  3M4P A;  5C44 G;  3GTQ I;  2WAQ G;  5M3F H;  2ES2 A;  2R93 G;  3A5Z B;  1N34 Q;  3GTP H;  4A3D I;  1OXT A;  1IL2 A;  3GTL H;  4JBW A;  2HIV A;  4DR3 L;  2QGQ A;  3M4O I;  1USP A;  4XTC S;  1S3O A;  3RLF A;  4WJ4 A;  1WCM G;  1I6H H;  5IYC H;  3HOY G;  2UUB Q;  4BXX H;  1KAW A;  4DR5 Q;  1V1Q A;  1Q46 A;  2E5L Q;  4MH4 A;  3CAM A;  4O2D A;  3TEH B;  4YY3 Q;  2R7F A;  5M5Y H;  4BY1 I;  4LF6 Q;  1PH8 A;  5M5W H;  1JJ2 A;  1HJP A;  1EIY B;  4A93 H;  1NE3 A;  1K9M C;  5ELN A;  2MFI A;  4R4O A;  5E7N A;  2VUM H;  2HT1 A;  3I4M H;  3HOV I;  1SRU A;  3M7N A;  1QUQ A;  3EIV A;  5K36 G;  3HOZ H;  4ME3 A;  5EAY A;  2HF1 A;  1WI5 A;  1SFO I;  3S2D H;  3ULJ A;  4L5S A;  3UDI A;  3FHW A;  3KDF A;  4JC0 A;  4DV4 L;  4J15 A;  3CW2 C;  3AEV A;  3A5U A;  2ZJP A;  4A3E G;  2AHO B;  3I7F A;  3S1M H;  3AFQ A;  3WWV A;  4KHP Q;  1E7Z A;  3STB D;  2ASB A;  2RBL A;  2JA7 I;  3RN5 A;  2E2H I;  3S24 A;  1K8A C;  4UY8 C;  3CCM A;  4UP8 A;  1J6Q A;  2Z6K C;  4YWK A;  3KOJ A;  5C44 I;  3J80 i;  1LYL A;  1N33 L;  1EOV A;  4NBA A;  3J81 c;  4KI0 A;  2I5L X;  3I2Z A;  1N2F A;  3HOY I;  4GN4 B;  1X3G A;  3BZK A;  2DE5 A;  2JA5 H;  2AMC B;  4JI2 L;  2AKW B;  1JT8 A;  1I50 H;  1TWA I;  5GRO A;  4NBB A;  2JA6 H;  4PMW A;  4A3L H;  3CC4 A;  1JE5 A;  1HNZ Q;  1K0R A;  1I94 L;  2ZJR A;  4JYA L;  1I3Q I;  3LGJ A;  3FKI H;  1LTL A;  1HZC A;  4QTT A;  2NVX I;  1HZB A;  2XTI A;  3CQZ H;  4X62 L;  3FP9 A;  3OTO Q;  1E22 A;  2HHH L;  1UE6 A;  2JJQ A;  4YWL A;  2NVQ I;  3H3V H;  4DV1 Q;  2JS4 A;  5LMN Q;  3CCU A;  3F8T A;  1G6P A;  1N36 Q;  1XNR Q;  3S2H I;  4JBK A;  4X66 Q;  4OO1 G;  1E3P A;  1IBK Q;  4JI5 L;  2VL6 A;  4A3E I;  4BBR H;  4A3M G;  1TFI A;  4NB8 A;  3RZO H;  4DUY L;  2K52 A;  1Y1W H;  1B7Y B;  3KYH C;  3I4N H;  1E1T A;  4P74 A;  4DV0 Q;  4DV7 Q;  1VQ8 A;  2BH8 A;  2PI2 A;  1TWF I;  1AH9 A;  1ZB9 A;  1X9N A;  5IYB G;  3AQQ A;  3HKZ G;  1EFW A;  3TRE A;  4BY7 H;  2R7Z I;  5FLM G;  3H0G G;  4X6A I;  3OYY A;  2Z6K A;  3W1B A;  4Y7N H;  2I5H A;  4LFA L;  2VQF L;  1MJC A;  3BU2 A;  5IE8 A;  4R4T A;  4GNX B;  3K7A I;  4YHH Q;  2OQ0 A;  3JAM c;  2K75 A;  3GTG I;  1T9H A;  4GN5 A;  4B3S L;  3VDY A;  1ZB8 A;  4LUO A;  3S1Q I;  4C3J H;  2IT1 A;  4R4I A;  4UP9 A;  4LF5 L; 
#chains in the Genus database with same CATH topology
 1TII D;  2SDF A;  4U67 3;  1EYA A;  4Y52 H;  2IWH A;  4GNX C;  4X64 L;  2V3V A;  1G2T A;  2D0P A;  3KJO A;  3F2C A;  2I5M X;  4G4K A;  2Q8T A;  1JJ2 Y;  2IHF A;  3B6Y A;  2UXB Q;  3SK4 A;  4DV3 L;  2ZXR A;  3HRZ C;  2KCT A;  1R9T H;  4FF2 A;  2PNH A;  1RCV D;  1JWH C;  5M3M H;  4A3C H;  4OO1 I;  4QQB X;  3PO2 H;  2IPK D;  2X6L A;  4ALP A;  1PFM A;  4ZKC B;  1M1K 1;  1N32 L;  4NBF A;  4KJO A;  1A3V A;  1L0Y B;  5M3F B;  1VQ4 Z;  2ATW A;  3GTP B;  1PDQ A;  2EYP A;  2E2J I;  2OTJ Z;  1Z9F A;  3L9A X;  2K3R A;  3GTL B;  3OHX C;  3NSW A;  5D1P A;  4PNY A;  3TBI B;  4OXP A;  3VR6 A;  4HGY A;  2N78 A;  3I56 A;  2QLV B;  1JQY D;  3MC0 B;  2A74 C;  2J6A A;  3NXW A;  1D7Q A;  4NPS A;  1I6H B;  1FNV A;  2CW0 D;  1LTR D;  5KYL A;  4IFD G;  1IZ6 A;  3EFX D;  5AFW A;  1CA6 A;  1L0X B;  3QIA A;  3NH5 A;  2XWJ B;  2ICE C;  5DLQ E;  1W6J A;  4PZ7 A;  3T1H Q;  1I4G A;  1VQC A;  2JQO A;  3D4D A;  4DN4 M;  1FYC A;  1RNI A;  4PQX A;  3VR3 A;  2UUB L;  3S17 H;  1T5E A;  3CP0 A;  4EX5 A;  2Z0S A;  5M5Y B;  1YNN C;  1YJW A;  2B63 G;  4FXD A;  5M5W B;  5C4J I;  1Y69 U;  2EXZ A;  1JJG A;  1CKN B;  2HQL A;  2HQE A;  1JOO A;  1J5E L;  5FLM I;  1EQV A;  2NVT H;  4A93 B;  4LFB Q;  4KTA A;  3H0G I;  2BH2 A;  5JOB A;  3STB C;  2D9U A;  3K59 A;  1EIH A;  2WFW A;  1XMO L;  3M9B A;  1QVG Z;  4JI6 Q;  2RVL A;  2LFN A;  2VUM B;  1U5K A;  1SMX A;  2PQE A;  2F0S A;  3I4M B;  2Z8L A;  2KQ3 A;  2E74 C;  1QB5 D;  3BG3 A;  4R8I A;  5COY A;  3JAM E;  3FPP A;  4HJA A;  4QTU A;  2B2W A;  4ZKB B;  3SK8 A;  3RZD I;  3OSO A;  1ZXT A;  2PZT A;  3HOZ B;  4X65 L;  3L3O C;  3P20 A;  3QWN A;  3S2D B;  4DF7 A;  5KNC A;  3KLR A;  3CCL 1;  3HOX I;  5IP9 H;  4LFC Q;  4KMU C;  1PFB A;  1LTS D;  2VZA A;  3CXC Z;  1VQ6 Z;  4A3B I;  1FL0 A;  2K5W A;  4RFB A;  3S1N H;  2B2U C;  2KCN A;  4A76 A;  3TP5 A;  2B8F A;  4EGV A;  1IL8 A;  3D6W A;  3BS1 A;  1M1K 2;  3CD6 A;  4C56 C;  2V1C C;  2Y0S E;  3SXH A;  4IJH A;  2DE7 A;  3EJI A;  4I65 A;  1ML8 A;  4DR6 Q;  4B08 A;  3H94 A;  2UXC Q;  3VYT A;  1EY4 A;  1JOQ A;  2EYL A;  3M3Y H;  1XTC D;  2EZV A;  1TS5 A;  4MD8 A;  1KDB A;  3S1M B;  4DUZ Q;  3MAQ A;  2JMO A;  5IYD H;  1HCZ A;  1VQ4 A;  1YBY A;  1LLR D;  4P72 A;  2O4X A;  4KV6 A;  1P16 A;  1UE5 A;  1VQP Z;  2CQA A;  5C0X H;  2G2K A;  3VMG A;  1SR3 A;  5ELC A;  1F9Q A;  2PPB C;  1H9S B;  5JJK A;  3ULL A;  3UE0 A;  1YJ9 A;  1CK1 A;  1MI2 A;  1OO9 B;  1YUA A;  1EIG A;  1IXR A;  3FDT A;  4HH4 A;  5H1S E;  3GTQ H;  4JCV E;  2ZAE B;  2LSS A;  5FLX L;  3TE5 B;  4ULL A;  2NN6 G;  4A3D H;  4KKS A;  3TN2 A;  2MP1 A;  3DXJ C;  3PV0 A;  1L1O B;  2DGY A;  1S5D D;  1GUW A;  1LV9 A;  4A3G I;  1TWC B;  1KRT A;  3M85 A;  1VQ7 1;  2PK7 A;  1CZG A;  2YTX A;  2JA5 B;  3LUS A;  2F4V Q;  1DOM A;  2IJ0 A;  1JOK A;  2MO1 A;  3NBI A;  1Q90 A;  3BYY B;  1EY5 A;  1X3W A;  1QVG A;  4X3U A;  1I50 B;  1NTG A;  4LF7 Q;  2DNC A;  1X0T A;  2YTV A;  3G6J B;  4WOR A;  2JA6 B;  3IFU A;  3SE0 A;  2UUA L;  1MSG A;  1IW7 C;  5GAG C;  1SNC A;  4IPD A;  3PUW A;  4PZ8 A;  2M2L A;  4TVA B;  3V96 A;  5BR8 L;  4BY1 H;  2KVM A;  4BBS G;  4ZRZ A;  1VQL Z;  3GTK B;  3ERO A;  2GN5 A;  2NWG A;  2JUB A;  1PYS B;  3FKI B;  1TR5 A;  2K5R A;  1B9N A;  3CCE A;  2OZK A;  4EWC A;  1VCI A;  1VF5 C;  2ZM6 L;  3PO3 G;  2RHS B;  4ZUJ A;  4XXE A;  4CKE A;  3M7G A;  3CQZ B;  4CDF C;  5LHY 1;  3EER A;  3P75 A;  1DGS A;  4XQJ A;  3H6M A;  5HGQ A;  3J80 c;  4K0K Q;  1EIF A;  3X3M A;  3VB9 A;  3S16 I;  1AEX A;  3J80 f;  1K28 A;  2QCP X;  4DV2 Q;  4KHV A;  3HOV H;  1GUN A;  4HTH A;  1PH6 A;  4RMF A;  2MPM A;  1Y1V B;  5IP7 G;  2F0T A;  5J1Z A;  1O7I A;  1HNW L;  1XPO A;  1Q7Y C;  1SFO H;  2B2T C;  4J1M A;  1VQD A;  2XWB B;  1OXX K;  4QUC A;  4H44 C;  5M3F G;  1DM0 B;  1JIC A;  1C48 A;  5T67 A;  2WKD A;  3PUX A;  1MD2 D;  3SVM A;  4KD3 A;  4YCW A;  5LMN L;  4AQY Q;  2F0D A;  1X32 A;  4DAM A;  1KC8 1;  1VQP A;  1STG A;  1Z47 A;  2OEO A;  3T1Y Q;  2PW7 A;  4BBR B;  4CDD C;  1WTR A;  4EQN A;  4X66 L;  2YU9 H;  5K5P A;  1EY7 A;  2PQA B;  1CKN A;  1LTI D;  2NTS A;  1O78 A;  5IT9 f;  3RZO B;  2M48 A;  1YHB A;  1ZYR D;  3CCM Z;  5IYC G;  1Y1W B;  4WJ3 M;  2PM9 A;  3I4N B;  1ML0 D;  2PMZ A;  3E3X A;  5F2D A;  3NDJ A;  3H3V C;  4IOC A;  1VQN A;  3BG1 B;  3IAY A;  3ONA B;  4RCN A;  1A3T A;  2ID0 A;  4QB4 A;  4DV6 L;  2XRQ D;  3M4Y A;  3I07 A;  2JA7 H;  1ET9 A;  4DR7 L;  3IFT A;  5FLX c;  2FFK B;  4HR7 B;  4KKT A;  4DKA C;  4B3M Q;  1LTG D;  1NR2 A;  2K4K A;  3CCU 1;  5FLX f;  4IFD J;  5C4X I;  4UP7 A;  3RLO A;  3GDE A;  2EY5 A;  2VQE Q;  5D1O A;  4IAL A;  2XRS D;  4A93 G;  2KPI A;  1SYB A;  3MZL B;  2OTL 1;  2LIY A;  3KLW A;  3NE5 B;  4FF1 A;  2NN6 I;  1HFN A;  4BY7 B;  2Z9H A;  1FGB D;  1MIU A;  5J22 A;  2UXD L;  4MTK A;  2IX0 A;  3I8Z A;  4E32 A;  2JE6 I;  1ENC A;  4IO9 A;  1TWG I;  1BDO A;  4M1U B;  2VUM G;  3T51 B;  3A56 A;  3WOF A;  3H15 A;  3WDN A;  1Y8C A;  1STE A;  4BS9 A;  2A5H A;  3I4M G;  4OWW B;  4IOA A;  1C7Y A;  2JXM B;  2PCF B;  4UPA A;  1STY A;  4TSS A;  3HGB A;  4Y7N B;  1VQF A;  1BNZ A;  1VQL A;  3CC4 Z;  3HOZ G;  1VQ8 1;  1DXM A;  2M00 A;  4A3I H;  4BA2 I;  1Q86 1;  1BCP F;  2F0P A;  2L1B A;  1B53 A;  1QNK A;  5LL6 f;  1YI2 Z;  4XDX A;  1TWA H;  4GKJ L;  3G71 Z;  3K0Y A;  4NXN Q;  4R4Q A;  1KRS A;  1XTD A;  1NMG A;  2CW0 C;  1A6X A;  5DEH A;  1JJC B;  1KAB A;  2WAQ E;  3J80 E;  4DV5 Q;  3PQI A;  3PO3 I;  3Q6S A;  2YAD A;  3PUZ A;  4UDU C;  4C3J B;  3I70 A;  1I3Q H;  3T16 A;  2A6E D;  4H7B A;  3K5N A;  1KC8 2;  1YIT 1;  1VQG A;  1XNQ Q;  2IHE A;  3S14 H;  2GA4 B;  3U9O A;  1NJI 1;  1WJJ A;  2W04 A;  4GZY C;  3J7A F;  1VLA A;  2LFU A;  4CHT B;  1V1P B;  2JA8 I;  3D4R A;  1MKH A;  4N9T A;  1IBL L;  1HZ9 A;  1AN8 A;  2HIX A;  3J7A 5;  3Q24 A;  3G4S A;  1PH9 A;  4CL1 A;  4QL5 A;  1STN A;  1SE8 A;  4XIG S;  2FJ2 A;  4DAY B;  2JA9 A;  4DR4 L;  2R61 A;  3P5J B;  1L1O A;  2EE1 A;  1B8A A;  3CCR A;  3MXN B;  4GOP C;  5M3M B;  4IN3 A;  3CRK C;  4OX9 L;  3GTP I;  3PO2 B;  5IGE A;  5IT9 E;  1HNX L;  1K0S A;  4DAP A;  2QA4 1;  1Y8P B;  2QEJ C;  2VY3 A;  3S15 B;  3S2H H;  3TQY A;  1KIX A;  3D8G A;  2R93 I;  4LW1 A;  4PG3 A;  2QKI C;  3GD7 A;  1LTA D;  1I6H I;  4NBG A;  4GLV B;  2LXJ A;  1GO3 E;  4GN3 B;  5FJ8 H;  4N8F A;  2JA5 G;  1NUI A;  5IIF A;  1AZQ A;  4JI7 L;  2MO0 A;  2R92 G;  2NTT A;  1NNX A;  2N49 A;  4ABN A;  3CME Z;  5FLX E;  1WCM I;  3UE1 A;  3DWQ A;  4FXK C;  2QF7 A;  1IBM Q;  3GTM I;  5EGT A;  4POG A;  3K80 C;  3TDH B;  4B3R L;  3A55 A;  1IYJ B;  1RTN A;  2HD3 A;  2AKL A;  4A3L G;  3CCS 1;  3HOW B;  4ILW A;  4OWX B;  1Q86 2;  1KD1 C;  1TWF H;  3S17 B;  3GTO I;  3JC6 6;  3R8B A;  2F1M A;  4NB3 A;  4F87 A;  4POF A;  1F2L A;  3QG1 A;  5I4D A;  4A75 A;  4MD9 A;  4J6H A;  2NVT B;  4CGY B;  1EY8 A;  4YIJ A;  2Y0S B;  1XPR A;  3FKI G;  4DK6 C;  2VUM I;  4JG2 A;  1B2T A;  2E75 C;  3I4M I;  2ALY B;  3IFD A;  2J7Z A;  2JNY A;  4DGL A;  1YI2 A;  2R7Z H;  1PVO A;  4JV5 L;  1HA5 A;  4A3F B;  1OXV A;  2OWO A;  4LFB L;  2RSO A;  3G71 A;  1SJH D;  1DOL A;  4C2M H;  3A8I E;  5JAV A;  3I56 1;  3I91 A;  2V8K A;  4S3S A;  2FIN B;  4G57 A;  4C3I B;  1FJG L;  1NJI 2;  1Y1V G;  1CTM A;  1LQL A;  4IUT A;  2DNE A;  1H9K A;  3SK5 A;  4HID A;  2E8G A;  4JI4 Q;  5M9O A;  4DR2 L;  1BBU A;  4DNR B;  4GS3 A;  1PTO H;  1HR0 W;  2UUC Q;  4YWM A;  3K7A H;  2DY7 A;  5CM2 M;  1SRO A;  1YJW 1;  3S1N B;  5CBA E;  2LY7 A;  4ZUI A;  1HH2 P;  5AJ3 L;  1CI3 M;  1ROD A;  1P8L A;  4RVG A;  3NEN A;  4JW0 A;  4BBR G;  3CCQ 1;  3GP7 A;  3S1M I;  3HS0 C;  2E2I B;  4TKO B;  3NBH B;  1ILP A;  2CVR A;  3GV3 A;  3TSS A;  2RF4 A;  1J8I A;  1Y1W G;  1ET6 A;  3NFZ A;  2VB3 X;  3M3Y B;  3I4N G;  1E1O A;  2EYO A;  1RJT A;  2LS0 1;  3I55 A;  2YTY A;  1QVG Y;  5TSS A;  4AYB E;  1Y8N B;  2XVS A;  1PH1 A;  1HHV A;  3RLN A;  5LL6 X;  2JYO A;  2CWP A;  4IUN A;  3HKZ A;  1V8Q A;  4B9W A;  1G8Z D;  1RL2 A;  2JIQ A;  1XJV A;  3HG9 A;  2R3Z A;  3CC2 Z;  5D3I B;  3DUZ A;  4HJ8 A;  2GVB A;  3SHL A;  4FDB A;  3U4Z A;  4GLX A;  2VPX A;  1VDZ A;  1F9R A;  1EEF D;  2F0M A;  3CME A;  4WRD A;  2EYH A;  2WP8 J;  2XSC A;  2ENB A;  4OO1 H;  4BY7 G;  1BCP B;  1SNQ A;  2F3W A;  1G2S A;  2KI7 B;  3CXC Y;  5ELD A;  1GUG A;  1PMR A;  3NQI A;  1SAP A;  1ILQ A;  3QR8 A;  3GTQ B;  2C9O A;  4LF8 L;  1JWS D;  1W3S A;  2NZH A;  1TWC I;  2SOB A;  3I4L A;  4HN7 A;  4B3T L;  4A3D B;  4XX2 A;  2JA5 I;  1HR0 L;  2E2J H;  2ICI A;  4JOI C;  1K3B C;  3RMH A;  2R92 I;  1UUP A;  3G48 A;  4LWC A;  4EQP A;  5C4H A;  5JVH 3;  1Y14 B;  2B8G A;  2K5N A;  1VQ5 Z;  1X55 A;  4JI0 L;  2MQH A;  1EYD A;  5BN5 A;  1KXL A;  4JVZ A;  1QIL A;  3HZX A;  2GU2 A;  1VQ4 1;  4R1J A;  2OCE A;  3W5O A;  1CA5 A;  3I90 A;  2L4N A;  2OTJ 1;  3PUV A;  1K73 1;  5LMU Q;  3C2P A;  3PUY A;  1B9M A;  2F0W A;  2CQO A;  2E2D C;  1CUK A;  1V1P A;  3AFP A;  3GTK I;  4QIW B;  2AQ2 B;  4CJ1 B;  4P71 A;  5CV6 A;  2HUG A;  5EPL A;  3CF5 A;  1ZYR C;  1VQE A;  3KF6 B;  3C46 A;  1PTO D;  1K8O A;  5A2Q b;  4C3J G;  4JI8 Q;  5KYI A;  4DR1 L;  3SGI A;  1ENF A;  3MXN A;  4V0B A;  3IL8 A;  2FXQ A;  1M4V A;  1AE3 A;  2O53 A;  1X3P A;  4A3J H;  1RKN A;  3G6E A;  3VA7 A;  4A3K H;  2AWO A;  1VQI A;  1EY6 A;  1F9P A;  2GVA A;  4IPG A;  1YHA A;  1Y1V I;  2WIN B;  3T4N B;  2B2Y C;  5CV4 A;  5IWA L;  2IZ4 A;  4KN7 C;  3H3V I;  1PFT A;  2UU9 Q;  2ZTE A;  3CPF A;  4DV4 Q;  1WTO A;  1QJO A;  1DL6 A;  1B70 B;  5M3M G;  2CKZ B;  3UDX A;  1SFO B;  4A3C G;  4DFA A;  3CD6 Z;  3L0O A;  3PO2 G;  4PMC A;  2K5Q A;  3HOX H;  1CZW A;  1UE7 A;  1SE2 A;  2PZU A;  3KF8 B;  4JI3 Q;  4BBR I;  4A3B H;  3FEW X;  3NH8 A;  3GCF A;  3PIP A;  2NBF A;  3OW2 A;  3CC2 A;  3GV6 A;  4ZQ3 A;  3MFY A;  1Z03 A;  3I4N I;  1ESF A;  2YU9 B;  2NUC A;  3J7Y W;  1QOH A;  2PI2 E;  4AQY L;  4A3M I;  4RHR A;  4QGU A;  2A6H D;  3K6O A;  2NVY I;  1VQ6 1;  4XYQ A;  1WFQ A;  5G3L D;  2JP1 A;  1EUJ A;  2K5H A;  4RVF A;  2IY5 B;  1N34 L;  4DU9 A;  5EBD A;  2N55 A;  3OIP A;  3EQL C;  5GAE C;  3HOW G;  2K04 A;  1N33 Q;  1Y8O B;  2WB1 A;  1YJ9 Z;  1U0L A;  3KJP A;  3F2U A;  1KQS Z;  1RHP A;  2A19 A;  2H1E A;  2JA7 B;  2AQ3 B;  1RF2 D;  1E0B A;  2A6E C;  1CSP A;  1K73 2;  1VQ5 A;  1Z01 A;  1NBW A;  1KAA A;  2Y0S G;  5COR A;  2Q2U A;  1QZG A;  1W6K A;  2EVB A;  3I3C A;  4DR5 L;  4IUQ A;  2E5L L;  2Q2T A;  1CM9 A;  3N6R A;  5I6Y A;  1K83 H;  2JN4 A;  4P75 A;  5KRU A;  3AYH B;  4A3F G;  1VQP 1;  1NUC A;  2KA7 A;  2IW3 A;  2WB1 G;  4YY3 L;  1M1K C;  1TY0 A;  4JI2 Q;  2H4O A;  1LAC A;  1QYP A;  4Y7N I;  1HPC A;  3RNU A;  4LF6 L;  1HRJ A;  2F3V A;  3VYS A;  2DY8 A;  4C3I G;  2A68 D;  2FMC A;  1Q8I A;  2EYF A;  4JPB W;  1S5B D;  2VUG A;  3CMA A;  4A3G H;  3AB9 A;  2OOX B;  2VXW A;  2F0L A;  3T53 B;  1PV4 A;  4A3I B;  1YZ6 A;  4MNO A;  4HIO A;  1I94 Q;  5I9O A;  4DXF A;  2Q8R E;  4JYA Q;  3KLS A;  1N9W A;  5IP9 G;  3Q0A A;  4JBJ A;  3S1R I;  1ICW A;  5ELF A;  1HXY D;  1USP B;  4JOI A;  4RGO S;  1TWA B;  1K8G A;  3CCE Z;  1LTB D;  3K7U C;  4HIM A;  5KEE A;  3RR5 A;  3J80 L;  2F0J A;  1BO0 A;  5C4Z A;  3H3V J;  2BA1 A;  1KTK A;  3NWS A;  4HJ5 A;  3TRZ A;  5JEA J;  4X62 Q;  4LUV A;  5C5L A;  5FKA C;  3HOU H;  3TS2 A;  4AH6 A;  4MON A;  1XMQ Q;  1QG7 A;  1RIP A;  2HHH Q;  4AIM A;  1M90 2;  2B2V C;  2AUJ D;  3GQB A;  1NAP A;  1TWH H;  5C3E H;  1X3Z A;  2R6G A;  4LF9 Q;  4IQZ A;  4BWG B;  3S14 B;  2F03 A;  4IPC A;  1OTC A;  3EA6 A;  4M8A A;  1BR9 A;  5IYD G;  2RDF A;  4Q5V A;  2K5D A;  2RSN A;  4CKB A;  1G6Z A;  2XGT A;  5LL6 S;  1VQL 1;  3S16 H;  1YUK A;  5EPJ A;  2O2L D;  1WOC A;  1JB3 A;  3URY A;  3PO2 I;  1WD0 A;  2QEX Z;  3S15 I;  3GTJ I;  3K5O A;  3PCO B;  5IT9 L;  4KHP L;  5T1I A;  2VB2 X;  2F0N A;  4E30 A;  1YEZ A;  2P5Z X;  1V43 A;  5D3D A;  2EYM A;  3BG0 B;  3LWU A;  3U50 C;  3S2H B;  1JC7 A;  3TS0 A;  3P7J A;  4A3D G;  1QUQ B;  3PF4 A;  4UAI A;  1SE4 A;  1KQS A;  2CHB D;  3BJU A;  4GNX A;  1VQN Z;  3NQT A;  1TT2 A;  1ASY A;  3CCJ Z;  3Q8D A;  4H02 A;  2F4I A;  3KDF B;  3HOW I;  1EQR A;  4DAV A;  2AWN A;  3DHQ A;  1BVS A;  4IZ8 A;  3M4O H;  4IFD I;  3S17 I;  1V9P A;  4K5W A;  1LUZ A;  3A8K E;  4DK1 A;  1Q8K A;  3HP3 A;  2VPY A;  5JJI A;  2NVT I;  5LMN W;  1EL0 A;  1TWF B;  1VQ9 Z;  4PMB A;  4R4C A;  3CCM 1;  3BDC A;  2B63 I;  5C4X H;  3NH4 A;  2HU9 A;  4A3F I;  1VQA A;  2NYZ D;  2ZTD A;  2VPW A;  5JPM C;  2NN6 H;  4K6D A;  1IYU A;  2R7Z B;  2IX1 A;  5HGT A;  3C1F A;  4LFA Q;  3NEL A;  2VQF Q;  4NXM Q;  2K5V A;  1STB A;  2TSS A;  1CKM A;  1HNZ L;  1QVF A;  1YIJ Z;  4AYB B;  4C2M B;  1N8R 1;  1NP6 A;  1UE1 A;  1YVC A;  1H95 A;  2OQK A;  1CKO A;  5J39 A;  1X6O A;  5T64 A;  1TXY A;  4XQQ A;  2DUD A;  3IRB A;  5KNB A;  1G29 1;  5IP9 I;  1GHJ A;  4ZAI A;  3DLL A;  2VNU D;  1K8M A;  1NR4 A;  1QVC A;  3S1N I;  4XYO A;  1EWI A;  5CV9 A;  2GTI A;  1AZP A;  1PTO B;  4XT1 B;  2DN8 A;  3K7A B;  2LEX A;  1F2Z A;  4LF5 Q;  3OTO L;  4E6I A;  2F0Q A;  5E3F A;  2E2I I;  4LF4 Q;  1A2T A;  1KLG D;  3CC4 1;  3KBG A;  1VF7 A;  2F3I A;  3M3Y I;  2E9H A;  1WZN A;  1WJ2 A;  5EPK A;  4DV1 L;  2O5J C;  4X64 Q;  2MUY A;  3ULP A;  3PO3 H;  3O13 A;  2QEX A;  1YI2 1;  3G4S Z;  5FO8 B;  3K5M A;  1C4Q A;  2EY6 A;  1A63 A;  1N36 L;  1XNR L;  3G71 1;  4DV3 Q;  3OIQ A;  5KIX A;  1FDI A;  5IT9 c;  1IBK L;  3CCR Z;  1VQH A;  1GD7 A;  3BVM A;  2JA8 H;  4I7A A;  4E2Z A;  1NCV A;  1N32 Q;  4U68 A;  1PTO C;  2JA7 G;  4BXX G;  2Q51 A;  5HY6 A;  1STA A;  2QDB A;  2B2U A;  1GM5 A;  2PZW A;  1STH A;  1IKL A;  1JMC A;  4F88 A;  1SE3 A;  4FYD A;  3E9I A;  3CCJ A;  4DV0 L;  2RPR A;  1K9M 1;  4DV7 L;  2E2H H;  5JJL A;  2EJM A;  1OXS C;  3M4Q A;  3ZYY X;  5C44 H;  2K05 A;  5EQ0 A;  2K1B A;  4K5X A;  2BJO A;  5CBE E;  2R93 H;  2Q4Z A;  1Q81 2;  1Q82 2;  1CT1 D;  1K3R A;  1UWV A;  4LMQ D;  1AE2 A;  4O0A A;  2VW9 A;  2F52 A;  2E2J B;  1VQ9 A;  1D8L A;  2RT9 A;  3PGZ A;  1KC8 C;  3R93 A;  1YNX A;  1I4R A;  4OHJ A;  4A3I G;  1N8R 2;  1HZA A;  1WCM H;  2PO4 A;  5BN4 A;  3PIP 3;  3GTM H;  1J5E Q;  3CCL A;  2DJF C;  3HOY H;  1F77 A;  3FPU B;  4DK3 C;  2FMM A;  2IV2 X;  2H5X A;  1YIJ A;  3MWY W;  3OW2 Y;  4PZ6 A;  2EY1 A;  1TKW B;  1H9R A;  3Q22 A;  1XMO Q;  2A6H C;  3GTO H;  3CME 1;  3EN2 A;  5LMU L;  3ERQ A;  1XYI A;  1UEB A;  1TS4 A;  4HJ7 A;  4BBS I;  1S72 Z;  3K0X A;  5C3W A;  4DPG A;  4NW2 A;  1VQK Z;  4YHH L;  1CHP D;  1MGS A;  4GOP B;  5A2Q L;  3VMI A;  1LM0 A;  4A3J B;  4JI1 Q;  4X65 Q;  4A3K B;  3A7L A;  1GKH A;  2Q2I A;  3D6C A;  1WYD A;  4JI8 L;  4DGZ A;  1GUT A;  3ER0 A;  2NZO A;  1ZH1 A;  1H9S A;  2F0H A;  1K8A 1;  1X54 A;  4CJ2 C;  4YCV A;  2NVX H;  2OF1 A;  1GVP A;  2KUM A;  2DJG C;  2F0K A;  1FGU A;  1SNM A;  3DWP A;  3LNN A;  3MEH A;  5IP7 I;  5K36 H;  2QR1 B;  4MN3 A;  2JR6 A;  2LXK A;  2VF1 A;  4K6L A;  1U4M A;  4DXG A;  2UU9 L;  3I4O A;  4DQY B;  1Q86 C;  4L5R C;  1U4P A;  1PH2 A;  3HOX B;  2A68 C;  2NVQ H;  5C0X J;  4OGQ C;  1R9T B;  4A3B B;  3NTK A;  2YU9 I;  3ICE A;  1K9M 2;  3NEM A;  2UXB L;  3MA2 B;  4C3H H;  2JIO A;  3I55 Z;  1FD7 D;  3GTL I;  2PMZ E;  3MEF A;  1E2Z A;  4GKK Q;  2Z6B A;  5CGK A;  1WW9 A;  4H13 C;  4JI3 L;  5FJ8 G;  1VQ7 A;  1E24 A;  3MXP A;  2K6A A;  3NTI A;  3SK6 A;  3J81 j;  1II3 A;  2F0G A;  2A1A A;  3U4V A;  2R7D A;  3AMU A;  1DYQ A;  2RKS A;  4A3E H;  2RHB A;  4RGN A;  4N9P A;  1PHJ A;  4BXX I;  2B2T A;  2D2C C;  1B50 A;  2J4X A;  3A54 A;  1NJI C;  5EBC A;  1VQO Z;  4HAE A;  4KHZ A;  1HA6 A;  2HDL A;  1MHW C;  1RLY A;  4Z9C B;  2JEA I;  1I6V C;  1GHK A;  1WTW A;  2JA6 G;  4FP5 D;  3OPO A;  2KEE A;  3J7A 4;  4NDX A;  4RVD A;  4E31 A;  1A62 A;  2V8J A;  2MHV A;  4A93 I;  4NBE A;  3J81 f;  5M5X H;  3N52 A;  3T1H L;  2R7Z G;  4MRI A;  1K83 B;  1U4L A;  3TP6 A;  1J9O A;  3CC2 1;  1Z7T A;  1VQJ A;  4C1N K;  4AYB G;  1TWC H;  1JOR A;  1PYB A;  3PSI A;  2R92 H;  4A3I I;  2F0E A;  4TQU S;  1GOZ A;  4KJN A;  2A8V A;  2UUA Q;  4LUZ A;  4X6A H;  4RKB A;  4CBV A;  5EKL A;  1S72 A;  2F0O A;  4A3G B;  2KJX A;  5BR8 Q;  1KLU D;  3HOZ I;  4K14 A;  4RKL A;  1K8A 2;  1VQK A;  5ELO A;  3S2D I;  1JWM D;  4DA2 A;  4JI6 L;  2VS1 A;  4C1N I;  3E9H A;  4V19 0;  2PQA A;  1U9R A;  2CWA A;  4X3T A;  1LT3 D;  1VQ5 1;  2AQ1 B;  2K32 A;  2SEB D;  1KHI A;  1KQS Y;  4KLK A;  1L0W A;  3W1G A;  5JEA G;  2ZM6 Q;  3GTK H;  5A2Q f;  2HCC A;  1WTX A;  4NBC A;  3G6E Z;  1IHZ A;  2K03 A;  1ASZ A;  1JB7 A;  1QNU A;  1X3Q A;  1S5E D;  3S14 I;  4EVO A;  3HOU B;  3GTG H;  1PRT D;  4JK1 C;  4RH6 A;  4LFC L;  1SDF A;  2J0T D;  1KNA A;  1D2B A;  1TWH B;  1RQF A;  5C3E B;  1XMQ L;  1HNW Q;  3S1Q H;  2BE5 D;  1FDO A;  2OXP A;  4KD4 A;  3BDO A;  1QXF A;  1PXU A;  5GAD C;  2V45 A;  4K5V A;  1Y1V H;  4LF9 L;  3S16 B;  4DR6 L;  4NB9 A;  1SXT A;  4P2C B;  2ZJQ A;  4OIK A;  1PZK D;  2UXC L;  1EU4 A;  4WJW A;  4ZLT F;  3UDG A;  3OW2 Z;  1BOS A;  4DUZ L;  2OTL A;  3T4A C;  5I6W A;  2K14 A;  3L2P A;  1SYD A;  4NBH A;  5BN3 A;  1EYC A;  2F0I A;  3TP7 A;  5CMD A;  4DR3 Q;  1VQO A;  2MJ8 A;  4QCL A;  3NK9 A;  4K8I A;  3KK7 A;  5GQO A;  3A8J E;  3NWT A;  4UHV A;  1B1Z A;  3BZD B;  1PA6 A;  3CD6 1;  3J81 b;  5JPN C;  4DV6 Q;  2GTH A;  3I73 A;  1YNJ D;  2YYZ A;  4A3M H;  4DR7 Q;  3E0E A;  2A69 D;  2NVY H;  2NAP A;  3MZK B;  3A74 A;  4RAU C;  4APV A;  1SIW A;  4EQ5 A;  2RHQ B;  3NDI A;  2ZXP A;  3D31 A;  5D14 A;  4GOP A;  3M4O B;  3CC7 Z;  1D1I A;  1I50 I;  2PNR C;  2JA6 I;  4A3L I;  2SNM A;  2RCF A;  2N8N A;  4R8N A;  1D6E C;  2M9V A;  2UXD Q;  4NOZ A;  4OWT B;  2L11 A;  2B2W C;  5FOB B;  1A3U A;  1EYG A;  4NH1 C;  4NBD A;  2F4V L;  2EGT A;  4N8X 1;  5CR3 A;  5C4X B;  3ZJY C;  1FVI A;  5IYB H;  1UNS A;  1PFN A;  4EQO A;  1Q12 A;  1I4P A;  3CU7 A;  2V8I A;  2K7V A;  2QRE B;  4X3K A;  1YIT A;  3FKI I;  1SYC A;  4BY1 B;  1YJ9 1;  4KN4 C;  5C4J H;  4A3J G;  3EED A;  4LF7 L;  2AYD A;  3CMA Z;  2CH4 A;  2K01 A;  4A3K G;  4OON A;  3ESW A;  3K81 C;  1I5F A;  4DAY A;  4H0L C;  5FLM H;  5DM7 3;  1SJE D;  1PLF A;  1SND A;  3CKI B;  2JIM A;  3CQZ I;  1EQT A;  1VS0 A;  3H0G H;  5E4W C;  2L5T A;  2YV5 A;  1Z02 A;  2KHJ A;  4NXM L;  4GKJ Q;  4GLA C;  3PF5 A;  5A2Q E;  1KDA A;  1SYE A;  3PO3 S;  4FXG C;  1X3E A;  3J81 i;  1L2F A;  1WTV A;  1D1K A;  4KK7 A;  3BVZ A;  1ZEQ X;  3OMG A;  3HOV B;  2RIQ A;  1CFM A;  2D62 A;  3HOX G;  3JAM f;  4YCU A;  2ZTC A;  2QA4 A;  4K0K L;  3RZD H;  3S1R H;  4A3B G;  4J8Q A;  1PH3 A;  2D0O A;  4DV2 L;  1K73 C;  4IPH A;  2BOS A;  3BZC A;  2LMC B;  5IGC A;  4NKL A;  4L63 B;  2B3G A;  1IBL Q;  1EEI D;  1HTL D;  3HKZ E;  4LF4 L;  3D2L A;  1AA6 A;  4KKU A;  1LT5 D;  3PO3 B;  4BA1 I;  5IGD A;  1QWY A;  1X3F A;  5L37 A;  3MFG A;  4A4I A;  3E6Z X;  1M90 1;  1A15 A;  4TRD A;  3U58 A;  1DJR D;  3RZO I;  1X65 A;  4ODG A;  2KEN A;  4DR4 Q;  1DZ1 A;  1Y1W I;  3QOJ A;  3CCE 1;  4IUP A;  1WTP A;  2BDO A;  2EQS A;  1PH4 A;  5IY0 A;  4OX9 Q;  1HQM C;  3CCS A;  3RN2 A;  2JA8 B;  2B29 A;  5CC4 A;  2Y0S A;  3T1Y L;  1HNX Q;  1JR0 D;  2HDM A;  1PTO F;  3CRL C;  1D5Z C;  3CPW Z;  5J3B A;  3OWF A;  4KY7 A;  1PH7 A;  2BA0 A;  1HUN A;  4LNQ A;  3S15 H;  3GTJ H;  1SN8 A;  1A0I A;  3GTM S;  2E2H B;  4JI7 Q;  3OWE B;  3EVQ A;  4BY7 I;  5NUC A;  1G91 A;  3CC7 A;  5C3X A;  4L5Q A;  1VQM Z;  2A73 B;  5C44 B;  1AW7 A;  1W2B Z;  2WAQ B;  4B3M L;  1C0A A;  2R93 B;  5FK9 C;  1EZ6 A;  2MNA A;  4B3R Q;  2ZT9 C;  4X3S A;  2QEX 1;  1SNP A;  1B4O A;  3SDZ A;  4IJL A;  2VQE L;  3ERS X;  2XN9 C;  1M90 C;  4NP5 A;  4E2W A;  1YJN Z;  2K50 A;  4K2K A;  3BYT B;  3DM3 A;  2RDH A;  1EQQ A;  4A3G G;  1B3Q A;  2F0F A;  4CJ0 B;  2OOY B;  1WCM B;  4L5T A;  3HOW H;  1YHQ Z;  3GTM B;  2F4M A;  4R9W A;  3HOY B;  2EIF A;  4IFD H;  3A0J A;  5DNF A;  5KND A;  2H85 A;  4MXU A;  1FR3 A;  2C35 B;  1GUO A;  3E0J A;  3NBH A;  3K8A A;  2JEB I;  1VQN 1;  2R6M A;  2JIP A;  3CCV Z;  1QCB D;  1EWH A;  3F2D A;  4JV5 Q;  3UDF A;  1M8A A;  1WTQ A;  3SEB A;  1NMF A;  3CCJ 1;  4MZ9 A;  3GTO B;  3CCQ A;  1XPU A;  1QE6 A;  2RCN A;  3HOU G;  3L7Z C;  1QVF Z;  5G3L F;  2B63 H;  4A3J I;  2PMZ B;  5EKK A;  3ITP A;  4I7Z C;  4A3K I;  1OXU A;  2Z1C A;  3D4W A;  3JAM b;  1FJG Q;  4A3F H;  5ISR A;  1XX8 A;  2KBN A;  3HKS A;  3J7Z C;  3NTH A;  3HFZ B;  5GAH C;  5C3E G;  4S1T A;  4NXN L;  3PIO A;  4OL7 A;  2QDL A;  1VQ9 1;  3W3A A;  4C3I H;  4P73 A;  1SMY D;  4DR2 Q;  3KFU A;  1BKB A;  3RUZ A;  1PH5 A;  1I3Q B;  3VMH A;  5D1O B;  4Y52 I;  4KY5 A;  3VYU A;  1TY2 A;  4DV5 L;  2KHI A;  4JI1 L;  3GKQ A;  1PFS A;  2KCM A;  3EBE A;  2NVX B;  3FRP B;  2EPB A;  2EYJ A;  5AJ3 Q;  5HUR A;  1XNQ L;  1F9S A;  1Q1B A;  1A8V A;  1R9T I;  2ZXO A;  2K28 A;  3TP8 A;  5C0X G;  1YIJ 1;  1SLJ A;  3R2T A;  4A3C I;  3VA5 A;  1BF4 A;  4FF3 A;  2MGS A;  1X56 A;  4JI5 Q;  1PRT B;  2NVQ B;  2E2I H;  2I0Q A;  1NSN S;  1QZH A;  2P3Y A;  4C3H B;  1O80 A;  3DEP A;  2JK8 A;  3CPW A;  3F2B A;  4DUY Q;  2WB1 E;  2B2Y A;  1A2U A;  2W03 A;  3JAM i;  4QUF A;  4GKK L;  4A3E B;  4FVM A;  2QW7 A;  2OTJ A;  3AU7 A;  3V05 A;  1LT4 D;  3FMC A;  3KF6 A;  1KNE A;  2KED A;  1BXT A;  4RWS C;  1VQM A;  1S5F D;  1W2B A;  2RA4 A;  3NPP A;  1EZ8 A;  4HJ9 A;  2QRD B;  4O42 A;  1I4H A;  1UEA B;  1RDP D;  2L15 A;  3QJY A;  1PRT C;  3D3R A;  3G4S 1;  4HMJ A;  4LF8 Q;  1Q3L A;  4B3T Q;  1YJN A;  2CFM A;  1HR0 Q;  5C4X G;  1K83 I;  1BBW A;  4QJF A;  3D0F A;  1IBM L;  4OEL B;  3TME A;  2F0V A;  1MJE A;  2BE5 C;  4IUV A;  3CCR 1;  1TVX A;  4RVH A;  2Z4H A;  4CKC A;  4BY1 G;  5M5X B;  4JI0 Q;  4XT3 B;  1YHQ A;  4IUR A;  3U9S A;  2QRC B;  5CV5 A;  5C5M A;  1B3A A;  4QY7 A;  3MON A;  3KUP A;  1Q81 1;  1Q82 1;  3CCV A;  1VQB A;  1NY4 A;  1TU2 B;  4RS4 A;  3CCL Z;  2D5D A;  4LAA A;  2R92 B;  2K33 A;  2QKD A;  4JBM A;  3GO5 A;  1TWG H;  2N3S A;  1KRL A;  3F1Z A;  2Q2H A;  1LO5 D;  3KF8 A;  1Q7Y 1;  1JJ2 Z;  1KL9 A;  4ID6 A;  2I07 B;  3H09 A;  1S5C D;  1FNW A;  3HOV G;  1E2V A;  2F4O A;  2WV6 D;  3ND9 A;  4WJ4 A;  1RO4 A;  4B3S Q;  3IX0 A;  2AUK A;  4ZCK A;  2DE6 A;  4DR1 Q;  2CCZ A;  3VYR A;  1Q1E A;  2Z4I A;  3HOU I;  1Y1V S;  2I3C A;  1RD9 D;  2V4D A;  1YNJ C;  4DNI A;  3DEO A;  2XNA C;  3F3P C;  1L1O C;  1CHQ D;  2A69 C;  4G7H C;  1JE4 A;  1TWH I;  5C3E I;  4JI4 L;  3Q87 A;  2NB0 A;  4BBS H;  5IWA Q;  3GTG B;  4G7Z C;  3CXC A;  4RG1 A;  1SYF A;  3MZ5 A;  3LWE A;  1CSQ A;  2UUC L;  1VQ6 A;  1DOK A;  4MIU A;  4MTN A;  1Q81 C;  1Q82 C;  1S40 A;  3S1Q B;  4RCO A;  2JA8 G;  4RA8 A;  1ONL A;  3KLS X;  4HIK A;  2WAQ A;  1S72 1;  1C9O A;  1WII A;  3T56 B;  1N8R C;  4WFN 3;  4Q0F A;  3QB3 A;  1VQK 1;  3OOC A;  2NZ1 D;  5C0X I;  3D9X A;  2F0U A;  2VPZ A;  1RO2 A;  3MHB A;  2BCO A;  4QIW E;  5IP7 H;  1G51 A;  1SNO A;  3UI2 A;  5IGB A;  4NFR A;  2TMP A;  3V2T A;  1VQ7 Z;  1UAP A;  3OW7 A;  5ELE A;  2EXD A;  5T6B A;  3M4P A;  3K57 A;  2B2V A;  2L0C A;  1ZKO A;  5C44 G;  1E2W A;  5ELB A;  3GTQ I;  5AN9 F;  2WAQ G;  1BCP D;  3DWA A;  3VR2 A;  5M3F H;  3A5Z B;  2ES2 A;  2R93 G;  1H9J A;  1N34 Q;  3GTP H;  4A3D I;  1OXT A;  1IL2 A;  3GTL H;  3HEJ A;  4FNF A;  4JBW A;  3S9W A;  4F8M A;  2HIV A;  1R4Q B;  4DR3 L;  2QGQ A;  4QMG A;  3M4O I;  1USP A;  1PYW D;  3TZU A;  4XTC S;  3WOE A;  1DD2 A;  2EY2 A;  4A3M B;  1S3O A;  3RLF A;  2EJF C;  1WCM G;  1BQQ T;  1TQO A;  3I72 A;  3NHH A;  4RGT A;  3J81 L;  1I6H H;  2NVY B;  4G7O C;  3MVV A;  1WD1 A;  5IYC H;  3HOY G;  1LT6 D;  3FQQ A;  3I55 1;  2UUB Q;  4BXX H;  1KAW A;  3VR4 A;  4DR5 Q;  2KCC A;  4DNT B;  1V1Q A;  1Q7Y 2;  1Q46 A;  1S7M A;  2E5L Q;  4MH4 A;  1TS2 A;  4LJZ C;  3CAM A;  4OIJ A;  5E4X A;  3T13 A;  5A35 A;  3MTS A;  4O2D A;  3TEH B;  4YY3 Q;  2OT2 A;  2E76 C;  4NMZ A;  2R7F A;  5M5Y H;  4F7X A;  4BY1 I;  4LF6 Q;  1PH8 A;  5M5W H;  3H91 A;  1JJ2 A;  1HJP A;  1EIY B;  2G9H D;  3HKZ B;  4A93 H;  2EDG A;  1NE3 A;  1VQO 1;  1K9M C;  5ELN A;  3K5L A;  5C4J B;  1WVL A;  1BUV T;  2MFI A;  3R2I A;  4QF4 A;  4R4O A;  1XWE A;  4HMI A;  5E7N A;  2LKV A;  2VUM H;  3H0G B;  1EOT A;  2HT1 A;  4MD7 A;  3I4M H;  2EOT A;  3HOV I;  1SRU A;  1IYV A;  2PYK A;  4HGZ A;  3C1E A;  4O1N A;  1D5M C;  3M7N A;  3MXU A;  1QUQ A;  3BDL A;  3J80 b;  3EIV A;  3HOZ H;  5K36 G;  4ME3 A;  5EAY A;  2HF1 A;  1O7L A;  1WI5 A;  1SFO I;  2B39 A;  3S2D H;  3ULJ A;  1B44 D;  2O4H A;  1JWU D;  4L5S A;  3RZD B;  2KHS A;  3S1R B;  1AFP A;  3UDI A;  1P9N A;  5KGU A;  3FHW A;  1Q16 A;  4IUU A;  3KDF A;  1HTP A;  4C3H G;  2CH4 W;  4JC0 A;  4LK1 C;  4DV4 L;  2I46 A;  5EKI A;  4J15 A;  3FVQ A;  3CW2 C;  3QWU A;  3AEV A;  1CQF A;  3A5U A;  2ZJP A;  4L8J A;  1YNN D;  1GXD C;  4A3E G;  2L9H A;  2AHO B;  3I7F A;  3S1M H;  3CCU Z;  3AFQ A;  3QO2 A;  2EJG C;  2N88 A;  4K8J A;  3WWV A;  4KHP Q;  2PW5 A;  1QF8 A;  3G6E 1;  1E7Z A;  5IT9 b;  1ESR A;  2XIW A;  1FNU A;  2OTL Z;  1KD1 1;  4FF4 A;  3STB D;  2ASB A;  2RBL A;  4HSV A;  2JA7 I;  1CQV A;  3RN5 A;  2E2H I;  3S24 A;  1K8A C;  4UY8 C;  3CCM A;  1LTT D;  2IL8 A;  4UP8 A;  3PIO 3;  1J6Q A;  1HUM A;  2Z6K C;  4YWK A;  3KOJ A;  2FHT A;  4AYB A;  3GTJ B;  1WTH A;  5C44 I;  3J80 i;  1SMY C;  1LYL A;  1PZJ D;  1HFG A;  2SNS A;  5FLX b;  1N33 L;  1EOV A;  3DM1 A;  4NBA A;  5I9P A;  1TS3 A;  1VQ8 Z;  3J81 c;  4KI0 A;  4OEM B;  1MBY A;  1DON A;  1ICF B;  1O7Y A;  3W2D A;  5DM6 3;  1V1O A;  3FQM A;  5E1F A;  3TZD A;  3G7L A;  2I5L X;  3I2Z A;  4L6T B;  1DCZ A;  2KOL A;  5IOD A;  1N2F A;  3HOY I;  4GN4 B;  1X3G A;  3BZK A;  2DE5 A;  3E5S A;  4FO2 A;  4RV9 A;  2JA5 H;  5CV8 A;  1H9M A;  3SR1 A;  4E2X A;  4DK0 A;  2AMC B;  3LX0 A;  3DMU A;  1F2Y A;  2C5C A;  4JI2 L;  4RHS A;  4ZYS A;  3IKJ A;  2AKW B;  5IOC A;  1JT8 A;  1Z6H A;  1ENA A;  1I50 H;  1TWA I;  5GRO A;  4NBB A;  4PMW A;  2JA6 H;  4A3L H;  1YIT Z;  2IZ3 A;  5D65 A;  3CPW Y;  5JVG 3;  3CC4 A;  1JE5 A;  3VR5 A;  3BVG A;  1HNZ Q;  1SSO A;  2BDN A;  1K0R A;  2B63 B;  1I94 L;  4B9X A;  1C8C A;  2ZJR A;  3CC7 1;  4JYA L;  2WB1 B;  1I3Q I;  3LGJ A;  3FKI H;  1IKM A;  1O7Z A;  1LTL A;  3CHB D;  3JAM L;  1HZC A;  1U4R A;  4QTT A;  1W2B Y;  2NVX I;  1HZB A;  2XTI A;  1LAB A;  3CQZ H;  2G9D A;  4X62 L;  1RO0 A;  3FP9 A;  2P28 A;  3NP8 A;  2HCI A;  5JJZ A;  3OTO Q;  2QA4 Z;  1HQR D;  1GUS A;  1E22 A;  4KY6 A;  1D5X C;  2HHH L;  1UE6 A;  3RD4 A;  4RGM A;  1I4Q A;  2JJQ A;  5DAU A;  3CMA 1;  4K2L A;  2KEC A;  1KD1 2;  4YWL A;  2NVQ I;  1EWC A;  4CDC C;  2M6N A;  3H3V H;  4DV1 Q;  2L55 A;  2JS4 A;  3R3O A;  3CCU A;  4PV1 C;  5JEA H;  5LMN Q;  1SYG A;  3F8T A;  1G6P A;  2RBM A;  1N36 Q;  3S2H I;  1EU3 A;  1XNR Q;  1JCK B;  4JBK A;  4X66 Q;  4OO1 G;  3MXG A;  1E3P A;  1IBK Q;  4JI5 L;  3C3L A;  1QVF Y;  2VL6 A;  4A3E I;  5IGG A;  5IGF A;  5T1G A;  3CCS Z;  5C6A A;  1I4X A;  4BBR H;  1PZI D;  4A3M G;  1TFI A;  1IW7 D;  5I2X A;  4NB8 A;  2X6G A;  4TNU A;  5FO9 B;  3RZO H;  4DUY L;  2E7Z A;  2K52 A;  1Y1W H;  4HSP A;  2G5D A;  1B7Y B;  3KYH C;  3I4N H;  3X3N A;  1E1T A;  4P74 A;  4DV0 Q;  4DV7 Q;  2X69 A;  2IX3 A;  1VQ8 A;  2BH8 A;  5I2Y A;  2L12 A;  3QOL A;  3P1H A;  4MHE A;  2Q8I B;  2PI2 A;  2JIR A;  3NUC A;  1TWF I;  3J81 E;  1AH9 A;  1PRT F;  3J7A V;  1ZB9 A;  1X9N A;  5IYB G;  3KIH A;  4HED A;  3AQQ A;  1MSH A;  3I56 Z;  2JSO A;  3OMC A;  3HKZ G;  4ZK9 B;  4E2Y A;  1EFW A;  3TRE A;  1SBB B;  5FO7 B;  1XXG A;  4CDE C;  1GJX A;  4BY7 H;  2R7Z I;  1T5X D;  1EFI D;  3TDQ A;  5FLM G;  1SEB D;  3IR7 A;  3KBX A;  3H0G G;  3K58 A;  4X6A I;  1AP0 A;  4HCE A;  3OYY A;  2Z6K A;  3W1B A;  2QIL A;  1YJW Z;  1TWG B;  2RDG A;  2RQX A;  4Y7N H;  2I5H A;  3A7A B;  2WAC A;  1VQM 1;  4LFA L;  1BCP C;  2VQF L;  1MJC A;  3CCQ Z;  3PMF A;  3BU2 A;  5IE8 A;  4R4T A;  5CV7 A;  1VMP A;  4GNX B;  1KDC A;  4E33 A;  3K7A I;  4YHH Q;  3ND8 A;  1S4Z A;  3IF8 A;  3VTN A;  2OQ0 A;  1YJN 1;  3JAM c;  2K75 A;  2WKC A;  3GTG I;  1T9H A;  4GN5 A;  4B3S L;  4HCS A;  5EJW A;  1R4P B;  1BBX C;  1EY9 A;  3KIF A;  2WII B;  3VDY A;  4ME5 A;  2O5I C;  1ZB8 A;  3F3F C;  1EY0 A;  1YHQ 1;  3Q23 A;  5CYU A;  4LUO A;  4BBS B;  3S1Q I;  4C3J H;  2IT1 A;  4R4I A;  4XQN A;  4UP9 A;  4LF5 L;  3CCV 1;  1RTO A;  1F2M A;  1VMC A; 
#chains in the Genus database with same CATH homology
 4Y52 H;  4GNX C;  4X64 L;  2D0P A;  3KJO A;  3F2C A;  2I5M X;  2UXB Q;  1JJ2 Y;  2IHF A;  3B6Y A;  4DV3 L;  2KCT A;  1R9T H;  2PNH A;  5M3M H;  1JWH C;  4A3C H;  4OO1 I;  4QQB X;  3PO2 H;  4ALP A;  1M1K 1;  1N32 L;  4NBF A;  1VQ4 Z;  2ATW A;  2E2J I;  2OTJ Z;  1Z9F A;  2K3R A;  5D1P A;  4OXP A;  4HGY A;  2N78 A;  3I56 A;  2QLV B;  2J6A A;  1D7Q A;  4NPS A;  4IFD G;  1IZ6 A;  3NH5 A;  5DLQ E;  4PZ7 A;  3T1H Q;  1VQC A;  2JQO A;  1RNI A;  2UUB L;  3S17 H;  3CP0 A;  4EX5 A;  2Z0S A;  1YJW A;  2B63 G;  5C4J I;  1JJG A;  1CKN B;  2HQL A;  1J5E L;  5FLM I;  2NVT H;  4LFB Q;  3H0G I;  2BH2 A;  3STB C;  2WFW A;  1XMO L;  3M9B A;  1QVG Z;  4JI6 Q;  1U5K A;  1SMX A;  4HJA A;  4QTU A;  3RZD I;  4X65 L;  3CCL 1;  3HOX I;  5IP9 H;  4LFC Q;  2VZA A;  3CXC Z;  1VQ6 Z;  4A3B I;  1FL0 A;  3S1N H;  4A76 A;  3D6W A;  1M1K 2;  3CD6 A;  2V1C C;  2Y0S E;  4IJH A;  2DE7 A;  1ML8 A;  4DR6 Q;  2UXC Q;  3M3Y H;  4MD8 A;  4DUZ Q;  2JMO A;  5IYD H;  1VQ4 A;  1YBY A;  4P72 A;  1P16 A;  1UE5 A;  1VQP Z;  2G2K A;  3VMG A;  1SR3 A;  5JJK A;  3ULL A;  3UE0 A;  1YJ9 A;  1YUA A;  1IXR A;  4HH4 A;  5H1S E;  3GTQ H;  4JCV E;  2ZAE B;  2LSS A;  3TE5 B;  4A3D H;  2NN6 G;  3PV0 A;  1L1O B;  2DGY A;  3M85 A;  4A3G I;  1KRT A;  1VQ7 1;  2PK7 A;  2YTX A;  3LUS A;  2F4V Q;  2MO1 A;  1X3W A;  1QVG A;  1NTG A;  4LF7 Q;  2YTV A;  1X0T A;  3IFU A;  2UUA L;  5GAG C;  4IPD A;  3PUW A;  4PZ8 A;  4TVA B;  5BR8 L;  4BY1 H;  4BBS G;  1VQL Z;  2GN5 A;  2JUB A;  1PYS B;  2K5R A;  3CCE A;  2OZK A;  4EWC A;  1VCI A;  2ZM6 L;  3PO3 G;  2RHS B;  3EER A;  1DGS A;  5HGQ A;  4K0K Q;  3J80 c;  1EIF A;  3VB9 A;  3S16 I;  3J80 f;  4DV2 Q;  3HOV H;  1PH6 A;  4RMF A;  5IP7 G;  1O7I A;  1HNW L;  1XPO A;  1Q7Y C;  1SFO H;  1VQD A;  1OXX K;  5M3F G;  5T67 A;  3PUX A;  4YCW A;  5LMN L;  4AQY Q;  4DAM A;  1KC8 1;  1VQP A;  1Z47 A;  3T1Y Q;  2YU9 H;  4X66 L;  2PQA B;  1CKN A;  5IT9 f;  2M48 A;  1YHB A;  3CCM Z;  5IYC G;  4WJ3 M;  2PM9 A;  2PMZ A;  3NDJ A;  4IOC A;  1VQN A;  3BG1 B;  2ID0 A;  4DV6 L;  3I07 A;  2JA7 H;  4DR7 L;  4B3M Q;  5FLX c;  4DKA C;  2K4K A;  3CCU 1;  5FLX f;  4IFD J;  5C4X I;  4UP7 A;  3RLO A;  3GDE A;  2VQE Q;  5D1O A;  4A93 G;  2KPI A;  3MZL B;  2OTL 1;  2LIY A;  3KLW A;  2NN6 I;  1MIU A;  2UXD L;  2IX0 A;  4E32 A;  2JE6 I;  4IO9 A;  1TWG I;  2VUM G;  3H15 A;  3I4M G;  4OWW B;  4IOA A;  1C7Y A;  4UPA A;  1VQF A;  1VQL A;  3CC4 Z;  3HOZ G;  1VQ8 1;  4A3I H;  4BA2 I;  1Q86 1;  5LL6 f;  1YI2 Z;  1TWA H;  4GKJ L;  3G71 Z;  4NXN Q;  4R4Q A;  1KRS A;  1XTD A;  1NMG A;  1JJC B;  2WAQ E;  4DV5 Q;  3PO3 I;  2YAD A;  3PUZ A;  1I3Q H;  1KC8 2;  1YIT 1;  1VQG A;  1XNQ Q;  2IHE A;  3S14 H;  1NJI 1;  1WJJ A;  2W04 A;  1VLA A;  2LFU A;  2JA8 I;  1MKH A;  1IBL L;  1HZ9 A;  2HIX A;  3J7A 5;  3G4S A;  1PH9 A;  4CL1 A;  4QL5 A;  1SE8 A;  4XIG S;  4DAY B;  2JA9 A;  4DR4 L;  3P5J B;  1L1O A;  1B8A A;  3CCR A;  3MXN B;  4GOP C;  4OX9 L;  3GTP I;  1HNX L;  2QA4 1;  2VY3 A;  3S2H H;  3TQY A;  1KIX A;  2R93 I;  4LW1 A;  4PG3 A;  3GD7 A;  1I6H I;  4NBG A;  4GLV B;  2LXJ A;  1GO3 E;  4GN3 B;  5FJ8 H;  2JA5 G;  1NUI A;  4JI7 L;  2MO0 A;  2R92 G;  2N49 A;  3CME Z;  1WCM I;  3UE1 A;  1IBM Q;  3GTM I;  4POG A;  3K80 C;  3TDH B;  4B3R L;  1IYJ B;  2AKL A;  4A3L G;  3CCS 1;  4OWX B;  1Q86 2;  1KD1 C;  1TWF H;  3GTO I;  3JC6 6;  4NB3 A;  4POF A;  4A75 A;  4MD9 A;  1XPR A;  3FKI G;  4DK6 C;  2VUM I;  4JG2 A;  3I4M I;  2ALY B;  2R7Z H;  2JNY A;  4DGL A;  1YI2 A;  1PVO A;  4JV5 L;  1OXV A;  2OWO A;  4LFB L;  3G71 A;  4C2M H;  3I56 1;  2V8K A;  1FJG L;  1NJI 2;  1Y1V G;  1LQL A;  4HID A;  2E8G A;  4JI4 Q;  4DR2 L;  1BBU A;  4GS3 A;  1HR0 W;  2UUC Q;  4YWM A;  3K7A H;  5CM2 M;  1SRO A;  1YJW 1;  1HH2 P;  5AJ3 L;  1P8L A;  4RVG A;  3NEN A;  4BBR G;  3CCQ 1;  3S1M I;  3NBH B;  2RF4 A;  1Y1W G;  3NFZ A;  3I4N G;  1E1O A;  3I55 A;  2YTY A;  1QVG Y;  4AYB E;  1PH1 A;  3RLN A;  2CWP A;  3HKZ A;  1RL2 A;  1XJV A;  3CC2 Z;  4HJ8 A;  2GVB A;  4FDB A;  3U4Z A;  4GLX A;  3CME A;  2WP8 J;  4BY7 G;  2KI7 B;  3CXC Y;  4LF8 L;  2NZH A;  1W3S A;  1TWC I;  4B3T L;  4XX2 A;  2JA5 I;  1HR0 L;  2E2J H;  4JOI C;  2R92 I;  3G48 A;  4LWC A;  1Y14 B;  2K5N A;  1VQ5 Z;  1X55 A;  4JI0 L;  2MQH A;  1KXL A;  2GU2 A;  1VQ4 1;  4R1J A;  2OCE A;  3W5O A;  3PUV A;  2OTJ 1;  1K73 1;  5LMU Q;  3PUY A;  2CQO A;  1CUK A;  3AFP A;  3GTK I;  4P71 A;  3CF5 A;  1VQE A;  3KF6 B;  5A2Q b;  4JI8 Q;  4DR1 L;  3SGI A;  2FXQ A;  1AE3 A;  2O53 A;  4A3J H;  3G6E A;  4A3K H;  2AWO A;  1VQI A;  2GVA A;  4IPG A;  1YHA A;  1Y1V I;  3T4N B;  5IWA L;  2IZ4 A;  3H3V I;  1PFT A;  2UU9 Q;  2ZTE A;  3CPF A;  4DV4 Q;  1DL6 A;  1B70 B;  5M3M G;  2CKZ B;  3UDX A;  4A3C G;  3PO2 G;  3CD6 Z;  3L0O A;  3HOX H;  1UE7 A;  3KF8 B;  4JI3 Q;  4A3B H;  4BBR I;  3NH8 A;  3GCF A;  3PIP A;  3OW2 A;  3CC2 A;  1Z03 A;  3I4N I;  2PI2 E;  4AQY L;  4A3M I;  4QGU A;  2NVY I;  1VQ6 1;  1WFQ A;  1EUJ A;  2K5H A;  4RVF A;  2IY5 B;  1N34 L;  5GAE C;  3HOW G;  1N33 Q;  2WB1 A;  1YJ9 Z;  1U0L A;  3KJP A;  1KQS Z;  2A19 A;  1CSP A;  1K73 2;  1VQ5 A;  1Z01 A;  1NBW A;  2Y0S G;  2Q2U A;  1QZG A;  4DR5 L;  2E5L L;  2Q2T A;  1K83 H;  4P75 A;  3AYH B;  4A3F G;  1VQP 1;  2WB1 G;  4YY3 L;  1M1K C;  4JI2 Q;  3RNU A;  1QYP A;  4Y7N I;  4LF6 L;  2VUG A;  3CMA A;  4A3G H;  2OOX B;  1PV4 A;  1YZ6 A;  4MNO A;  4HIO A;  1I94 Q;  4JYA Q;  1N9W A;  5IP9 G;  4JBJ A;  3S1R I;  1USP B;  4JOI A;  1K8G A;  3CCE Z;  3K7U C;  4HIM A;  3RR5 A;  3H3V J;  2BA1 A;  4HJ5 A;  3TRZ A;  5JEA J;  4X62 Q;  4LUV A;  3HOU H;  3TS2 A;  4AH6 A;  4MON A;  1XMQ Q;  1RIP A;  2HHH Q;  4AIM A;  1M90 2;  1TWH H;  5C3E H;  1X3Z A;  2R6G A;  4LF9 Q;  4IPC A;  1OTC A;  5IYD G;  2XGT A;  1VQL 1;  3S16 H;  1YUK A;  1WOC A;  3PO2 I;  2QEX Z;  3S15 I;  3GTJ I;  3PCO B;  4KHP L;  4E30 A;  1YEZ A;  1V43 A;  3BG0 B;  3U50 C;  3TS0 A;  4A3D G;  1QUQ B;  3PF4 A;  1KQS A;  3BJU A;  4GNX A;  1VQN Z;  1ASY A;  3CCJ Z;  3Q8D A;  4H02 A;  3KDF B;  3HOW I;  1EQR A;  2AWN A;  1BVS A;  3M4O H;  4IFD I;  3S17 I;  1V9P A;  1LUZ A;  4DK1 A;  1Q8K A;  5JJI A;  2NVT I;  5LMN W;  1VQ9 Z;  4R4C A;  3CCM 1;  2B63 I;  5C4X H;  3NH4 A;  2HU9 A;  4A3F I;  1VQA A;  2ZTD A;  2IX1 A;  4LFA Q;  3NEL A;  2VQF Q;  4NXM Q;  2K5V A;  1HNZ L;  1CKM A;  1QVF A;  1YIJ Z;  1N8R 1;  1NP6 A;  1UE1 A;  1YVC A;  1H95 A;  2OQK A;  1CKO A;  1X6O A;  5T64 A;  1TXY A;  2DUD A;  3IRB A;  1G29 1;  5IP9 I;  2VNU D;  3DLL A;  1QVC A;  3S1N I;  1EWI A;  2GTI A;  4LF5 Q;  3OTO L;  2E2I I;  4LF4 Q;  3CC4 1;  2F3I A;  3M3Y I;  2E9H A;  4DV1 L;  4X64 Q;  3ULP A;  3PO3 H;  2QEX A;  1YI2 1;  3G4S Z;  1A63 A;  1N36 L;  1XNR L;  3G71 1;  4DV3 Q;  5IT9 c;  1IBK L;  3CCR Z;  1VQH A;  1GD7 A;  2JA8 H;  4E2Z A;  1N32 Q;  2JA7 G;  4BXX G;  2Q51 A;  5HY6 A;  1GM5 A;  1JMC A;  3E9I A;  3CCJ A;  4DV0 L;  2RPR A;  1K9M 1;  4DV7 L;  2E2H H;  5JJL A;  1OXS C;  3M4Q A;  5C44 H;  2BJO A;  2R93 H;  2Q4Z A;  1Q81 2;  1Q82 2;  1UWV A;  1K3R A;  4O0A A;  1AE2 A;  2VW9 A;  2F52 A;  1VQ9 A;  1D8L A;  2RT9 A;  3PGZ A;  1KC8 C;  1YNX A;  4A3I G;  1N8R 2;  1HZA A;  1WCM H;  3GTM H;  1J5E Q;  3CCL A;  3HOY H;  4DK3 C;  2H5X A;  1YIJ A;  3OW2 Y;  4PZ6 A;  1XMO Q;  3GTO H;  3CME 1;  3EN2 A;  5LMU L;  1UEB A;  4HJ7 A;  4BBS I;  1S72 Z;  3K0X A;  4DPG A;  1VQK Z;  4YHH L;  4GOP B;  3VMI A;  1LM0 A;  4JI1 Q;  4X65 Q;  4JI8 L;  1GKH A;  2Q2I A;  1WYD A;  3ER0 A;  2NZO A;  1ZH1 A;  1K8A 1;  1X54 A;  4YCV A;  2NVX H;  1GVP A;  1FGU A;  5IP7 I;  2QR1 B;  2JR6 A;  2LXK A;  2VF1 A;  2UU9 L;  3I4O A;  4DQY B;  1Q86 C;  4L5R C;  1PH2 A;  2NVQ H;  5C0X J;  2YU9 I;  3ICE A;  1K9M 2;  3NEM A;  2UXB L;  4C3H H;  3I55 Z;  3GTL I;  2PMZ E;  3MEF A;  4GKK Q;  1WW9 A;  4JI3 L;  5FJ8 G;  1VQ7 A;  1E24 A;  3J81 j;  2A1A A;  3U4V A;  2R7D A;  4A3E H;  2RHB A;  1PHJ A;  4BXX I;  1NJI C;  1VQO Z;  4KHZ A;  1RLY A;  2JEA I;  2JA6 G;  3J7A 4;  4RVD A;  4E31 A;  1A62 A;  2V8J A;  4A93 I;  4NBE A;  3J81 f;  5M5X H;  3T1H L;  2R7Z G;  4MRI A;  3CC2 1;  1VQJ A;  4AYB G;  1TWC H;  1PYB A;  3PSI A;  2R92 H;  4A3I I;  4TQU S;  2A8V A;  2UUA Q;  4LUZ A;  4X6A H;  1S72 A;  5BR8 Q;  3HOZ I;  1K8A 2;  1VQK A;  5ELO A;  3S2D I;  4JI6 L;  2VS1 A;  3E9H A;  2PQA A;  2CWA A;  1VQ5 1;  2ZM6 Q;  1L0W A;  4KLK A;  1KHI A;  1KQS Y;  5JEA G;  3W1G A;  3GTK H;  5A2Q f;  4NBC A;  3G6E Z;  1ASZ A;  1JB7 A;  3S14 I;  3GTG H;  4LFC L;  1RQF A;  1XMQ L;  1HNW Q;  3S1Q H;  5GAD C;  1Y1V H;  4LF9 L;  4DR6 L;  4NB9 A;  2ZJQ A;  2UXC L;  3UDG A;  3OW2 Z;  4DUZ L;  2OTL A;  2K14 A;  3L2P A;  4NBH A;  4DR3 Q;  1VQO A;  5GQO A;  1PA6 A;  3CD6 1;  3J81 b;  4DV6 Q;  2GTH A;  2YYZ A;  4A3M H;  4DR7 Q;  3E0E A;  2NVY H;  3MZK B;  3A74 A;  4APV A;  4EQ5 A;  2RHQ B;  3NDI A;  4GOP A;  3D31 A;  3CC7 Z;  1I50 I;  2JA6 I;  4A3L I;  2N8N A;  2UXD Q;  4NOZ A;  4OWT B;  1EYG A;  4NH1 C;  4NBD A;  2F4V L;  2EGT A;  3ZJY C;  1FVI A;  5IYB H;  1Q12 A;  2V8I A;  2QRE B;  1YIT A;  3FKI I;  1YJ9 1;  5C4J H;  4A3J G;  3EED A;  4LF7 L;  3CMA Z;  4A3K G;  4OON A;  3ESW A;  3K81 C;  1I5F A;  5FLM H;  3CQZ I;  1VS0 A;  3H0G H;  2YV5 A;  1Z02 A;  2KHJ A;  4NXM L;  4GKJ Q;  4GLA C;  3PF5 A;  3PO3 S;  1X3E A;  3J81 i;  1L2F A;  2RIQ A;  2D62 A;  3HOX G;  3JAM f;  4YCU A;  2ZTC A;  2QA4 A;  4K0K L;  3RZD H;  3S1R H;  4A3B G;  1PH3 A;  2D0O A;  4DV2 L;  1K73 C;  4IPH A;  3BZC A;  1IBL Q;  2B3G A;  3HKZ E;  4LF4 L;  4BA1 I;  1X3F A;  4A4I A;  1M90 1;  3U58 A;  1X65 A;  3RZO I;  4DR4 Q;  2KEN A;  1Y1W I;  3CCE 1;  2EQS A;  1PH4 A;  5IY0 A;  4OX9 Q;  3CCS A;  3RN2 A;  2B29 A;  2Y0S A;  3T1Y L;  1HNX Q;  3CPW Z;  5J3B A;  1PH7 A;  2BA0 A;  4LNQ A;  3S15 H;  3GTJ H;  1SN8 A;  1A0I A;  3GTM S;  4JI7 Q;  4BY7 I;  3CC7 A;  4L5Q A;  1VQM Z;  1W2B Z;  4B3M L;  1C0A A;  2MNA A;  4B3R Q;  2QEX 1;  4IJL A;  2VQE L;  3ERS X;  1M90 C;  4E2W A;  1YJN Z;  2K50 A;  3DM3 A;  4A3G G;  1EQQ A;  2OOY B;  4L5T A;  3HOW H;  1YHQ Z;  2F4M A;  2EIF A;  3A0J A;  2H85 A;  4MXU A;  2C35 B;  3K8A A;  2JEB I;  1VQN 1;  2R6M A;  3CCV Z;  3F2D A;  4JV5 Q;  3UDF A;  1NMF A;  3CCJ 1;  4MZ9 A;  3CCQ A;  1XPU A;  2RCN A;  3HOU G;  3L7Z C;  1QVF Z;  2B63 H;  4A3J I;  4A3K I;  1OXU A;  3JAM b;  1FJG Q;  4A3F H;  3J7Z C;  2KBN A;  3HKS A;  3HFZ B;  5GAH C;  5C3E G;  4S1T A;  4NXN L;  3PIO A;  1VQ9 1;  4C3I H;  4P73 A;  3KFU A;  4DR2 Q;  1BKB A;  1PH5 A;  3VMH A;  5D1O B;  4Y52 I;  4DV5 L;  2KHI A;  4JI1 L;  3GKQ A;  1PFS A;  2KCM A;  3EBE A;  5AJ3 Q;  1XNQ L;  1Q1B A;  1A8V A;  1R9T I;  5C0X G;  1YIJ 1;  1SLJ A;  4A3C I;  1X56 A;  4JI5 Q;  2E2I H;  2I0Q A;  1QZH A;  2P3Y A;  2JK8 A;  3CPW A;  3F2B A;  4DUY Q;  2WB1 E;  2W03 A;  3JAM i;  4GKK L;  2OTJ A;  3KF6 A;  1VQM A;  1W2B A;  4HJ9 A;  2QRD B;  2L15 A;  3G4S 1;  4LF8 Q;  4B3T Q;  1YJN A;  2CFM A;  1HR0 Q;  5C4X G;  1K83 I;  1BBW A;  4QJF A;  3D0F A;  1IBM L;  1MJE A;  3CCR 1;  4RVH A;  4BY1 G;  4JI0 Q;  1YHQ A;  2QRC B;  4QY7 A;  3MON A;  1Q81 1;  1Q82 1;  3CCV A;  1VQB A;  1NY4 A;  4RS4 A;  3CCL Z;  2QKD A;  4JBM A;  3GO5 A;  1TWG H;  2N3S A;  1KRL A;  3F1Z A;  2Q2H A;  1Q7Y 1;  1JJ2 Z;  1KL9 A;  3HOV G;  2F4O A;  1RO4 A;  4B3S Q;  3IX0 A;  2DE6 A;  4DR1 Q;  2CCZ A;  1Q1E A;  3HOU I;  1Y1V S;  2I3C A;  4DNI A;  3F3P C;  1L1O C;  1TWH I;  5C3E I;  4JI4 L;  3Q87 A;  4BBS H;  5IWA Q;  3CXC A;  4RG1 A;  1VQ6 A;  1CSQ A;  2UUC L;  4MTN A;  1Q81 C;  1Q82 C;  1S40 A;  2JA8 G;  4HIK A;  2WAQ A;  1S72 1;  1C9O A;  1WII A;  1N8R C;  1VQK 1;  5C0X I;  3D9X A;  1RO2 A;  4QIW E;  5IP7 H;  1G51 A;  4NFR A;  1VQ7 Z;  2EXD A;  5T6B A;  3M4P A;  5C44 G;  3GTQ I;  5AN9 F;  2WAQ G;  5M3F H;  2ES2 A;  2R93 G;  3A5Z B;  1N34 Q;  3GTP H;  4A3D I;  1OXT A;  1IL2 A;  3GTL H;  4JBW A;  2HIV A;  4DR3 L;  2QGQ A;  3M4O I;  1USP A;  4XTC S;  1S3O A;  3RLF A;  4WJ4 A;  1WCM G;  1I6H H;  5IYC H;  3HOY G;  3FQQ A;  3I55 1;  2UUB Q;  4BXX H;  1KAW A;  4DR5 Q;  1V1Q A;  1Q7Y 2;  1Q46 A;  1S7M A;  2E5L Q;  4MH4 A;  3CAM A;  4O2D A;  3TEH B;  4YY3 Q;  2R7F A;  5M5Y H;  4BY1 I;  4LF6 Q;  1PH8 A;  5M5W H;  1JJ2 A;  1HJP A;  1EIY B;  4A93 H;  1NE3 A;  1VQO 1;  1K9M C;  5ELN A;  2MFI A;  4R4O A;  5E7N A;  2VUM H;  2HT1 A;  4MD7 A;  3I4M H;  3HOV I;  1SRU A;  4HGZ A;  3M7N A;  1QUQ A;  3EIV A;  3J80 b;  5K36 G;  3HOZ H;  4ME3 A;  5EAY A;  2HF1 A;  1WI5 A;  1SFO I;  3S2D H;  3ULJ A;  2O4H A;  4L5S A;  3UDI A;  1P9N A;  3FHW A;  3KDF A;  4JC0 A;  4DV4 L;  4J15 A;  3CW2 C;  3QWU A;  3AEV A;  3A5U A;  2ZJP A;  4A3E G;  2AHO B;  3I7F A;  3S1M H;  3CCU Z;  3AFQ A;  3WWV A;  4KHP Q;  1QF8 A;  3G6E 1;  1E7Z A;  5IT9 b;  2OTL Z;  1KD1 1;  3STB D;  2ASB A;  2RBL A;  2JA7 I;  3RN5 A;  2E2H I;  3S24 A;  1K8A C;  4UY8 C;  3CCM A;  4UP8 A;  1J6Q A;  2Z6K C;  4YWK A;  3KOJ A;  4AYB A;  5C44 I;  3J80 i;  1LYL A;  5FLX b;  1N33 L;  1EOV A;  4NBA A;  1VQ8 Z;  3J81 c;  4KI0 A;  3FQM A;  2I5L X;  3I2Z A;  1N2F A;  3HOY I;  4GN4 B;  1X3G A;  3BZK A;  2DE5 A;  4RV9 A;  2JA5 H;  4E2X A;  2AMC B;  4JI2 L;  2AKW B;  1JT8 A;  1I50 H;  1TWA I;  5GRO A;  4NBB A;  4PMW A;  2JA6 H;  4A3L H;  1YIT Z;  2IZ3 A;  3CPW Y;  3CC4 A;  1JE5 A;  1HNZ Q;  1K0R A;  1I94 L;  2ZJR A;  3CC7 1;  4JYA L;  1I3Q I;  3LGJ A;  3FKI H;  1LTL A;  1HZC A;  4QTT A;  1W2B Y;  2NVX I;  1HZB A;  2XTI A;  3CQZ H;  4X62 L;  1RO0 A;  3FP9 A;  2P28 A;  3OTO Q;  2QA4 Z;  1E22 A;  2HHH L;  1UE6 A;  2JJQ A;  3CMA 1;  4YWL A;  1KD1 2;  2NVQ I;  2M6N A;  3H3V H;  4DV1 Q;  2JS4 A;  5LMN Q;  3CCU A;  3F8T A;  1G6P A;  1N36 Q;  1XNR Q;  3S2H I;  4JBK A;  4X66 Q;  4OO1 G;  1E3P A;  1IBK Q;  4JI5 L;  1QVF Y;  2VL6 A;  4A3E I;  3CCS Z;  4BBR H;  4A3M G;  1TFI A;  4NB8 A;  4TNU A;  3RZO H;  4DUY L;  2K52 A;  1Y1W H;  1B7Y B;  3KYH C;  3I4N H;  1E1T A;  4P74 A;  4DV0 Q;  4DV7 Q;  1VQ8 A;  2BH8 A;  2PI2 A;  1TWF I;  1AH9 A;  1ZB9 A;  1X9N A;  5IYB G;  3KIH A;  3AQQ A;  3I56 Z;  3HKZ G;  4E2Y A;  1EFW A;  3TRE A;  4BY7 H;  2R7Z I;  5FLM G;  3H0G G;  4X6A I;  3OYY A;  2Z6K A;  3W1B A;  1YJW Z;  4Y7N H;  2I5H A;  1VQM 1;  4LFA L;  2VQF L;  1MJC A;  3CCQ Z;  3BU2 A;  5IE8 A;  4R4T A;  4GNX B;  4E33 A;  3K7A I;  4YHH Q;  2OQ0 A;  3IF8 A;  3VTN A;  1YJN 1;  3JAM c;  2K75 A;  3GTG I;  1T9H A;  4GN5 A;  4B3S L;  3KIF A;  3VDY A;  1ZB8 A;  3F3F C;  1YHQ 1;  4LUO A;  3S1Q I;  4C3J H;  2IT1 A;  4R4I A;  4UP9 A;  4LF5 L;  3CCV 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...