1L1OC

Structure of the human replication protein a (rpa) trimerization core
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
178
structure length
173
Chain Sequence
NTNWKTLYEVKSENLGQGDKPDYFSSVATVVYLRKENCMYQACPTQDCNKKVIDQQNGLYRCEKCDTEFPNFKYRMILSVNIADFQENQWVTCFQESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFRSFIFRVRVKVETYIKATVMDVKPVDYREYGRRLVMSIRRSALM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the RPA trimerization core and its role in the multistep DNA-binding mechanism of RPA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Replication protein A 14 kDa subunit
total genus 39
structure length 173
sequence length 178
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08646 Rep_fac-A_C Replication factor-A C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1l1oC02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1l1oC01
4QL5A 3CD6A 2R93G 1L1OB 1CKMA 4NPSA 4LFAQ 4A3GG 5C4JI 4B3SL 2QGQA 2RCNA 1WYDA 3BJUA 2KPIA 1G291 2AKWB 4JBWA 4NBHA 1Q81C 1XNQQ 2BJOA 3A5UA 1IZ6A 3STBC 4B3TQ 1A62A 1BVSA 1J5EL 3PUXA 4JC0A 1WOCA 2KENA 1VQGA 5ELNA 3CF5A 1XNQL 2GVBA 4LUVA 4A3JG 3S15H 3KF6A 2J6AA 4DR4L 1D7QA 4DR4Q 3GTQI 5C3EG 4DR2L 1UE6A 1X3GA 3HKZE 4A3II 2YYZA 4YWMA 4JI5L 1KQSA 3RZDI 3KJOA 1PA6A 3U50C 3HOUI 3RZOI 3PF4A 2E2JI 3EN2A 1PFTA 3TEHB 4DR3Q 3RN2A 5DLQE 4YY3L 3KYHC 1S72A 4LF5L 1I6HH 3M3YI 1USPB 1VQNA 4DV0L 2ALYB 2WB1E 1GKHA 4OXPA 3J7ZC 1VQIA 3S15I 2A1AA 5FLMH 1YHQA 2P3YA 4LF4Q 2Q2HA 1YIJA 5C44I 1E1TA 1NY4A 3ER0A 1PH6A 1K0RA 1PH7A 2VUMH 3VB9A 4X6AI 2MFIA 2ZTDA 2R92G 4A3BI 2CWAA 2D0PA 5M5WH 3U4ZA 1TWGI 2YTVA 2F52A 4P74A 1PHJA 3GTMH 4YCWA 3S17I 1GD7A 1C9OA 1O7IA 4A3KH 1J5EQ 4DK6C 1HZAA 1UEBA 1XMOL 3FKIH 5M5YH 3GDEA 4DR7Q 1Z9FA 4H02A 2PI2A 1QYPA 1HNWL 4GNXA 3ULLA 2R6GA 1NUIA 4IFDI 2E5LL 2R92I 1K83I 2YV5A 3FHWA 3G4SA 5M3FH 1VQMA 1QZGA 4A3CH 4KI0A 5EAYA 3S14H 1C0AA 2Z0SA 2K5RA 3I7FA 4YCUA 4JI7Q 1EWIA 4NBFA 2UXDQ 4LF8Q 2UXDL 2VY3A 1ASYA 1R9TH 3GTOI 4X65L 4JI4L 1VQAA 3OTOL 3M85A 3JAMc 3ICEA 2GVAA 2R92H 1VQBA 4BBSG 4K0KL 3CPWA 3PUVA 4R4IA 1KRTA 4BBSH 3S16I 1N32L 4NOZA 1IYJB 5C44H 1NMFA 1Q86C 1PH5A 5IYCG 1Y1WI 2OQ0A 4B3ML 4OX9Q 3AFPA 2V1CC 2L15A 4HJ9A 1HR0W 3I56A 4GKJL 1Y1VS 1LUZA 3ZJYC 4GNXB 2EIFA 4UPAA 3L7ZC 1I50I 3S1RI 4DV6Q 5HGQA 3KF6B 4IOAA 1HJPA 3UE0A 4LWCA 1L0WA 3HOWH 1BBUA 4DV3Q 1YZ6A 3H3VH 4ME3A 1OXVA 2VL6A 1OTCA 2UUBL 3UDFA 4A3CI 4A3BG 1P8LA 4BBRI 1CSPA 3HKSA 1KHIA 4JI4Q 1RL2A 3I07A 4DK3C 4JI8L 1VQPA 1K73C 4LFAL 1KC8C 4APVA 2JA7G 3HOYH 4JOIC 2JA7H 3NELA 1PYSB 1HNXQ 3ESWA 1YJ9A 1S3OA 4L5TA 2R7FA 3J81c 3CCJA 3S1MI 1WJJA 4JI0L 2HT1A 4J15A 3HOZI 2ZM6L 5IP9I 1NTGA 4DR2Q 2BA0A 2UXCQ 3H3VJ 3AQQA 2Q2UA 1AE2A 1WCMI 5M3MG 4P73A 1YJNA 3RNUA 2K5HA 2KCTA 4A3FG 1N34Q 4LF4L 4NXMQ 4GOPC 4X62Q 1PH9A 3GTKH 1SFOH 5IP9H 3KDFA 5IWAQ 5BR8L 4A3KG 4X62L 2DE6A 4EQ5A 2R7ZI 2MQHA 3MXNB 2WAQG 2K5NA 4IFDJ 1VQLA 4X65Q 4DV7L 2KCMA 4A3EG 3GTKI 1WI5A 1R9TI 3U4VA 4IOCA 1GVPA 3CCEA 1XMQQ 1V43A 3I4MG 2VNUD 4DV1L 4A3FI 5FLMG 4YHHL 3GTLI 1J6QA 4PG3A 1W3SA 4JI2L 4JI2Q 4QIWE 1HNXL 3PGZA 3I4NG 3H15A 1USPA 1TWFH 4BY7H 5M5XH 1UE5A 3M4PA 4L5QA 5J3BA 3TRZA 1CKNB 1X6OA 2HIVA 4BXXI 2NZOA 4NB3A 3PF5A 1Q8KA 1JJCB 2IHFA 1HR0L 2JA8I 3PUWA 5GQOA 3CQZH 4QQBX 4GKKL 1VLAA 1X54A 3HOVI 1WW9A 1I94L 4JBMA 4DR7L 5C4XG 2PK7A 4AQYL 3DM3A 4JV5Q 5FLMI 1I94Q 4HIKA 2NVQH 5IYBH 1PH3A 1E24A 1KIXA 1C7YA 2VQEL 1X56A 2UUBQ 2R7DA 2DGYA 2PMZE 4JG2A 3PO2I 1S40A 2JJQA 1IBMQ 1LQLA 3LUSA 4JBKA 2ASBA 4A3EH 4DUZL 4KLKA 1XPOA 3GTJI 5LMNQ 1YBYA 3M9BA 3I55A 4B3MQ 2BA1A 4X66Q 3RLNA 1PVOA 1TWAH 3OTOQ 3CXCA 4K0KQ 2DE7A 1KL9A 4GOPA 1KD1C 3KOJA 1K9MC 3M3YH 3J81j 1RO4A 3CCUA 4QTTA 1E3PA 4BY1H 4Y52H 5IP7H 4BBSI 3NENA 1L2FA 1X3FA 2NZHA 3M4QA 1MKHA 4JI1L 4DPGA 5IP7G 5AJ3L 4JYAL 2IY5B 4NBBA 1VQ7A 4A93I 2OTLA 1VQEA 2HQLA 4NBDA 1VQ9A 5M3MH 4A3JH 1ZB9A 3EERA 3OYYA 1HNZL 4GLXA 1HNZQ 1FJGL 4O0AA 5H1SE 4BA2I 3A0JA 4B3RQ 4TQUS 4A3KI 2QA4A 4GS3A 2B63G 4GLVB 4Y7NI 1X9NA 4DV2Q 4DV7Q 4IFDG 3E9IA 4LF8L 2F4OA 4NB9A 3D31A 2DE5A 3CCQA 3K80C 3T1YL 4DR1Q 2VQFQ 2JEBI 4B3TL 2NN6I 3I4OA 5GAHC 1L1OA 4A76A 4XIGS 1AE3A 2N78A 4EX5A 4A93G 5E7NA 2UUCQ 2A19A 2UUAL 4C2MH 3HOUG 3F2BA 4IO9A 2JS4A 3RZOH 1LYLA 5JJKA 4O2DA 4JI0Q 3H0GI 4LF6Q 3K7AI 2HIXA 3VMIA 4LF5Q 2UXCL 1KXLA 2LXKA 4LF7Q 3GTPH 2VUMI 4JI6Q 4NBGA 4DV0Q 4OO1I 1XPUA 1LTLA 4IPHA 3HFZB 4R4TA 3HOXI 4NXML 4NXNQ 1EIFA 3S1NI 4DR3L 4BY1G 4JI3L 1JMCA 2D62A 1VQKA 2KHJA 1EQQA 2E2IH 2IT1A 3M4OI 2AWNA 4JCVE 4LFCL 5IYCH 3PIPA 4IJHA 4A75A 4DR5L 3GTGH 1KRSA 2CFMA 3A5ZB 3PIOA 4A3IG 1N8RC 4IPDA 1JJ2A 4JI3Q 3I4MH 4A3IH 3S1QI 1VQ4A 4X66L 4UP9A 3CC4A 4X64L 3M4OH 3F8TA 3KDFB 4OWXB 3S1NH 4A3MI 2ATWA 4DV1Q 4HIMA 1CUKA 1CKOA 1UWVA 4C3HH 1YVCA 4XTCS 1B8AA 5IYBG 3CC2A 4C3IH 2F4VQ 1PV4A 5JEAG 2GN5A 3S24A 3TS0A 1YJWA 1N9WA 2JEAI 1QUQA 1BKBA 1TWHI 2DUDA 1N36L 3SGIA 1N36Q 3M7NA 3WWVA 1JJGA 2R93I 3A74A 4DNIA 1OXXK 3W1GA 5BR8Q 4A3MH 2N3SA 4R4OA 2E5LQ 1SN8A 2K75A 3MEFA 1WCMG 2YU9H 4A3GI 1A8VA 2ZJRA 3GTMS 2NVXI 2F4VL 1PH4A 1NJIC 2PI2E 1NMGA 1QZHA 3ERSX 3ULPA 3RZDH 4JI7L 4LFBL 1XMOQ 1PYBA 1VS0A 1WFQA 1MIUA 4NBEA 4PMWA 2I5HA 4JBJA 1RLYA 4X64Q 3S14I 3BZCA 3PCOB 1XMQL 3S2DH 4LW1A 1VQOA 1YI2A 2JA5I 2VZAA 3I4NI 1TWCH 4A3LG 3RR5A 4DUYL 1EUJA 5C3EI 3BU2A 4HJ8A 2OWOA 1I3QH 4PZ7A 1PH8A 4A3DI 2RF4A 3G71A 2WB1G 3CCSA 4IPGA 4DV4L 4WJ4A 4BY1I 4JYAQ 5C44G 3GKQA 4Y52I 4DV5L 4HJAA 3STBD 5IT9c 1W2BA 2JA5H 2CWPA 3NBHB 4GLAC 2I5MX 4LUZA 3HOXH 4LFCQ 4MZ9A 2OTJA 2I0QA 1EOVA 2B29A 2JA6H 3Q87A 3GTJH 4DV3L 4A3DG 3BZKA 1I50H 4POGA 4OX9L 5LMNL 1B7YB 1SROA 1FL0A 1D8LA 1OXTA 4A3GH 3HOZH 2LSSA 3E0EA 4PZ8A 3S2HI 3TS2A 3PO3I 2OQKA 3HKZG 3I2ZA 2Y0SG 3KLWA 1K3RA 4GNXC 3W1BA 4A3CG 1SFOI 1DL6A 2NN6G 4A4IA 2MNAA 3FKIG 4BBRH 3CCRA 4BY7G 1XTDA 3GTOH 4JI6L 3I4NH 2JK8A 4RMFA 4DAMA 4Y7NH 1X3WA 1YHBA 1TWAI 1VQCA 3EIVA 2AMCB 5C4XI 2K4KA 3T1HL 3T1HQ 1GM5A 1Z47A 1DGSA 1Q12A 4FDBA 1M1KC 4GN5A 3KJPA 2IX1A 1Q1BA 4OWWB 2EXDA 2AKLA 1EFWA 4WJ3M 3UDGA 1I3QI 1YEZA 5LMNW 1Y1VH 4OO1G 2OCEA 1N2FA 2MO0A 1MJCA 4GN4B 2JA5G 2E2II 2VS1A 2XGTA 4R4QA 2VQFL 1X65A 1IBLQ 1Y1WG 1IBLL 1N33L 2WFWA 1Y1VI 1VQDA 3HOWI 3J80i 3AEVA 2E2HH 4HJ7A 2UU9L 4IJLA 4OWTB 2UU9Q 3F2CA 3GTPI 4DR6L 5C3EH 1HZBA 5C0XJ 1FVIA 2AHOB 5FJ8H 2ZM6Q 1OXSC 1HZ9A 3K0XA 3E9HA 1TWCI 1U5KA 2VW9A 3DLLA 4LUOA 4DV5Q 4HJ5A 1E7ZA 4AYBG 1VQ5A 4LF6L 3D6WA 3OW2A 1Y1VG 1JB7A 4YY3Q 2FXQA 3S1MH 5IYDH 3CMEA 1UE7A 3VDYA 1VQJA 1SMXA 2K14A 3VMGA 3L2PA 4AIMA 2CCZA 1VQ6A 1IBKL 3CP0A 4R1JA 1IBKQ 4UY8C 2JA6G 3HOVG 1WCMH 1ML8A 3J80c 4JOIA 4L5SA 4AH6A 1PH1A 2B63H 2MO1A 3H3VI 1GO3E 1OXUA 2I5LX 1QUQB 4DUYQ 4HIOA 1VQ8A 3S17H 2YTYA 2ZJPA 2HF1A 4DAYB 3HOYI 3CCVA 1G51A 1YITA 1XNRQ 3PO2H 2JA9A 2K50A 4C3JH 1A0IA 3GTGI 1P16A 4NBCA 2IX0A 5FJ8G 2Q2TA 3J7A5 3PO3H 4JV5L 2B63I 2YU9I 3IRBA 4P75A 5ELOA 2ID0A 1YNXA 2R7ZG 1XNRL 4DR1L 2ES2A 4MNOA 1Y1WH 1CKNA 3CC7A 4OONA 1M90C 4NBAA 4A3DH 1VQFA 1ASZA 1PFSA 2NVYH 4BA1I 2WP8J 5IP7I 1IL2A 1QVGA 3HOYG 2CKZB 4LF9L 2N49A 1KAWA 1SE8A 5C4XH 1IXRA 1FGUA 4YWKA 5IE8A 4HIDA 5LMUQ 3PUYA 4LFBQ 1BBWA 1Q82C 3CW2C 4A3LI 1UE1A 4KHZA 2KBNA 2NVQI 1CSQA 1X55A 4A3JI 2JA8G 3GTLH 3H0GH 3J81i 5LMUL 4LNQA 2JR6A 2NVYI 2JA7I 1HH2P 2Z6KC 5GAEC 1FJGQ 3HOWG 2E2HI 1TXYA 4B3RL 4KHPL 3TREA 4R4CA 4BBRG 2NVXH 4YWLA 3HOUH 4GOPB 1PH2A 5IWAL 1V9PA 3UE1A 2A8VA 3S2HH 4NXNL 3RN5A 5AJ3Q 1Q1EA 4QGUA 2RHQB 1SRUA 4DV6L 4LF7L 2ZTEA 2NVTI 3G48A 3JC66 5JEAJ 3GCFA 4DKAC 4B3SQ 2UXBL 4DV2L 1G6PA 4QTUA 2D0OA 4P72A 3CQZI 3CPFA 3GTMI 1QVFA 3HOZG 3S1QH 3K7AH 5K36G 1AH9A 3PV0A 2JA6I 5IYDG 2ZJQA 4AYBE 4YCVA 4A3BH 2PNHA 3LGJA 5GROA 5GADC 4PZ6A 3HOXG 2UUCL 4A3MG 1X3EA 4LF9Q 1K8GA 2NVTH 2VUMG 5FLXc 2R7ZH 2JE6I 3Q8DA 2Y0SE 3U58A 4DR6Q 3PO3S 2EQSA 2K5VA 2Z6KA 5C0XI 3CMAA 4MH4A 3W5OA 2RHSB 3RLOA 1XJVA 1HR0Q 2E8GA 2UUAQ 1N33Q 5JJLA 3S16H 1K83H 5IP9G 2WAQE 1TWHH 3I4MI 2KHIA 3UDXA 3F1ZA 2JNYA 1E22A 3PO3G 2Q2IA 1H95A 1VQHA 5GAGC 2H5XA 4POFA 5M3FG 1EYGA 4GKKQ 1N34L 5JJIA 1TWFI 4BY7I 4A3LH 1IBML 4A93H 2UXBQ 4P71A 1LM0A 1TFIA 4UP7A 2HHHL 1Q46A 4DR5Q 1K8AC 1RIPA 4BXXG 4QJFA 3CCMA 3HOVH 3ULJA 4YHHQ 1NBWA 3PSIA 2CQOA 2AWOA 4GKJQ 2JQOA 2BH2A 3GTQH 4JI1Q 2N8NA 2C35B 5C4JH 4QY7A 2R93H 3VMHA 1YHAA 2K52A 3F2DA 3AFQA 1HNWQ 2E2JH 1V1QA 1VCIA 4DV4Q 3S1RH 2PQAA 3K81C 2JA8H 2RBLA 4A3EI 3FP9A 2BH8A 4MTNA 1I5FA 3UDIA 3G6EA 1T9HA 1MJEA 4BXXH 3K7UC 3H0GG 2PQAB 1E1OA 4UP8A 3S2DI 3CCLA 2QEXA 3KF8B 1A63A 3L0OA 3D0FA 3PUZA 1QVCA 3EBEA 4JI8Q 5IY0A 4AQYQ 1HZCA 2B3GA 3B6YA 5HY6A 2VQEQ 1JT8A 3T1YQ 1ZB8A 3K8AA 3JAMi 2HHHQ 2IHEA 1SR3A 4NB8A 1I6HI 1X3ZA 4TVAB 4ALPA 3TQYA 2LXJA 1L1OC 1YUAA 4GN3B 3GD7A 4RG1A 1Q7YC 3KFUA 1N32Q 1B70B 3FKII 2YTXA 3RLFA 2F3IA 3NEMA 5C0XG 4DUZQ 1EIYB 5CM2M 1XPRA 1SLJA 4L5RC 4KHPQ 1EQRA 3AYHB 1U0LA 4JI5Q 1Y14B 4XX2A 2XTIA 2F4MA 3CAMA 4A3FH 1JE5A 1TWGH 3PO2G 4IPCA 1NE3A 4X6AH 3GO5A 2ZTCA
chains in the Genus database with same CATH superfamily
4IURA 2K3RA 1HTPA 1L1OB 4LFAQ 2E9HA 3KLSA 3GQBA 4B3SL 4PQXA 2RCNA 2Q8IB 2SDFA 1QCBD 3K5OA 2K5QA 3A5UA 4KV6A 2MJ8A 2Z9HA 4IALA 1J5EL 4MHEA 2JIPA 5ELNA 3CF5A 1F9SA 1L0YB 3P7JA 4DR4L 3HOUB 1X3GA 3HKZE 4JI5L 1BQQT 5FO7B 1PA6A 2QA41 3CC2Z 3PF4A 3EN2A 3TEHB 3RN2A 1S72A 2KEEA 1SE4A 3M3YI 1Z6HA 3CCJZ 2F0SA 3W2DA 3J7ZC 5FLMH 2QKIC 1WTXA 3P5JB 2I46A 5C44I 1E1TA 3W3AA 1PH7A 3VB9A 3GP7A 2MFIA 2CWAA 5L37A 2YTVA 3GTMH 2F0PA 1C4QA 3QR8A 3A8JE 4CDDC 1J5EQ 4LJZC 4DK6C 3FDTA 4ZK9B 1D5ZC 5M5YH 3EVQA 4DR7Q 1RTNA 3A54A 1HNWL 4GNXA 4IUQA 5M3MB 2MPMA 1NUIA 1VQO1 1CHQD 4IFDI 3VR4A 2LFNA 1IW7C 4ID6A 2N88A 3S14H 4K2KA 2Z0SA 5CV5A 1VQOZ 4NBFA 2UXDQ 1HPCA 4ODGA 1SYFA 4X65L 4BBSG 2GVAA 2SOBA 3CPWA 3BYYB 4R4IA 2Z4HA 3S16I 2F0IA 1NMFA 3VYSA 1PH5A 2X69A 2OQ0A 2X6GA 1U4PA 4OX9Q 1NR2A 1VQ7Z 3I90A 1HR0W 2AQ1B 5C3EB 4GKJL 1Y1VS 3ZJYC 1SNCA 4GNXB 1I4QA 1Y8NB 5HGQA 5J22A 5C4JB 2OTL1 3FPUB 3HOWH 3P1HA 1PLFA 4MD8A 2F0LA 4MIUA 1OXVA 2VPYA 1SE2A 3UDFA 1P8LA 1CSPA 1F2MA 1KHIA 2DN8A 1JWHC 4DK3C 1K73C 1AZPA 4LFAL 2JA7G 1E2VA 4ULLA 1MSHA 1HNXQ 3S1MI 2HT1A 2UXCQ 3CCSZ 1WCMI 3A7LA 3IFTA 1N8R2 4J6HA 2K5HA 3I56Z 4LK1C 4A3FG 3GTKH 1YNJD 1QB5D 2K5WA 1SFOH 4EVOA 2VB3X 4A3GB 2E75C 2Q51A 1SBBB 1J8IA 4IFDJ 4RWSC 4OGQC 2GU2A 4A3EG 3GTKI 2JA7B 3FQQA 1R9TI 1B44D 5FLMG 1V1PB 3G711 4PNYA 4JI2L 4HGYA 3WDNA 3NDJA 3IX0A 1HNXL 1USPA 4E2ZA 4HN7A 3S2HB 3S9WA 1CKNB 2HIVA 4S3SA 5FLXf 3G4SZ 1JJCB 1QNUA 2OEOA 3CRKC 1X54A 1I94L 4JBMA 4DR7L 1STYA 2PK7A 4AQYL 4JV5Q 1AEXA 3G4S1 1E24A 2L55A 2VQEL 1S40A 1U4MA 4KLKA 5LMNQ 2BOSA 3M9BA 3DEOA 3D6CA 4X3KA 4LMQD 4IZ8A 3BG0B 1PVOA 1TWAH 4V0BA 4A93B 1Y8PB 5DM73 4CDFC 1LLRD 3TDHB 4WRDA 3M3YH 2J0TD 1E2WA 1K9MC 1E3PA 2F0MA 1SYEA 2EVBA 1L2FA 1X3FA 3M4QA 3PMFA 1MKHA 4JI1L 4DPGA 5IP7G 4JYAL 2K32A 3HS0C 1VQ7A 4A93I 3A56A 2OTLA 1VQEA 1K83B 4NBDA 1VQ9A 3S1NB 3OYYA 3VR2A 4GLXA 1WTPA 4O0AA 3A0JA 5C6AA 4A3KI 1PDQA 3E9IA 2F4OA 1T5EA 3D31A 2DE5A 3NSWA 4DR1Q 2L12A 1SXTA 2SNSA 1AFPA 1Z01A 3DEPA 1L1OA 3I4OA 4A93G 2QKDA 1Q7Y1 2N78A 1H9RA 2VUMB 1WVLA 1SYBA 4C2MH 2QDBA 1SJED 4FF2A 4O2DA 2UXCL 3F2UA 3VMIA 4LF5Q 5FKAC 1I6HB 4DV0Q 3H0GB 1XPUA 4C3HG 1K9M2 4R4TA 4NXNQ 3HOXI 2VPWA 3CC4Z 1EIFA 4DR3L 4BY1G 1Y1VB 1JMCA 2D62A 2K1BA 1VQKA 3M4OI 4LFCL 3K59A 5FO9B 4DR5L 1UAPA 1KRSA 4A3IH 1PZKD 2QEJC 2AYDA 4X64L 3M4OH 5BN3A 3KDFB 4A3MI 2LMCB 4U673 1UWVA 1B3AA 1YVCA 4CDCC 5IYBG 3CC2A 4C3IH 1EWCA 3NTIA 2GN5A 4JPBW 1N9WA 5D14A 3SGIA 3WWVA 1YNJC 2PQEA 5BN4A 3A74A 4HEDA 1OXXK 3IAYA 4MD9A 2E5LQ 2K75A 2WKCA 4QUCA 2QF7A 1A8VA 3GTMS 2F4VL 2PI2E 5A2Qb 1RKNA 1VQLZ 3CCEZ 1ENFA 1PYBA 1MIUA 4PMWA 2JA5B 4X64Q 3P20A 3S2DH 1VQOA 4DUYL 1VQL1 5C3EI 5KYLA 4HJ8A 3I73A 1I3QH 5HGTA 5IT9E 3HRZC 3CMAZ 1KLUD 2WB1G 2IWHA 3L3OC 5C0XH 3IL8A 2CH4W 4JYAQ 4WJ4A 3GKQA 4BY7B 3CPWY 2A69D 2KEDA 3NBHB 4MZ9A 2OTJA 1XTCD 3Q87A 4OELB 3LNNA 4ZLTF 2E2DC 4POGA 1SAPA 1G8ZD 3QIAA 3HOZH 3TS2A 3NWTA 3HKZG 1F77A 2DJFC 3TN2A 1A3UA 4A3CG 2BDNA 2RVLA 3CCRA 1TWHB 4BY7G 1FNVA 3GTOH 4JI6L 3I4NH 4RMFA 1Y8OB 4G57A 5KIXA 4Y7NH 1X3WA 3OHXC 1HFGA 1YHBA 3EIVA 2EYOA 3E5SA 3T1HL 2A74C 3MZ5A 1CA6A 2I3CA 3KJPA 2IX1A 4KY5A 3CCQZ 5KGUA 1CZGA 4TSSA 4OWWB 2B2YA 2EXDA 3UDGA 4OO1G 3NH5A 1N2FA 1BR9A 4GN4B 3VYRA 2VS1A 5C3WA 1K9M1 1D5MC 2FINB 3AB9A 4CJ1B 3V96A 1Y1WG 1IBLQ 5NUCA 2R6MA 1VQDA 4KY7A 2UU9Q 3K5LA 3UI2A 2N55A 1STGA 1H9MA 1HZBA 1FVIA 2HCIA 1OXSC 3E9HA 2XN9C 3ZYYX 4C56C 4HJ5A 1E7ZA 3GTLB 4AYBG 1B9NA 1JB7A 4YY3Q 2FXQA 4CKCA 1YJ9Z 1STHA 1YHQ1 4R1JA 2RDGA 5I4DA 1IBKQ 2JA6G 3N6RA 1ESFA 2OOXB 3T56B 1PH1A 4MTKA 1SNDA 1SNOA 1Y1WB 2I5LX 1W6JA 4HIOA 2ZJPA 2Y0SB 2WIIB 3SR1A 3PO2H 2JA9A 2K50A 3KBXA 1A0IA 3FKIB 4C3JH 5FJ8G 3TP8A 4JV5L 5CV8A 4C3HB 2ID0A 2VB2X 5CV9A 1CKNA 4OONA 5M5WB 3OPOA 1ASZA 1HUMA 1IL2A 1QVGA 2CKZB 5D1OB 5IE8A 2NVQB 3BG3A 1A3VA 3CD6Z 4A3LI 4KHZA 2NVQI 1QWYA 5G3LF 1LT6D 1PRTC 1ESRA 3GTLH 2G9HD 4DA2A 4LNQA 2JR6A 2RT9A 2O4XA 1HH2P 4R8IA 3HOWG 4B9WA 4F87A 4BXXG 4B3RL 4KHPL 3TREA 4R4CA 1EYCA 4TNUA 3DWQA 1CHPD 1KDBA 5EPJA 1VQ41 3HGBA 3DMUA 5IWAL 2E2HB 3BDCA 1Q1EA 4X3UA 4XXEA 5T1GA 1O80A 4LF7L 3I55Z 3G48A 2BCOA 2XRSD 4B3SQ 3J7AF 2UXBL 4XYQA 3HOZG 2IPKD 2A68D 1VQ4Z 3VR5A 4ME5A 4A3BH 2UUCL 5GROA 5GADC 4RS4A 1QVFZ 3OMGA 1X3EA 4A3MG 2VUMG 3I551 1HTLD 1GUWA 1Q861 1TVXA 4CHTB 3PO3S 1EIGA 1DYQA 2Z6KA 4NKLA 5C0XI 4Y7NB 2RHSB 1HR0Q 5J1ZA 4DXFA 2B2UC 2WAQE 1TWHH 3PO3G 3F1ZA 2JNYA 1ET9A 1PFNA 1VQHA 3T13A 5M3FG 2PZTA 3A7AB 1LTAD 1JORA 5IGCA 1JQYD 4E32A 1TWFI 4BY1B 4DAPA 4CL1A 4PV1C 1IBML 2UXBQ 3CU7A 4DR5Q 4FP5D 4QJFA 3CCR1 4YHHQ 2NYZD 4HMJA 2CQOA 2AWOA 1PTOD 4JI1Q 2N8NA 2E74C 3J81f 2JA8B 1HNWQ 4A3EI 1FD7D 4DF7A 1RCVD 1MJEA 2PQAB 5IGGA 3S2DI 2I07B 3KBGA 2QEXA 1KDCA 1CK1A 1A63A 2O2LD 3D0FA 2OOYB 3EBEA 2AUKA 5IY0A 2ES2A 5M5XB 3S2DB 3ERQA 3T1YQ 2JN4A 1BUVT 1VQ51 1SR3A 4NB8A 1VQ6Z 3NBHA 1IL8A 1L1OC 2LXJA 4U68A 5CYUA 1B70B 3NWSA 3RLFA 2YTXA 3NEMA 4DUZQ 4KHPQ 5CM2M 1XPRA 1EQRA 4KD3A 2C9OA 1VQ5Z 1F9RA 2F4MA 4A3FH 3SE0A 3HG9A 4IPCA 1U4LA 2K7VA 4BA1I 1RJTA 2Q8RE 1QVGY 1NUCA 3MHBA 5EPLA 2R7ZB 1Q822 4NPSA 2R93G 5C4JI 1U9RA 5C5MA 2FMCA 3M4OB 2KPIA 4JBWA 2BDOA 4A3IB 2BJOA 1Q81C 1XNQQ 1IZ6A 4B3TQ 1KRLA 3S1QB 1D6EC 3PUXA 2XVSA 2KENA 4J8QA 3KF6A 1KD11 3MFGA 2YYZA 3ITPA 4KHVA 1KQSA 5CC4A 3HOUI 2NZ1D 2L0CA 1PFTA 1I6HH 3D4DA 3KYHC 1TU2B 1VQNA 1PRTB 3RZOB 2F4VQ 2WB1E 4C2MB 1VQIA 2P3YA 4HH4A 2PCFB 5IT9f 2Q2HA 5ELEA 1PH6A 2VUMH 3BVGA 2ZTDA 3ND9A 3K57A 3JAMb 3S17I 1VQM1 1R9TB 1S721 1STNA 4IUNA 1QF8A 1G2TA 1ZXTA 3G6JB 4L63B 5JAVA 2PI2A 3A8IE 4H44C 5FLXE 5ELDA 1K8A1 1Q812 2CQAA 2R6GA 5CGKA 3G4SA 3FHWA 1S72Z 2MHVA 1CM9A 5EAYA 1C0AA 1WCMB 3I7FA 3JAME 4JI7Q 3CCMZ 1WTVA 4LF8Q 3CPWZ 1EEID 5CORA 4JK1C 3T51B 3M85A 1VQBA 1IKMA 3TSSA 4PMCA 1N32L 5FOBB 1IYJB 5EKLA 4Z9CB 5I9PA 5IYCG 1SNPA 1Y1WI 4B3ML 5TSSA 2V1CC 3BS1A 4HJ9A 4RGTA 1VQ9Z 4R8NA 2LIYA 3H09A 3KF6B 1PRTF 3OIPA 3UE0A 1L0WA 1BBUA 3HZXA 5C4ZA 4DV3Q 1Q8IA 3H3VH 4ME3A 1HQRD 2VPZA 4A3BG 4BBRI 1DJRD 2Z1CA 3DWPA 4I7AA 1RL2A 1ZH1A 3S1QH 4JI8L 1VQPA 4APVA 2KVMA 3HOYH 5CV4A 1RO0A 2JXMB 2JA7H 3MXUA 1S3OA 1MI2A 2R7FA 2MGSA 3OIQA 5IP9I 3CC21 2BA0A 4DR2Q 3H3VJ 3AQQA 1HA5A 1RDPD 1UEAB 1Q90A 1W2BY 2ZXPA 1N34Q 1PH9A 3GTKB 2LEXA 2EYHA 2NAPA 5IWAQ 1GOZA 4A3KG 2F0KA 4X62L 5FLXb 2R7ZI 1I50B 1VQLA 1KD12 4DV7L 2KCMA 5ELCA 1EY8A 3Q22A 2A6ED 1XMQQ 3I4MG 2WAQA 3NHHA 4A3FI 4DV1L 1J6QA 4QIWE 3R2IA 2EJFC 3A8KE 1TWFH 1HA6A 3M4PA 4RVFA 3NP8A 4P2CB 3PF5A 1SYCA 1Q8KA 3VR6A 1HR0L 2JA8I 5JJZA 2ICIA 2L9HA 2DJGC 3CCUZ 5A35A 1TWCB 3DM3A 3S1RB 1RNIA 2FJ2A 2F0TA 1KIXA 2R93B 1C7YA 2OTJ1 2UUBQ 1IBMQ 2PMZE 3CCU1 3LUSA 1SYGA 1M1K1 4M8AA 4A3EH 1O7YA 1XPOA 4R9WA 4B3MQ 1YBYA 4XQJA 1YJ91 3RLNA 1VQ71 1YHQZ 1Y8CA 3CXCA 2DE7A 3PQIA 2F03A 2A73B 5COYA 1GHJA 3KOJA 4C3JB 1KD1C 1RO4A 4BY1H 4Y52H 5IP7H 2IY5B 3MVVA 2B2WC 4NBBA 3IKJA 2NB0A 5M3MH 4A3JH 3EERA 1HNZL 4B3RQ 1YJW1 2QA4A 2B63G 1O7ZA 2K04A 5IOCA 2EJMA 4QF4A 3T1YL 2ZXRA 2VQFQ 4EX5A 1EU3A 4HSVA 1EY0A 3J7AV 1R4QB 1PTOB 2UUCQ 1J9OA 2A19A 4IUTA 3SXHA 4Q5VA 3HOUG 3F2BA 2HCCA 3RZOH 2JS4A 1LYLA 3E6ZX 1ICWA 1UNSA 2LXKA 2VUMI 1EOTA 3NK9A 1PTOH 4DAYA 4NBGA 2PW7A 2J7ZA 1EWHA 1LTLA 3OWFA 4JI3L 1EQQA 3D9XA 5E1FA 2D2CC 4FXGC 4A3IG 3M7GA 3SK4A 1VQ4A 4X66L 1EY5A 1BBXC 3SHLA 4DV1Q 4G4KA 4HIMA 1CUKA 4KD4A 4C3HH 1B8AA 1F2YA 3S24A 1YJWA 3PO2B 1BKBA 3M7NA 5FLXL 1JJGA 3SDZA 3S17B 5BR8Q 2N3SA 1SN8A 2YU9H 2P28A 3VYTA 2NVXI 5K36H 3J7YW 3QG1A 1NJIC 1QZHA 3ERSX 3RZDH 1K732 1BCPF 2R3ZA 3BZCA 3C1FA 3KIHA 3CCRZ 4M1UB 3I4NI 3NQTA 1I3QB 3DM1A 1M901 3ONAB 3BU2A 2NWGA 5JVH3 2WKDA 1M1K2 2G9DA 4PZ7A 1H9SB 1G2SA 3LX0A 2RCFA 5ELBA 5C44G 4Y52I 1GUNA 1T5XD 1W2BA 3STBD 2H1EA 1AA6A 3MEHA 3CXCY 1QILA 2CW0C 4A3DG 5EBCA 2K33A 5I6WA 1S5ED 1F2ZA 2YU9B 1B7YB 1SROA 4QMGA 2IV2X 3S2HI 1EZ6A 3TDQA 2Q4ZA 3PO3I 1WTOA 3KLWA 3U9SA 3W1BA 1O78A 2NN6G 2CW0D 1JOOA 3R2TA 1SJHD 4DFAA 4E2YA 2F0VA 1TWAI 5C4XI 4HCEA 1GM5A 3HOZB 1Z47A 1DGSA 1Q12A 1EYAA 4FDBA 1M1KC 4K6LA 1ZEQX 3KLSX 2NVTB 2K05A 2AKLA 4WJ3M 2IJ0A 1TY0A 1Y1VH 2OF1A 2OCEA 4DQYB 3K5NA 1MJCA 1RHPA 1VDZA 2XGTA 4R4QA 3AEVA 3J80i 3HOWI 3NFZA 3C1EA 2E2HH 2L11A 4HJ7A 2UU9L 3GTPI 3FRPB 4DR6L 5C0XJ 2AHOB 5FJ8H 2A68C 3K0XA 1S5DD 1KLGD 2VW9A 4X3SA 4LUOA 5EJWA 2LY7A 4DV5Q 3MFYA 3J80b 2K28A 5IGBA 1PFMA 1CI3M 3VDYA 2NTTA 2ICEC 3VMGA 4RVHA 4AIMA 3OW7A 5D1OA 2M00A 3MXNA 1VQ6A 1IBKL 3CP0A 4MN3A 3HOVG 3J80c 3NUCA 4A3JB 1H9KA 2MO1A 3H3VI 5AN9F 1OXUA 1QUQB 3T16A 3CMA1 3S17H 2V3VA 1B9MA 2YTYA 4QCLA 3HOYI 1G51A 2TSSA 1XNRQ 3EFXD 3K6OA 3J7A5 4NBCA 3R8BA 4C3IB 1X3PA 1FR3A 4P75A 1Z03A 1YNXA 5JOBA 1Y1WH 2BE5C 3IFUA 4A3EB 1M902 3NH8A 1KC81 1FDIA 3J80L 5I9OA 1SE8A 5LMUQ 3PUYA 4C3JG 1DZ1A 2KBNA 5LL6X 2VUGA 3J81i 2NVYI 4AYBA 4N9PA 4BBRG 4GOPB 4CKBA 1VQN1 3I91A 2A8VA 3S2HH 4NXNL 3QOLA 5AJ3Q 2EYJA 3MA2B 3CCQ1 1A2TA 2ZTEA 5JEAJ 3JC66 4DKAC 3GCFA 2Z6BA 3CXCZ 1X3QA 1P9NA 3EROA 1QVFA 1D2BA 2F0JA 3E3XA 3PV0A 2ZJQA 4AYBE 3K0YA 2PNHA 2ZT9C 4PZ6A 1DD2A 5FLXc 5A2QE 2JE6I 4DR6Q 1TY2A 2K5VA 3FEWX 2F1MA 2VPXA 3I4LA 4MH4A 4G7HC 5JJLA 3FMCA 4H0LC 1BF4A 2KHIA 2JUBA 4RV9A 2H5XA 4RGMA 4POFA 3RMHA 1EYGA 1LTRD 5EPKA 4DNTB 5KRUA 2ENBA 3M3YB 2WAQB 1HUNA 3QB3A 4P71A 2PZWA 1TFIA 4ILWA 3CKIB 1K8AC 3HOVH 1RF2D 3PSIA 5FK9C 2C35B 5C4JH 4QY7A 2R93H 3AFQA 2PMZB 5C5LA 5HURA 1VCIA 4DV4Q 3S1RH 1CT1D 2OXPA 3BVZA 3Q24A 1I5FA 2XWBB 2L4NA 1T9HA 1X32A 5IODA 3K7UC 3H0GG 3G7LA 1E1OA 5EQ0A 3KF8B 2ZAEB 3I3CA 3PUZA 4AQYQ 3DXJC 2B3GA 1VQK1 3PIP3 3K8AA 2OTJZ 4HAEA 1X3ZA 3CD61 3TQYA 1YUAA 1KNAA 3NTKA 1Q16A 3GD7A 3MWYW 4GN3B 3OW2Z 1SSOA 2XIWA 2F3IA 2F0HA 1TS5A 4DN4M 1HCZA 2DY8A 3AYHB 1LTGD 4ZAIA 3EEDA 2PMZA 4TKOB 3BG1B 4I65A 1BNZA 1K8MA 5DNFA 3MZKB 2QCPX 1IYUA 1CKMA 4A3GG 2PM9A 4A3BB 1HRJA 3CC71 1WYDA 3D4RA 1B53A 3QWUA 1N8R1 2QDLA 2QLVB 2AKWB 4NBHA 3J81L 3HOYB 1A62A 1BVSA 1JICA 1NR4A 3CC7Z 2GVBA 4A3JG 5E4XA 2J6AA 5K5PA 1D7QA 4EGVA 1LT5D 2K01A 5C3EG 4DR2L 3CME1 4A3II 1ICFB 1BCPC 2EY5A 2NUCA 3RZOI 4DXGA 2E2JI 4DR3Q 5DLQE 1A15A 5EBDA 3Q6SA 1EY4A 2A1AA 1YHQA 5ELFA 1YIJA 2WINB 4X6AI 2O5IC 3VYUA 2IX3A 4RFBA 5IGFA 2R92G 2D0PA 5M5WH 1PZID 4RH6A 1TWGI 4P74A 1TS2A 1PHJA 4EQOA 2EYPA 1JOQA 1GD7A 1C9OA 2EE1A 1UEBA 1LTSD 2CH4A 3GDEA 3LWUA 1C48A 1Z9FA 3D3RA 1QYPA 3ULLA 3QWNA 4A3FB 2E5LL 3DWAA 4C1NK 4B9XA 3NPPA 2K5RA 1YJN1 4YCUA 1EWIA 2M6NA 5CMDA 1M8AA 1QOHA 1ASYA 1R9TH 3GTOI 3OTOL 4K0KL 1NP6A 2KECA 3ICEA 1Y69U 2EYLA 1KRTA 3FPPA 1GUGA 2EYMA 4ZKBB 3MXPA 1S5BD 1I4XA 2F3VA 1LUZA 2ZXOA 4UPAA 1I50I 3S1RI 4DV6Q 1HJPA 1Q7Y2 1BCPB 2Y0SA 4LWCA 4FF3A 2CHBD 1BOSA 3OWEB 4KN4C 4UHVA 2F3WA 2VL6A 5EGTA 3KK7A 1TR5A 1MGSA 4CGYB 1M4VA 4Q0FA 3I07A 2QEX1 1KC8C 2RQXA 2SEBD 3VTNA 4JOIC 3ESWA 3J81c 3I4NB 4K8IA 1WJJA 4KN7C 3HOZI 2L1BA 5CBAE 1NTGA 1VMCA 2LS01 2QEXZ 2Q2UA 1AE2A 5M3MG 1YJNA 3RNUA 4NXMQ 2KCTA 4NW2A 5IP9H 2AQ3B 1JJ2Y 2DE6A 1QVGZ 2MQHA 3GV6A 2JIRA 2K5NA 5FO8B 4X65Q 3BZDB 4RKLA 4F88A 3T53B 4E33A 1WI5A 3U4VA 4RCNA 3OW2Y 1GVPA 3CCEA 1V43A 3CCJ1 3HP3A 4YHHL 4PG3A 1W3SA 1TKWB 3I4NG 3H15A 5M5XH 1UE5A 5J3BA 2RKSA 1X6OA 2NZOA 2FHTA 1GJXA 1I4PA 3C46A 2EJGC 3PUWA 5GQOA 3LWEA 4GKKL 3HOVI 1WW9A 5DEHA 1EIHA 1DOLA 1PXUA 2QILA 1EL0A 3EA6A 5FLMI 3CCM1 3CCE1 3BYTB 3ND8A 1EZ8A 1I94Q 2NVQH 5IYBH 1PH3A 3GTQB 2R7DA 1AN8A 2DGYA 4JG2A 3PO2I 4HR7B 1LQLA 3DUZA 4OHJA 4XQNA 1GUTA 4NDXA 5I2YA 3GTJI 1JWUD 4EQPA 2BA1A 3VA7A 1LT4D 3MONA 3OTOQ 4FF4A 1EY7A 2KQ3A 4K0KQ 1KL9A 2SNMA 3J81j 2IZ4A 4QTTA 3S14B 3NENA 5AJ3L 5KYIA 5M3FB 3R93A 1HNZQ 3H3VC 4TQUS 3HKZA 4NB9A 1B2TA 4NH1C 3CCQA 2B2TC 1EYDA 5KNDA 4B3TL 2NN6I 5GAHC 2D5DA 4A76A 5I6YA 4XIGS 5C3XA 5E7NA 1LO5D 4K14A 3CHBD 1MHWC 5F2DA 4LF6Q 1KXLA 4LF7Q 2JMOA 3CCS1 1QNKA 4NXML 1W6KA 2RDFA 4L6TB 1E0BA 4HSPA 3I561 4A75A 1LTBD 2AWNA 2DY7A 4JCVE 1NAPA 1G91A 4IJHA 2A5HA 3GTGH 2CFMA 3PIOA 1N8RC 1ONLA 1SYDA 3U9OA 3S1QI 4UP9A 1XWEA 1B1ZA 3CC4A 2A6EC 2A6HD 4KKSA 2V8IA 2JP1A 4DK0A 4DAVA 4RAUC 3S1NH 2XNAC 4DGZA 4XDXA 1CKOA 3H91A 1G6ZA 1PV4A 5JEAG 3G71Z 3TS0A 2JEAI 1QUQA 1TWHI 1N36Q 2KOLA 2R93I 4DNIA 2E7ZA 2H4OA 1TWAB 3QO2A 3MEFA 1WCMG 1NJI2 2JIOA 1F2LA 1CQFA 4WORA 1RO2A 1PH4A 4LFBL 1XMOQ 2FFKB 3IF8A 1FNWA 4KY6A 2QRCB 4NBEA 2I5HA 4N8FA 1B3QA 1XMQL 3D8GA 2M2LA 2JA5I 1HQMC 2VZAA 1TWCH 4A3LG 1EUJA 1NNXA 2EOTA 1YUKA 2OWOA 1I4RA 1SDFA 1PH8A 4A3DI 3QOJA 1YJWZ 1DXMA 4IPGA 4AYBB 4BY1I 1TWFB 4V190 2JYOA 4HJAA 5IT9c 2JA5H 1KQSY 3EQLC 2A69C 2RIQA 4GLAC 4BS9A 2I5MX 4O42A 4LFCQ 1KTKA 1YNNC 2I0QA 1YIJ1 2O5JC 1EOVA 2B29A 2JA6H 3BZKA 5AFWA 1I50H 4RCOA 4HGZA 4GZYC 1VQKZ 5LMNL 1OXTA 4A3GH 4DGLA 3G6E1 1S7MA 3X3MA 5C4HA 4ZYSA 3E0EA 4PZ8A 1ENAA 1SFOB 1CFMA 2BE5D 2OQKA 2Y0SG 2NN6H 1K3RA 1DL6A 4BBRB 4A4IA 3G6EZ 3FKIG 3TE5B 1TT2A 2EGTA 1Z7TA 4MD7A 4DU9A 2DNEA 4IUUA 5M9OA 2K4KA 2HDLA 4KJOA 3TP7A 4GN5A 4K5XA 1AW7A 4FXKC 1EFWA 1A6XA 1YEZA 5JPMC 3CC41 3TZUA 3GTJB 1JCKB 1DM0B 1VMPA 2JA5G 1EQVA 1A2UA 2VQFL 2IL8A 1ET6A 3GTPB 1N33L 2WFWA 1Y1VI 1B50A 2F0DA 2WV6D 4MONA 2F0UA 4IJLA 4OWTB 1PYWD 1KDAA 2ZM6Q 1V1OA 3DLLA 3D6WA 3KIFA 1Y1VG 3OW2A 4RVGA 3JAML 3S1MH 3CMEA 2GTHA 1SMXA 1S5FD 3L2PA 5C4XB 3Q23A 4RGNA 2CCZA 2F0QA 1WCMH 5G3LD 5DM63 1WTRA 2B63H 4E2XA 3OOCA 5KEEA 2E76C 3SVMA 1NJI1 1PZJD 2F0NA 2GTIA 1TIID 1VQ8A 3F3PC 4HMIA 3PO3B 2HF1A 4WJWA 4XT3B 4DAYB 4ZKCB 4B08A 4MXUA 1K3BC 2Q2TA 1P16A 1VQ61 2B63I 2YU9I 3IRBA 1TQOA 5ELOA 3RUZA 4FVMA 1JC7A 4N8X1 4DR1L 2R7ZG 1ILPA 1WZNA 3M4YA 2G2KA 3CC7A 1M90C 2B63B 3GTMB 1ML0D 1VQFA 3AU7A 1PFSA 2NTSA 2NVYH 2WP8J 4TRDA 5E4WC 1KAWA 4HIDA 1I4HA 1I6VC 1Q82C 4K5VA 1UE1A 1RTOA 3S1MB 1X55A 2QREB 5T67A 2JA8G 1KNEA 4L8JA 3H0GH 5GAEC 2JA7I 3JAMf 3F3FC 3HEJA 1FJGQ 1LACA 2NVXH 3HOUH 1V9PA 3UE1A 4H13C 3IFDA 4OIKA 3MAQA 1VQ8Z 2RHQB 1SRUA 1G6PA 3KLRA 4ZUIA 3CPFA 5K36G 1SMYC 3K7AH 2JA6I 5IYDG 4YCVA 1VQPZ 5KNCA 3WOEA 5D3DA 2R7ZH 2Y0SE 3U58A 2EQSA 3HKZB 3CMAA 1W2BZ 3W5OA 3RLOA 1XJVA 4G7OC 3S16H 1K83H 5IP9G 3UDXA 3I4MI 1E22A 2Q2IA 4K6DA 4CJ2C 5GAGC 2RDHA 4GKKQ 1SEBD 1N34L 1QXFA 4BY7I 1V1PA 5JJIA 3J81b 4A3LH 1K8A2 2B39A 5A2QL 1HHVA 4A93H 4IUPA 1LABA 2HHHL 4N9TA 2JSOA 3NDIA 1EY6A 1RIPA 4I7ZC 2NBFA 3P75A 1WTQA 3URYA 1VF7A 1JE4A 4YIJA 2JQOA 2BH2A 4GKJQ 1DCZA 2B2UA 1SE3A 1MSGA 4OEMB 5E3FA 3VMHA 1YHAA 5ISRA 3CCVZ 2M9VA 2JA8H 2RBLA 3G6EA 4MTNA 1H9SA 4PMBA 4BXXH 3I70A 4UP8A 1WD1A 3CCLA 1GHKA 3CCV1 5C44B 3BVMA 3L0OA 1JT8A 5T64A 5HY6A 3B6YA 2VQEQ 4KMUC 1GXDC 2HHHQ 4K5WA 1K8OA 2IHEA 3NE5B 1I6HI 4TVAB 3H94A 1VQ91 4ALPA 4RG1A 2KUMA 2QW7A 2C5CA 5C0XG 4L5RC 1EIYB 1SLJA 3J80f 4RGOS 1EY9A 2JIQA 1Y14B 2O4HA 1PTOF 4RVDA 2XTIA 3CAMA 4DNRB 1HFNA 1JE5A 1TWGH 3PO2G 1U4RA 1D1IA 1K731 1NE3A 4X6AH 3GO5A 1KQSZ 4QL5A 3CD6A 4A3KB 2QGQA 2R61A 3BJUA 1LT3D 3E0JA 1G291 1IW7D 3X3NA 4KKTA 4HCSA 3STBC 4KK7A 3I4MB 1Z02A 2MP1A 2V4DA 4JC0A 1WOCA 2KA7A 1VQGA 2E2IB 2HU9A 1XNQL 4LUVA 3S15H 2LFUA 3GTQI 1LTTD 4DR4Q 1UE6A 1Q3LA 4YWMA 5CV6A 3HOWB 3RZDI 5LHY1 2KI7B 3KJOA 3U50C 1WTHA 4LF5L 4YY3L 4XYOA 1USPB 3Q0AA 4DV0L 2ALYB 4OXPA 1GKHA 4LF4Q 3S15I 3TP6A 1Q862 4UAIA 1NY4A 3ER0A 1FNUA 1K0RA 1XYIA 1JOKA 4A3BI 2P5ZX 3U4ZA 2B2VC 1SIWA 2F52A 1IHZA 1OO9B 4YCWA 4KKUA 1O7IA 4A3KH 1HZAA 2RHBA 2PNRC 3K58A 1XMOL 5T1IA 3FKIH 4H02A 4NP5A 1FGBD 1YI21 2EXZA 5DAUA 1ENCA 2R92I 1K83I 2YV5A 5M3FH 1QZGA 1VQMA 4A3CH 4FYDA 2W04A 2A6HC 4KI0A 3NTHA 1YI2Z 5J39A 2UXDL 2VY3A 5C4XG 1AZQA 4JI4L 1VQAA 5I2XA 3JAMc 4IFDH 2R92H 1RODA 3PUVA 1H9JA 4BBSH 2F0WA 4NOZA 1O7LA 5C44H 1Q86C 2IZ3A 2K5DA 2LKVA 4FXDA 4DK1A 3AFPA 1D1KA 2L15A 3I56A 1NSNS 3AMUA 3V05A 2EIFA 3L7ZC 4O1NA 2WB1B 4IOAA 4H7BA 2RPRA 1ZKOA 4CJ0B 4FF1A 3V2TA 1YZ6A 5JVG3 3S15B 1OTCA 2UUBL 4A3CI 4XT1B 3HKSA 5IIFA 4JI4Q 1PMRA 3CRLC 3TZDA 4ABNA 1YIJZ 2XSCA 4EWCA 1PYSB 3NELA 3T4AC 1YJ9A 4L5TA 3CCJA 2EZVA 3CMEZ 2PO4A 4BWGB 3GTOB 4EQNA 4JI0L 1Q821 1S4ZA 4J15A 2ZM6L 1RQFA 3MXGA 4P73A 4LF4L 1JWSD 4GOPC 4X62Q 3KDFA 1MD2D 5CR3A 5BR8L 1X0TA 2F4IA 1STAA 2AUJD 3VA5A 1STBA 1CA5A 4EQ5A 3H6MA 3MXNB 2WAQG 2MUYA 3K7AB 3MC0B 2L5TA 5IT9L 4IOCA 2VNUD 2F0EA 3NH4A 3KUPA 3GTLI 4JI2Q 3L9AX 3PGZA 4BY7H 4L5QA 3TRZA 4NB3A 1BDOA 4BXXI 4F7XA 3TP5A 3T4NB 2IHFA 1I4GA 1IKLA 1AP0A 4QQBX 3CQZH 3N52A 4UDUC 1VLAA 3D2LA 1LV9A 1FDOA 1YJNZ 1RD9D 2QRDB 2E2JB 1ZYRC 2PZUA 3TMEA 5T6BA 1XXGA 4HIKA 4HTHA 1GUOA 3FQMA 1X56A 5EKKA 4XQQA 2JJQA 5D3IB 4ZCKA 2F0FA 4JBKA 1Q811 2ASBA 4A3DB 4DUZL 4BBSB 2EPBA 1WD0A 3I55A 4X66Q 5D65A 4A3MB 4GOPA 2AQ2B 1WJ2A 4WFN3 3CCUA 5IT9b 1EFID 2QR1B 4BBSI 1B4OA 2NZHA 2Z4IA 3OMCA 1GUSA 2HQLA 3NXWA 2F0GA 5CV7A 1ZB9A 2JIMA 4BA2I 2XRQD 1FJGL 4JW0A 5H1SE 1V8QA 3RD4A 3NBIA 1MBYA 4GS3A 4GLVB 4Y7NI 1X9NA 5IGDA 4DV2Q 3SEBA 4DV7Q 4IFDG 4LF8L 4FO2A 3K80C 2JEBI 2OT2A 2FMMA 1AE3A 2B8FA 1K28A 2QA4Z 1VF5C 2UUAL 5BN5A 3J7A4 1F9PA 4IO9A 5JJKA 4JI0Q 3H0GI 3K7AI 2HIXA 2V45A 2HDMA 3GTPH 3SK8A 4E2WA 4JI6Q 4FNFA 4OO1I 4IPHA 3HFZB 3S1NI 3PIO3 2B2YC 1EEFD 2KHJA 1E2ZA 1JJ2Z 2E2IH 2IT1A 1VQ81 5IYCH 3PIPA 3A5ZB 3I4MH 4NFRA 2RA4A 4IPDA 1JJ2A 4K8JA 4JI3Q 4E6IA 3F8TA 4QB4A 2X6LA 4OWXB 1VQP1 2ATWA 4RA8A 2M48A 2WB1A 4XTCS 4IQZA 3J81E 4OIJA 3MTSA 3O13A 2RBMA 4RHSA 2PW5A 2DUDA 1N36L 1R4PB 3I8ZA 3W1GA 3TBIB 2B2TA 4A3MH 4R4OA 1ZYRD 4A3GI 2ZJRA 2VF1A 1CZWA 1NMGA 3BDOA 3ULPA 2KJXA 4JI7L 4C1NI 1VS0A 1WFQA 1CTMA 4JVZA 3HOXB 4JBJA 1RLYA 5LL6S 3S14I 3PCOB 1QVFY 3A55A 4LW1A 1YI2A 3RR5A 4LAAA 3IR7A 4ZRZA 1KAAA 2OTLZ 5JEAH 1JR0D 3C3LA 2RF4A 3G71A 3CCSA 5LL6f 1JWMD 4DV4L 4DV5L 3D4WA 2EY6A 4X3TA 2CWPA 4LUZA 4E30A 4MRIA 3HOXH 1EU4A 3GTJH 4DV3L 3HOVB 3OSOA 4OX9L 1FL0A 1D8LA 5EKIA 1QE6A 1VQNZ 2V8JA 2LSSA 1C8CA 2G5DA 4E31A 3I72A 3I2ZA 2VXWA 4GNXC 2HUGA 1SFOI 1YNND 2MNAA 2HD3A 4BBRH 4C3IG 1XTDA 2JK8A 4DAMA 1VQCA 2AMCB 3T1HQ 1PFBA 3GTGB 1Q1BA 1I3QI 5LMNW 2MO0A 2E2II 2OZKA 1X65A 1IBLL 1IYVA 2RSOA 2EY2A 3F2CA 5C3EH 2NVXB 1SMYD 1HZ9A 1PTOC 1TWCI 1U5KA 3C2PA 2O53A 4F8MA 3EJIA 1WIIA 1VQ5A 3K5MA 4LF6L 4OO1H 4ZQ3A 5IYDH 1UE7A 4J1MA 1ILQA 1VQJA 2K14A 2XWJB 3WOFA 1KABA 2GA4B 4UY8C 2NVYB 2J4XA 1ML8A 4JOIA 2B8GA 4KTAA 4NMZA 4AH6A 2V8KA 4L5SA 1STEA 1GO3E 4DUYQ 1TS4A 3J80E 1DOMA 1L0XB 3CCVA 1YITA 3GTGI 5M5YB 2IX0A 3PO3H 2H85A 1D5XC 1XNRL 4MNOA 4NBAA 4A3DH 3NQIA 5IP7I 1LTID 3HOYG 4LF9L 2N49A 3KF8A 3SK6A 5C4XH 5A2Qf 1IXRA 1FGUA 4YWKA 1YIT1 1K0SA 4LFBQ 1BBWA 3CW2C 3MZLB 3SK5A 1CQVA 1CSQA 4A3JI 1DOKA 2D9UA 3QJYA 5LMUL 3R3OA 1SNMA 2Z6KC 2E2HI 1TXYA 1YITZ 3BDLA 4QIWB 4YWLA 1PH2A 1SNQA 3DHQA 4IUVA 3RN5A 1A3TA 1FYCA 4QGUA 1JB3A 4IN3A 4DV6L 2NVTI 4DV2L 4QTUA 2D0OA 4P72A 3CQZI 3GTMI 1QJOA 1AH9A 3CCL1 5D1PA 1UUPA 3LGJA 2HQEA 2NVTH 3HOXG 4LF9Q 1K8GA 3Q8DA 2TMPA 2EDGA 1II3A 3CCLZ 2UUAQ 1WTWA 2E8GA 1N33Q 1TWGB 5IGEA 4CBVA 5KNBA 2KHSA 2KCNA 1H95A 2B2WA 2K03A 4CKEA 1QG7A 4CDEC 3FVQA 1BO0A 1XX8A 1LM0A 1TS3A 4UP7A 1Q46A 1BXTA 2IW3A 3CCMA 3ULJA 1NBWA 2JA6B 2EYFA 4RHRA 3GTQH 3GV3A 1BCPD 1VQMZ 2K52A 4KJNA 4QUFA 3VR3A 5CBEE 3F2DA 2E2JH 1V1QA 2KCCA 2PQAA 4ZUJA 3K81C 3UDIA 3FP9A 2BH8A 3CQZB 2WACA 4K2LA 2RSNA 4JI8Q 2K6AA 1QVCA 1NCVA 1PRTD 1DONA 1HZCA 4G7ZC 1F9QA 4RKBA 2R92B 1ZB8A 3JAMi 2PYKA 2YADA 2DNCA 2F0OA 4OL7A 2Q8TA 2EY1A 3KFUA 3RZDB 1Q7YC 1N32Q 2W03A 3FKII 4S1TA 2B2VA 1HXYD 5JPNC 2PPBC 1U0LA 4JI5Q 4XX2A 3S16B 2CVRA 1EQTA 1KC82 2Z8LA 1S5CD 2ZTCA
chains in the Genus database with same CATH topology
2K3RA 1L1OB 4LFAQ 2E9HA 4B3SL 2RCNA 3A5UA 1J5EL 5ELNA 3CF5A 4DR4L 1X3GA 3HKZE 4JI5L 1PA6A 2QA41 3CC2Z 3PF4A 3EN2A 3TEHB 3RN2A 1S72A 3M3YI 3CCJZ 3J7ZC 5FLMH 3P5JB 5C44I 1E1TA 1PH7A 3VB9A 2MFIA 2CWAA 2YTVA 3GTMH 1J5EQ 4DK6C 5M5YH 4DR7Q 1HNWL 4GNXA 1NUIA 1VQO1 4IFDI 3S14H 2Z0SA 1VQOZ 4NBFA 2UXDQ 4X65L 4BBSG 2GVAA 3CPWA 4R4IA 3S16I 1NMFA 1PH5A 2OQ0A 4OX9Q 1VQ7Z 1HR0W 4GKJL 1Y1VS 3ZJYC 4GNXB 5HGQA 2OTL1 3HOWH 4MD8A 1OXVA 3UDFA 1P8LA 1CSPA 1KHIA 4LFAL 1JWHC 4DK3C 1K73C 2JA7G 1HNXQ 3S1MI 2HT1A 2UXCQ 3CCSZ 1WCMI 1N8R2 2K5HA 3I56Z 4A3FG 3GTKH 1SFOH 2Q51A 4IFDJ 2GU2A 4A3EG 3GTKI 3FQQA 1R9TI 5FLMG 3G711 4JI2L 4HGYA 3NDJA 3IX0A 1HNXL 1USPA 4E2ZA 1CKNB 2HIVA 5FLXf 3G4SZ 1JJCB 1X54A 1I94L 4JBMA 4DR7L 2PK7A 4AQYL 4JV5Q 3G4S1 1E24A 2VQEL 1S40A 4KLKA 5LMNQ 3M9BA 3BG0B 1PVOA 1TWAH 3TDHB 3M3YH 1K9MC 1E3PA 1L2FA 1X3FA 3M4QA 4JI1L 1MKHA 4DPGA 5IP7G 4JYAL 1VQ7A 4A93I 2OTLA 1VQEA 4NBDA 1VQ9A 3OYYA 4GLXA 4O0AA 3A0JA 4A3KI 3E9IA 2F4OA 3D31A 2DE5A 4DR1Q 1Z01A 3I4OA 1L1OA 4A93G 2QKDA 1Q7Y1 2N78A 4C2MH 4O2DA 2UXCL 3VMIA 4LF5Q 4DV0Q 1XPUA 1K9M2 4R4TA 4NXNQ 3HOXI 3CC4Z 1EIFA 4DR3L 4BY1G 1VQKA 1JMCA 2D62A 3M4OI 4LFCL 4DR5L 1KRSA 4A3IH 4X64L 3M4OH 3KDFB 4A3MI 1UWVA 1YVCA 5IYBG 3CC2A 4C3IH 2GN5A 1N9WA 3SGIA 3WWVA 3A74A 1OXXK 4MD9A 2E5LQ 2K75A 1A8VA 3GTMS 2F4VL 2PI2E 5A2Qb 1VQLZ 3CCEZ 1PYBA 1MIUA 4PMWA 4X64Q 3S2DH 1VQOA 4DUYL 1VQL1 5C3EI 4HJ8A 1I3QH 3CMAZ 2WB1G 4WJ4A 4JYAQ 3GKQA 3CPWY 3NBHB 4MZ9A 2OTJA 3Q87A 4POGA 3HOZH 3TS2A 3HKZG 4A3CG 3CCRA 4BY7G 3GTOH 4JI6L 3I4NH 4RMFA 4Y7NH 1X3WA 1YHBA 3EIVA 3T1HL 2I3CA 3KJPA 2IX1A 3CCQZ 4OWWB 2EXDA 3UDGA 4OO1G 3NH5A 1N2FA 4GN4B 2VS1A 1K9M1 1IBLQ 1Y1WG 2R6MA 1VQDA 2UU9Q 1HZBA 1FVIA 1OXSC 3E9HA 4HJ5A 1E7ZA 4AYBG 1JB7A 4YY3Q 2FXQA 1YJ9Z 1YHQ1 4R1JA 1IBKQ 2JA6G 2OOXB 1PH1A 2I5LX 4HIOA 2ZJPA 3PO2H 2JA9A 2K50A 4C3JH 1A0IA 5FJ8G 4JV5L 2ID0A 1CKNA 4OONA 1ASZA 1IL2A 1QVGA 2CKZB 5D1OB 5IE8A 3CD6Z 4A3LI 4KHZA 2NVQI 3GTLH 4LNQA 4BXXG 2JR6A 2RT9A 3HOWG 1HH2P 4KHPL 4B3RL 3TREA 4R4CA 4TNUA 5IWAL 1VQ41 1Q1EA 4LF7L 3I55Z 3G48A 4B3SQ 2UXBL 3HOZG 1VQ4Z 4A3BH 2UUCL 5GROA 5GADC 4RS4A 1QVFZ 4A3MG 1X3EA 2VUMG 3I551 1Q861 3PO3S 2Z6KA 5C0XI 2RHSB 1HR0Q 2WAQE 1TWHH 3PO3G 3F1ZA 2JNYA 1VQHA 5M3FG 4E32A 1TWFI 4CL1A 1IBML 2UXBQ 4DR5Q 4QJFA 3CCR1 4YHHQ 2CQOA 2AWOA 4JI1Q 2N8NA 3J81f 1HNWQ 4A3EI 1MJEA 2PQAB 3S2DI 2QEXA 1A63A 2ES2A 3D0FA 2OOYB 3EBEA 5IY0A 3T1YQ 1VQ51 1SR3A 4NB8A 1VQ6Z 2LXJA 1L1OC 1B70B 3RLFA 2YTXA 3NEMA 4DUZQ 4KHPQ 5CM2M 1XPRA 1EQRA 1VQ5Z 2F4MA 4A3FH 4IPCA 4BA1I 1QVGY 1Q822 4NPSA 2R93G 5C4JI 2KPIA 4JBWA 1Q81C 1XNQQ 2BJOA 1IZ6A 4B3TQ 1KRLA 3PUXA 2KENA 3KF6A 1KD11 2YYZA 1KQSA 3HOUI 1PFTA 1I6HH 3KYHC 1VQNA 2F4VQ 2WB1E 1VQIA 2P3YA 4HH4A 2Q2HA 5IT9f 1PH6A 2VUMH 2ZTDA 3JAMb 3S17I 1VQM1 1S721 1QF8A 2PI2A 1K8A1 1Q812 2R6GA 3G4SA 3FHWA 1S72Z 5EAYA 1C0AA 3I7FA 4JI7Q 3CCMZ 4LF8Q 3CPWZ 3M85A 1VQBA 1N32L 1IYJB 5IYCG 1Y1WI 4B3ML 2V1CC 4HJ9A 1VQ9Z 2LIYA 3KF6B 3UE0A 1L0WA 1BBUA 4DV3Q 3H3VH 4ME3A 4A3BG 4BBRI 1RL2A 1ZH1A 3S1QH 4JI8L 1VQPA 4APVA 3HOYH 1RO0A 2JA7H 1S3OA 2R7FA 5IP9I 3CC21 2BA0A 4DR2Q 3H3VJ 3AQQA 1W2BY 1N34Q 1PH9A 5IWAQ 4A3KG 4X62L 5FLXb 2R7ZI 1VQLA 1KD12 4DV7L 2KCMA 1XMQQ 3I4MG 2WAQA 4DV1L 4A3FI 1J6QA 4QIWE 1TWFH 3M4PA 4RVFA 3PF5A 1Q8KA 1HR0L 2JA8I 3CCUZ 3DM3A 1RNIA 1KIXA 1C7YA 2OTJ1 2UUBQ 1IBMQ 2PMZE 3CCU1 3LUSA 1M1K1 4A3EH 1XPOA 4B3MQ 1YBYA 1YJ91 3RLNA 1VQ71 1YHQZ 3CXCA 2DE7A 1KD1C 3KOJA 1RO4A 4BY1H 4Y52H 5IP7H 2IY5B 4NBBA 5M3MH 4A3JH 3EERA 1HNZL 4B3RQ 1YJW1 2QA4A 2B63G 3T1YL 2VQFQ 4EX5A 2UUCQ 2A19A 3HOUG 3F2BA 3RZOH 2JS4A 1LYLA 2LXKA 2VUMI 4NBGA 1LTLA 4JI3L 1EQQA 3D9XA 4A3IG 1VQ4A 4X66L 4DV1Q 4HIMA 1CUKA 4C3HH 1B8AA 3S24A 1YJWA 1BKBA 3M7NA 1JJGA 5BR8Q 2N3SA 1SN8A 2YU9H 2P28A 2NVXI 1NJIC 1QZHA 3ERSX 3RZDH 1K732 3BZCA 3KIHA 3CCRZ 3I4NI 1M901 3BU2A 1M1K2 4PZ7A 5C44G 4Y52I 1W2BA 3STBD 3CXCY 4A3DG 1B7YB 1SROA 3S2HI 2Q4ZA 3PO3I 3KLWA 3W1BA 2NN6G 4E2YA 1TWAI 5C4XI 1GM5A 1Z47A 1DGSA 1Q12A 4FDBA 1M1KC 2AKLA 4WJ3M 1Y1VH 2OCEA 4DQYB 1MJCA 2XGTA 4R4QA 3AEVA 3J80i 3HOWI 3NFZA 2E2HH 4HJ7A 2UU9L 3GTPI 4DR6L 5C0XJ 2AHOB 5FJ8H 3K0XA 2VW9A 4LUOA 4DV5Q 3J80b 3VDYA 3VMGA 4RVHA 4AIMA 5D1OA 1VQ6A 1IBKL 3CP0A 3HOVG 3J80c 2MO1A 3H3VI 5AN9F 1OXUA 1QUQB 3CMA1 3S17H 2YTYA 3HOYI 1G51A 1XNRQ 3J7A5 4NBCA 4P75A 1Z03A 1YNXA 1Y1WH 3IFUA 1M902 3NH8A 1KC81 1SE8A 5LMUQ 3PUYA 2KBNA 2VUGA 3J81i 2NVYI 4AYBA 4BBRG 4GOPB 1VQN1 2A8VA 3S2HH 4NXNL 5AJ3Q 3CCQ1 2ZTEA 5JEAJ 3JC66 4DKAC 3GCFA 3CXCZ 1P9NA 1QVFA 3PV0A 2ZJQA 4AYBE 2PNHA 4PZ6A 5FLXc 2JE6I 4DR6Q 2K5VA 4MH4A 5JJLA 2KHIA 2JUBA 4RV9A 2H5XA 4POFA 1EYGA 4P71A 1TFIA 1K8AC 3HOVH 3PSIA 2C35B 5C4JH 4QY7A 2R93H 3AFQA 1VCIA 4DV4Q 3S1RH 1I5FA 1T9HA 3K7UC 3H0GG 1E1OA 3KF8B 2ZAEB 3PUZA 4AQYQ 2B3GA 1VQK1 3K8AA 2OTJZ 1X3ZA 3CD61 3TQYA 1YUAA 4GN3B 3GD7A 3OW2Z 2F3IA 3AYHB 3EEDA 2PMZA 3BG1B 3MZKB 1CKMA 4A3GG 2PM9A 3CC71 1WYDA 3QWUA 1N8R1 2QLVB 2AKWB 4NBHA 1A62A 1BVSA 3CC7Z 2GVBA 4A3JG 2J6AA 1D7QA 5C3EG 4DR2L 3CME1 4A3II 3RZOI 2E2JI 4DR3Q 5DLQE 1YHQA 2A1AA 1YIJA 4X6AI 2R92G 2D0PA 5M5WH 1TWGI 4P74A 1PHJA 1GD7A 1C9OA 1UEBA 3GDEA 1Z9FA 1QYPA 3ULLA 2E5LL 2K5RA 1YJN1 4YCUA 1EWIA 2M6NA 1ASYA 1R9TH 3GTOI 3OTOL 4K0KL 1NP6A 3ICEA 1KRTA 1LUZA 4UPAA 1I50I 3S1RI 4DV6Q 1HJPA 1Q7Y2 2Y0SA 4LWCA 2VL6A 3I07A 2QEX1 1KC8C 3VTNA 4JOIC 3ESWA 3J81c 1WJJA 3HOZI 1NTGA 2QEXZ 2Q2UA 1AE2A 5M3MG 1YJNA 3RNUA 4NXMQ 2KCTA 5IP9H 1JJ2Y 2DE6A 1QVGZ 2MQHA 2K5NA 4X65Q 4E33A 1WI5A 3U4VA 3OW2Y 1GVPA 3CCEA 1V43A 3CCJ1 4YHHL 4PG3A 1W3SA 3I4NG 3H15A 5M5XH 1UE5A 5J3BA 1X6OA 2NZOA 3PUWA 5GQOA 4GKKL 3HOVI 1WW9A 5FLMI 3CCM1 3CCE1 1I94Q 2NVQH 5IYBH 1PH3A 2R7DA 2DGYA 4JG2A 3PO2I 1LQLA 3GTJI 2BA1A 3MONA 3OTOQ 4K0KQ 1KL9A 3J81j 2IZ4A 4QTTA 3NENA 5AJ3L 1HNZQ 4TQUS 3HKZA 4NB9A 4NH1C 3CCQA 4B3TL 2NN6I 5GAHC 4A76A 4XIGS 5E7NA 4LF6Q 1KXLA 4LF7Q 2JMOA 3CCS1 4NXML 3I561 4A75A 4JCVE 2AWNA 4IJHA 3GTGH 2CFMA 3PIOA 1N8RC 3S1QI 4UP9A 3CC4A 2V8IA 3S1NH 1CKOA 1PV4A 5JEAG 3G71Z 3TS0A 2JEAI 1QUQA 1TWHI 1N36Q 2R93I 4DNIA 3MEFA 1WCMG 1NJI2 1RO2A 1PH4A 4LFBL 1XMOQ 3IF8A 2QRCB 4NBEA 2I5HA 1XMQL 2JA5I 2VZAA 1TWCH 4A3LG 1EUJA 1YUKA 2OWOA 1PH8A 4A3DI 1YJWZ 4IPGA 4BY1I 4HJAA 5IT9c 2JA5H 1KQSY 2RIQA 4GLAC 2I5MX 4LFCQ 2I0QA 1YIJ1 1EOVA 2B29A 2JA6H 3BZKA 1I50H 4HGZA 1VQKZ 5LMNL 1OXTA 4A3GH 4DGLA 3G6E1 1S7MA 3E0EA 4PZ8A 2OQKA 2Y0SG 1K3RA 1DL6A 4A4IA 3G6EZ 3FKIG 3TE5B 2EGTA 4MD7A 2K4KA 4GN5A 1EFWA 1YEZA 3CC41 2JA5G 2VQFL 1N33L 2WFWA 1Y1VI 4MONA 4IJLA 4OWTB 2ZM6Q 3DLLA 3D6WA 3KIFA 1Y1VG 3OW2A 4RVGA 3S1MH 3CMEA 2GTHA 1SMXA 3L2PA 2CCZA 1WCMH 2B63H 4E2XA 1NJI1 1VQ8A 2GTIA 3F3PC 2HF1A 4DAYB 4MXUA 2Q2TA 1P16A 1VQ61 2B63I 2YU9I 3IRBA 5ELOA 2R7ZG 4DR1L 2G2KA 3CC7A 1M90C 1VQFA 1PFSA 2NVYH 2WP8J 1KAWA 4HIDA 1Q82C 1UE1A 1X55A 2QREB 5T67A 2JA8G 3H0GH 5GAEC 2JA7I 3JAMf 3F3FC 1FJGQ 2NVXH 3HOUH 1V9PA 3UE1A 1VQ8Z 2RHQB 1SRUA 1G6PA 3CPFA 5K36G 3K7AH 2JA6I 5IYDG 4YCVA 1VQPZ 2R7ZH 2Y0SE 3U58A 2EQSA 3CMAA 1W2BZ 3W5OA 3RLOA 1XJVA 3S16H 1K83H 5IP9G 3UDXA 3I4MI 1E22A 2Q2IA 5GAGC 4GKKQ 1N34L 5JJIA 4BY7I 3J81b 4A3LH 1K8A2 4A93H 2HHHL 3NDIA 1RIPA 4GKJQ 2JQOA 2BH2A 3VMHA 1YHAA 3CCVZ 2JA8H 2RBLA 3G6EA 4MTNA 4BXXH 4UP8A 3CCLA 3CCV1 3L0OA 1JT8A 5T64A 5HY6A 3B6YA 2VQEQ 2HHHQ 2IHEA 1I6HI 4TVAB 4ALPA 1VQ91 4RG1A 5C0XG 4L5RC 1EIYB 1SLJA 3J80f 1Y14B 2O4HA 4RVDA 2XTIA 3CAMA 1JE5A 1TWGH 3PO2G 1K731 1NE3A 4X6AH 3GO5A 1KQSZ 4QL5A 3CD6A 2QGQA 3BJUA 1G291 3STBC 1Z02A 4JC0A 1WOCA 1VQGA 2HU9A 1XNQL 4LUVA 3S15H 2LFUA 3GTQI 4DR4Q 1UE6A 4YWMA 3RZDI 3KJOA 2KI7B 3U50C 4LF5L 4YY3L 1USPB 4DV0L 2ALYB 4OXPA 1GKHA 4LF4Q 3S15I 1Q862 1NY4A 3ER0A 1K0RA 4A3BI 3U4ZA 2F52A 4YCWA 1O7IA 4A3KH 1HZAA 2RHBA 1XMOL 3FKIH 4H02A 1YI21 2R92I 1K83I 2YV5A 5M3FH 1QZGA 1VQMA 4A3CH 2W04A 4KI0A 1YI2Z 2UXDL 2VY3A 5C4XG 4JI4L 1VQAA 3JAMc 2R92H 3PUVA 4BBSH 4NOZA 5C44H 1Q86C 2IZ3A 4DK1A 3AFPA 2L15A 3I56A 2EIFA 3L7ZC 4IOAA 2RPRA 1YZ6A 1OTCA 2UUBL 4A3CI 3HKSA 4JI4Q 1YIJZ 4EWCA 1PYSB 3NELA 1YJ9A 4L5TA 3CCJA 3CMEZ 4JI0L 1Q821 4J15A 2ZM6L 1RQFA 4P73A 4LF4L 4GOPC 4X62Q 3KDFA 5BR8L 1X0TA 4EQ5A 3MXNB 2WAQG 4IOCA 2VNUD 3NH4A 3GTLI 4JI2Q 3PGZA 4BY7H 4L5QA 3TRZA 4NB3A 4BXXI 3T4NB 2IHFA 4QQBX 3CQZH 1VLAA 1YJNZ 2QRDB 5T6BA 4HIKA 3FQMA 1X56A 2JJQA 4JBKA 1Q811 2ASBA 4DUZL 3I55A 4X66Q 4GOPA 3CCUA 5IT9b 2QR1B 4BBSI 2NZHA 2HQLA 1ZB9A 4BA2I 1FJGL 5H1SE 4GS3A 4GLVB 4Y7NI 1X9NA 4DV2Q 4DV7Q 4IFDG 4LF8L 3K80C 2JEBI 1AE3A 2QA4Z 2UUAL 3J7A4 4IO9A 5JJKA 4JI0Q 3H0GI 3K7AI 2HIXA 3GTPH 4E2WA 4JI6Q 4OO1I 4IPHA 3HFZB 3S1NI 2KHJA 2E2IH 1JJ2Z 2IT1A 1VQ81 5IYCH 3PIPA 3A5ZB 3I4MH 4NFRA 4IPDA 1JJ2A 4JI3Q 3F8TA 4OWXB 1VQP1 2ATWA 2M48A 2WB1A 4XTCS 2DUDA 1N36L 3W1GA 4A3MH 4R4OA 4A3GI 2ZJRA 2VF1A 1NMGA 3ULPA 4JI7L 1VS0A 1WFQA 4JBJA 1RLYA 3S14I 3PCOB 1QVFY 4LW1A 1YI2A 3RR5A 2OTLZ 2RF4A 3G71A 3CCSA 5LL6f 4DV4L 4DV5L 2CWPA 4LUZA 4E30A 4MRIA 3HOXH 3GTJH 4DV3L 4OX9L 1FL0A 1D8LA 1VQNZ 2V8JA 2LSSA 4E31A 3I2ZA 4GNXC 1SFOI 2MNAA 4BBRH 1XTDA 2JK8A 4DAMA 1VQCA 2AMCB 3T1HQ 1Q1BA 1I3QI 5LMNW 2MO0A 2E2II 2OZKA 1X65A 1IBLL 3F2CA 5C3EH 1HZ9A 1TWCI 1U5KA 2O53A 1WIIA 1VQ5A 4LF6L 5IYDH 1UE7A 1VQJA 2K14A 4UY8C 1ML8A 4JOIA 4L5SA 4AH6A 2V8KA 1GO3E 4DUYQ 3CCVA 1YITA 3GTGI 2IX0A 3PO3H 2H85A 1XNRL 4MNOA 4NBAA 4A3DH 5IP7I 3HOYG 4LF9L 2N49A 5C4XH 5A2Qf 1IXRA 1FGUA 4YWKA 1YIT1 4LFBQ 1BBWA 3CW2C 3MZLB 1CSQA 4A3JI 5LMUL 2Z6KC 2E2HI 1TXYA 1YITZ 4YWLA 1PH2A 3RN5A 4QGUA 4DV6L 2NVTI 4DV2L 4QTUA 2D0OA 4P72A 3CQZI 3GTMI 1AH9A 3CCL1 5D1PA 3LGJA 2NVTH 3HOXG 4LF9Q 1K8GA 3Q8DA 2UUAQ 3CCLZ 1N33Q 2E8GA 1H95A 1LM0A 4UP7A 1Q46A 3CCMA 3ULJA 1NBWA 3GTQH 2K52A 1VQMZ 3F2DA 2E2JH 1V1QA 2PQAA 3K81C 3UDIA 3FP9A 2BH8A 4JI8Q 1QVCA 1HZCA 1ZB8A 3JAMi 2YADA 3KFUA 1Q7YC 1N32Q 2W03A 3FKII 4S1TA 1U0LA 4JI5Q 4XX2A 1KC82 2ZTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QL5 A;  3CD6 A;  2R93 G;  1L1O B;  1CKM A;  4NPS A;  4LFA Q;  4A3G G;  5C4J I;  4B3S L;  2QGQ A;  2RCN A;  1WYD A;  3BJU A;  2KPI A;  1G29 1;  2AKW B;  4JBW A;  4NBH A;  1Q81 C;  1XNQ Q;  2BJO A;  3A5U A;  1IZ6 A;  3STB C;  4B3T Q;  1A62 A;  1BVS A;  1J5E L;  3PUX A;  4JC0 A;  1WOC A;  2KEN A;  1VQG A;  5ELN A;  3CF5 A;  1XNQ L;  2GVB A;  4LUV A;  4A3J G;  3S15 H;  3KF6 A;  2J6A A;  4DR4 L;  1D7Q A;  4DR4 Q;  3GTQ I;  5C3E G;  4DR2 L;  1UE6 A;  1X3G A;  3HKZ E;  4A3I I;  2YYZ A;  4YWM A;  4JI5 L;  1KQS A;  3RZD I;  3KJO A;  1PA6 A;  3U50 C;  3HOU I;  3RZO I;  3PF4 A;  2E2J I;  3EN2 A;  1PFT A;  3TEH B;  4DR3 Q;  3RN2 A;  5DLQ E;  4YY3 L;  3KYH C;  1S72 A;  4LF5 L;  1I6H H;  3M3Y I;  1USP B;  1VQN A;  4DV0 L;  2ALY B;  2WB1 E;  1GKH A;  4OXP A;  3J7Z C;  1VQI A;  3S15 I;  2A1A A;  5FLM H;  1YHQ A;  2P3Y A;  4LF4 Q;  2Q2H A;  1YIJ A;  5C44 I;  1E1T A;  1NY4 A;  3ER0 A;  1PH6 A;  1K0R A;  1PH7 A;  2VUM H;  3VB9 A;  4X6A I;  2MFI A;  2ZTD A;  2R92 G;  4A3B I;  2CWA A;  2D0P A;  5M5W H;  3U4Z A;  1TWG I;  2YTV A;  2F52 A;  4P74 A;  1PHJ A;  3GTM H;  4YCW A;  3S17 I;  1GD7 A;  1C9O A;  1O7I A;  4A3K H;  1J5E Q;  4DK6 C;  1HZA A;  1UEB A;  1XMO L;  3FKI H;  5M5Y H;  3GDE A;  4DR7 Q;  1Z9F A;  4H02 A;  2PI2 A;  1QYP A;  1HNW L;  4GNX A;  3ULL A;  2R6G A;  1NUI A;  4IFD I;  2E5L L;  2R92 I;  1K83 I;  2YV5 A;  3FHW A;  3G4S A;  5M3F H;  1VQM A;  1QZG A;  4A3C H;  4KI0 A;  5EAY A;  3S14 H;  1C0A A;  2Z0S A;  2K5R A;  3I7F A;  4YCU A;  4JI7 Q;  1EWI A;  4NBF A;  2UXD Q;  4LF8 Q;  2UXD L;  2VY3 A;  1ASY A;  1R9T H;  3GTO I;  4X65 L;  4JI4 L;  1VQA A;  3OTO L;  3M85 A;  3JAM c;  3ICE A;  2GVA A;  2R92 H;  1VQB A;  4BBS G;  4K0K L;  3CPW A;  3PUV A;  4R4I A;  1KRT A;  4BBS H;  3S16 I;  1N32 L;  4NOZ A;  1IYJ B;  5C44 H;  1NMF A;  1Q86 C;  1PH5 A;  5IYC G;  1Y1W I;  2OQ0 A;  4B3M L;  4OX9 Q;  3AFP A;  2V1C C;  2L15 A;  4HJ9 A;  1HR0 W;  3I56 A;  4GKJ L;  1Y1V S;  1LUZ A;  3ZJY C;  4GNX B;  2EIF A;  4UPA A;  3L7Z C;  1I50 I;  3S1R I;  4DV6 Q;  5HGQ A;  3KF6 B;  4IOA A;  1HJP A;  3UE0 A;  4LWC A;  1L0W A;  3HOW H;  1BBU A;  4DV3 Q;  1YZ6 A;  3H3V H;  4ME3 A;  1OXV A;  2VL6 A;  1OTC A;  2UUB L;  3UDF A;  4A3C I;  4A3B G;  1P8L A;  4BBR I;  1CSP A;  3HKS A;  1KHI A;  4JI4 Q;  1RL2 A;  3I07 A;  4DK3 C;  4JI8 L;  1VQP A;  1K73 C;  4LFA L;  1KC8 C;  4APV A;  2JA7 G;  3HOY H;  4JOI C;  2JA7 H;  3NEL A;  1PYS B;  1HNX Q;  3ESW A;  1YJ9 A;  1S3O A;  4L5T A;  2R7F A;  3J81 c;  3CCJ A;  3S1M I;  1WJJ A;  4JI0 L;  2HT1 A;  4J15 A;  3HOZ I;  2ZM6 L;  5IP9 I;  1NTG A;  4DR2 Q;  2BA0 A;  2UXC Q;  3H3V J;  3AQQ A;  2Q2U A;  1AE2 A;  1WCM I;  5M3M G;  4P73 A;  1YJN A;  3RNU A;  2K5H A;  2KCT A;  4A3F G;  1N34 Q;  4LF4 L;  4NXM Q;  4GOP C;  4X62 Q;  1PH9 A;  3GTK H;  1SFO H;  5IP9 H;  3KDF A;  5IWA Q;  5BR8 L;  4A3K G;  4X62 L;  2DE6 A;  4EQ5 A;  2R7Z I;  2MQH A;  3MXN B;  2WAQ G;  2K5N A;  4IFD J;  1VQL A;  4X65 Q;  4DV7 L;  2KCM A;  4A3E G;  3GTK I;  1WI5 A;  1R9T I;  3U4V A;  4IOC A;  1GVP A;  3CCE A;  1XMQ Q;  1V43 A;  3I4M G;  2VNU D;  4DV1 L;  4A3F I;  5FLM G;  4YHH L;  3GTL I;  1J6Q A;  4PG3 A;  1W3S A;  4JI2 L;  4JI2 Q;  4QIW E;  1HNX L;  3PGZ A;  3I4N G;  3H15 A;  1USP A;  1TWF H;  4BY7 H;  5M5X H;  1UE5 A;  3M4P A;  4L5Q A;  5J3B A;  3TRZ A;  1CKN B;  1X6O A;  2HIV A;  4BXX I;  2NZO A;  4NB3 A;  3PF5 A;  1Q8K A;  1JJC B;  2IHF A;  1HR0 L;  2JA8 I;  3PUW A;  5GQO A;  3CQZ H;  4QQB X;  4GKK L;  1VLA A;  1X54 A;  3HOV I;  1WW9 A;  1I94 L;  4JBM A;  4DR7 L;  5C4X G;  2PK7 A;  4AQY L;  3DM3 A;  4JV5 Q;  5FLM I;  1I94 Q;  4HIK A;  2NVQ H;  5IYB H;  1PH3 A;  1E24 A;  1KIX A;  1C7Y A;  2VQE L;  1X56 A;  2UUB Q;  2R7D A;  2DGY A;  2PMZ E;  4JG2 A;  3PO2 I;  1S40 A;  2JJQ A;  1IBM Q;  1LQL A;  3LUS A;  4JBK A;  2ASB A;  4A3E H;  4DUZ L;  4KLK A;  1XPO A;  3GTJ I;  5LMN Q;  1YBY A;  3M9B A;  3I55 A;  4B3M Q;  2BA1 A;  4X66 Q;  3RLN A;  1PVO A;  1TWA H;  3OTO Q;  3CXC A;  4K0K Q;  2DE7 A;  1KL9 A;  4GOP A;  1KD1 C;  3KOJ A;  1K9M C;  3M3Y H;  3J81 j;  1RO4 A;  3CCU A;  4QTT A;  1E3P A;  4BY1 H;  4Y52 H;  5IP7 H;  4BBS I;  3NEN A;  1L2F A;  1X3F A;  2NZH A;  3M4Q A;  1MKH A;  4JI1 L;  4DPG A;  5IP7 G;  5AJ3 L;  4JYA L;  2IY5 B;  4NBB A;  1VQ7 A;  4A93 I;  2OTL A;  1VQE A;  2HQL A;  4NBD A;  1VQ9 A;  5M3M H;  4A3J H;  1ZB9 A;  3EER A;  3OYY A;  1HNZ L;  4GLX A;  1HNZ Q;  1FJG L;  4O0A A;  5H1S E;  4BA2 I;  3A0J A;  4B3R Q;  4TQU S;  4A3K I;  2QA4 A;  4GS3 A;  2B63 G;  4GLV B;  4Y7N I;  1X9N A;  4DV2 Q;  4DV7 Q;  4IFD G;  3E9I A;  4LF8 L;  2F4O A;  4NB9 A;  3D31 A;  2DE5 A;  3CCQ A;  3K80 C;  3T1Y L;  4DR1 Q;  2VQF Q;  2JEB I;  4B3T L;  2NN6 I;  3I4O A;  5GAH C;  1L1O A;  4A76 A;  4XIG S;  1AE3 A;  2N78 A;  4EX5 A;  4A93 G;  5E7N A;  2UUC Q;  2A19 A;  2UUA L;  4C2M H;  3HOU G;  3F2B A;  4IO9 A;  2JS4 A;  3RZO H;  1LYL A;  5JJK A;  4O2D A;  4JI0 Q;  3H0G I;  4LF6 Q;  3K7A I;  2HIX A;  3VMI A;  4LF5 Q;  2UXC L;  1KXL A;  2LXK A;  4LF7 Q;  3GTP H;  2VUM I;  4JI6 Q;  4NBG A;  4DV0 Q;  4OO1 I;  1XPU A;  1LTL A;  4IPH A;  3HFZ B;  4R4T A;  3HOX I;  4NXM L;  4NXN Q;  1EIF A;  3S1N I;  4DR3 L;  4BY1 G;  4JI3 L;  1JMC A;  2D62 A;  1VQK A;  2KHJ A;  1EQQ A;  2E2I H;  2IT1 A;  3M4O I;  2AWN A;  4JCV E;  4LFC L;  5IYC H;  3PIP A;  4IJH A;  4A75 A;  4DR5 L;  3GTG H;  1KRS A;  2CFM A;  3A5Z B;  3PIO A;  4A3I G;  1N8R C;  4IPD A;  1JJ2 A;  4JI3 Q;  3I4M H;  4A3I H;  3S1Q I;  1VQ4 A;  4X66 L;  4UP9 A;  3CC4 A;  4X64 L;  3M4O H;  3F8T A;  3KDF B;  4OWX B;  3S1N H;  4A3M I;  2ATW A;  4DV1 Q;  4HIM A;  1CUK A;  1CKO A;  1UWV A;  4C3H H;  1YVC A;  4XTC S;  1B8A A;  5IYB G;  3CC2 A;  4C3I H;  2F4V Q;  1PV4 A;  5JEA G;  2GN5 A;  3S24 A;  3TS0 A;  1YJW A;  1N9W A;  2JEA I;  1QUQ A;  1BKB A;  1TWH I;  2DUD A;  1N36 L;  3SGI A;  1N36 Q;  3M7N A;  3WWV A;  1JJG A;  2R93 I;  3A74 A;  4DNI A;  1OXX K;  3W1G A;  5BR8 Q;  4A3M H;  2N3S A;  4R4O A;  2E5L Q;  1SN8 A;  2K75 A;  3MEF A;  1WCM G;  2YU9 H;  4A3G I;  1A8V A;  2ZJR A;  3GTM S;  2NVX I;  2F4V L;  1PH4 A;  1NJI C;  2PI2 E;  1NMG A;  1QZH A;  3ERS X;  3ULP A;  3RZD H;  4JI7 L;  4LFB L;  1XMO Q;  1PYB A;  1VS0 A;  1WFQ A;  1MIU A;  4NBE A;  4PMW A;  2I5H A;  4JBJ A;  1RLY A;  4X64 Q;  3S14 I;  3BZC A;  3PCO B;  1XMQ L;  3S2D H;  4LW1 A;  1VQO A;  1YI2 A;  2JA5 I;  2VZA A;  3I4N I;  1TWC H;  4A3L G;  3RR5 A;  4DUY L;  1EUJ A;  5C3E I;  3BU2 A;  4HJ8 A;  2OWO A;  1I3Q H;  4PZ7 A;  1PH8 A;  4A3D I;  2RF4 A;  3G71 A;  2WB1 G;  3CCS A;  4IPG A;  4DV4 L;  4WJ4 A;  4BY1 I;  4JYA Q;  5C44 G;  3GKQ A;  4Y52 I;  4DV5 L;  4HJA A;  3STB D;  5IT9 c;  1W2B A;  2JA5 H;  2CWP A;  3NBH B;  4GLA C;  2I5M X;  4LUZ A;  3HOX H;  4LFC Q;  4MZ9 A;  2OTJ A;  2I0Q A;  1EOV A;  2B29 A;  2JA6 H;  3Q87 A;  3GTJ H;  4DV3 L;  4A3D G;  3BZK A;  1I50 H;  4POG A;  4OX9 L;  5LMN L;  1B7Y B;  1SRO A;  1FL0 A;  1D8L A;  1OXT A;  4A3G H;  3HOZ H;  2LSS A;  3E0E A;  4PZ8 A;  3S2H I;  3TS2 A;  3PO3 I;  2OQK A;  3HKZ G;  3I2Z A;  2Y0S G;  3KLW A;  1K3R A;  4GNX C;  3W1B A;  4A3C G;  1SFO I;  1DL6 A;  2NN6 G;  4A4I A;  2MNA A;  3FKI G;  4BBR H;  3CCR A;  4BY7 G;  1XTD A;  3GTO H;  4JI6 L;  3I4N H;  2JK8 A;  4RMF A;  4DAM A;  4Y7N H;  1X3W A;  1YHB A;  1TWA I;  1VQC A;  3EIV A;  2AMC B;  5C4X I;  2K4K A;  3T1H L;  3T1H Q;  1GM5 A;  1Z47 A;  1DGS A;  1Q12 A;  4FDB A;  1M1K C;  4GN5 A;  3KJP A;  2IX1 A;  1Q1B A;  4OWW B;  2EXD A;  2AKL A;  1EFW A;  4WJ3 M;  3UDG A;  1I3Q I;  1YEZ A;  5LMN W;  1Y1V H;  4OO1 G;  2OCE A;  1N2F A;  2MO0 A;  1MJC A;  4GN4 B;  2JA5 G;  2E2I I;  2VS1 A;  2XGT A;  4R4Q A;  2VQF L;  1X65 A;  1IBL Q;  1Y1W G;  1IBL L;  1N33 L;  2WFW A;  1Y1V I;  1VQD A;  3HOW I;  3J80 i;  3AEV A;  2E2H H;  4HJ7 A;  2UU9 L;  4IJL A;  4OWT B;  2UU9 Q;  3F2C A;  3GTP I;  4DR6 L;  5C3E H;  1HZB A;  5C0X J;  1FVI A;  2AHO B;  5FJ8 H;  2ZM6 Q;  1OXS C;  1HZ9 A;  3K0X A;  3E9H A;  1TWC I;  1U5K A;  2VW9 A;  3DLL A;  4LUO A;  4DV5 Q;  4HJ5 A;  1E7Z A;  4AYB G;  1VQ5 A;  4LF6 L;  3D6W A;  3OW2 A;  1Y1V G;  1JB7 A;  4YY3 Q;  2FXQ A;  3S1M H;  5IYD H;  3CME A;  1UE7 A;  3VDY A;  1VQJ A;  1SMX A;  2K14 A;  3VMG A;  3L2P A;  4AIM A;  2CCZ A;  1VQ6 A;  1IBK L;  3CP0 A;  4R1J A;  1IBK Q;  4UY8 C;  2JA6 G;  3HOV G;  1WCM H;  1ML8 A;  3J80 c;  4JOI A;  4L5S A;  4AH6 A;  1PH1 A;  2B63 H;  2MO1 A;  3H3V I;  1GO3 E;  1OXU A;  2I5L X;  1QUQ B;  4DUY Q;  4HIO A;  1VQ8 A;  3S17 H;  2YTY A;  2ZJP A;  2HF1 A;  4DAY B;  3HOY I;  3CCV A;  1G51 A;  1YIT A;  1XNR Q;  3PO2 H;  2JA9 A;  2K50 A;  4C3J H;  1A0I A;  3GTG I;  1P16 A;  4NBC A;  2IX0 A;  5FJ8 G;  2Q2T A;  3J7A 5;  3PO3 H;  4JV5 L;  2B63 I;  2YU9 I;  3IRB A;  4P75 A;  5ELO A;  2ID0 A;  1YNX A;  2R7Z G;  1XNR L;  4DR1 L;  2ES2 A;  4MNO A;  1Y1W H;  1CKN A;  3CC7 A;  4OON A;  1M90 C;  4NBA A;  4A3D H;  1VQF A;  1ASZ A;  1PFS A;  2NVY H;  4BA1 I;  2WP8 J;  5IP7 I;  1IL2 A;  1QVG A;  3HOY G;  2CKZ B;  4LF9 L;  2N49 A;  1KAW A;  1SE8 A;  5C4X H;  1IXR A;  1FGU A;  4YWK A;  5IE8 A;  4HID A;  5LMU Q;  3PUY A;  4LFB Q;  1BBW A;  1Q82 C;  3CW2 C;  4A3L I;  1UE1 A;  4KHZ A;  2KBN A;  2NVQ I;  1CSQ A;  1X55 A;  4A3J I;  2JA8 G;  3GTL H;  3H0G H;  3J81 i;  5LMU L;  4LNQ A;  2JR6 A;  2NVY I;  2JA7 I;  1HH2 P;  2Z6K C;  5GAE C;  1FJG Q;  3HOW G;  2E2H I;  1TXY A;  4B3R L;  4KHP L;  3TRE A;  4R4C A;  4BBR G;  2NVX H;  4YWL A;  3HOU H;  4GOP B;  1PH2 A;  5IWA L;  1V9P A;  3UE1 A;  2A8V A;  3S2H H;  4NXN L;  3RN5 A;  5AJ3 Q;  1Q1E A;  4QGU A;  2RHQ B;  1SRU A;  4DV6 L;  4LF7 L;  2ZTE A;  2NVT I;  3G48 A;  3JC6 6;  5JEA J;  3GCF A;  4DKA C;  4B3S Q;  2UXB L;  4DV2 L;  1G6P A;  4QTU A;  2D0O A;  4P72 A;  3CQZ I;  3CPF A;  3GTM I;  1QVF A;  3HOZ G;  3S1Q H;  3K7A H;  5K36 G;  1AH9 A;  3PV0 A;  2JA6 I;  5IYD G;  2ZJQ A;  4AYB E;  4YCV A;  4A3B H;  2PNH A;  3LGJ A;  5GRO A;  5GAD C;  4PZ6 A;  3HOX G;  2UUC L;  4A3M G;  1X3E A;  4LF9 Q;  1K8G A;  2NVT H;  2VUM G;  5FLX c;  2R7Z H;  2JE6 I;  3Q8D A;  2Y0S E;  3U58 A;  4DR6 Q;  3PO3 S;  2EQS A;  2K5V A;  2Z6K A;  5C0X I;  3CMA A;  4MH4 A;  3W5O A;  2RHS B;  3RLO A;  1XJV A;  1HR0 Q;  2E8G A;  2UUA Q;  1N33 Q;  5JJL A;  3S16 H;  1K83 H;  5IP9 G;  2WAQ E;  1TWH H;  3I4M I;  2KHI A;  3UDX A;  3F1Z A;  2JNY A;  1E22 A;  3PO3 G;  2Q2I A;  1H95 A;  1VQH A;  5GAG C;  2H5X A;  4POF A;  5M3F G;  1EYG A;  4GKK Q;  1N34 L;  5JJI A;  1TWF I;  4BY7 I;  4A3L H;  1IBM L;  4A93 H;  2UXB Q;  4P71 A;  1LM0 A;  1TFI A;  4UP7 A;  2HHH L;  1Q46 A;  4DR5 Q;  1K8A C;  1RIP A;  4BXX G;  4QJF A;  3CCM A;  3HOV H;  3ULJ A;  4YHH Q;  1NBW A;  3PSI A;  2CQO A;  2AWO A;  4GKJ Q;  2JQO A;  2BH2 A;  3GTQ H;  4JI1 Q;  2N8N A;  2C35 B;  5C4J H;  4QY7 A;  2R93 H;  3VMH A;  1YHA A;  2K52 A;  3F2D A;  3AFQ A;  1HNW Q;  2E2J H;  1V1Q A;  1VCI A;  4DV4 Q;  3S1R H;  2PQA A;  3K81 C;  2JA8 H;  2RBL A;  4A3E I;  3FP9 A;  2BH8 A;  4MTN A;  1I5F A;  3UDI A;  3G6E A;  1T9H A;  1MJE A;  4BXX H;  3K7U C;  3H0G G;  2PQA B;  1E1O A;  4UP8 A;  3S2D I;  3CCL A;  2QEX A;  3KF8 B;  1A63 A;  3L0O A;  3D0F A;  3PUZ A;  1QVC A;  3EBE A;  4JI8 Q;  5IY0 A;  4AQY Q;  1HZC A;  2B3G A;  3B6Y A;  5HY6 A;  2VQE Q;  1JT8 A;  3T1Y Q;  1ZB8 A;  3K8A A;  3JAM i;  2HHH Q;  2IHE A;  1SR3 A;  4NB8 A;  1I6H I;  1X3Z A;  4TVA B;  4ALP A;  3TQY A;  2LXJ A;  1L1O C;  1YUA A;  4GN3 B;  3GD7 A;  4RG1 A;  1Q7Y C;  3KFU A;  1N32 Q;  1B70 B;  3FKI I;  2YTX A;  3RLF A;  2F3I A;  3NEM A;  5C0X G;  4DUZ Q;  1EIY B;  5CM2 M;  1XPR A;  1SLJ A;  4L5R C;  4KHP Q;  1EQR A;  3AYH B;  1U0L A;  4JI5 Q;  1Y14 B;  4XX2 A;  2XTI A;  2F4M A;  3CAM A;  4A3F H;  1JE5 A;  1TWG H;  3PO2 G;  4IPC A;  1NE3 A;  4X6A H;  3GO5 A;  2ZTC A; 
#chains in the Genus database with same CATH topology
 4IUR A;  2K3R A;  1HTP A;  1L1O B;  4LFA Q;  2E9H A;  3KLS A;  3GQB A;  4B3S L;  4PQX A;  2RCN A;  2Q8I B;  2SDF A;  1QCB D;  3K5O A;  2K5Q A;  3A5U A;  4KV6 A;  2MJ8 A;  2Z9H A;  4IAL A;  1J5E L;  4MHE A;  2JIP A;  5ELN A;  3CF5 A;  1F9S A;  1L0Y B;  3P7J A;  4DR4 L;  3HOU B;  1X3G A;  3HKZ E;  4JI5 L;  1BQQ T;  5FO7 B;  1PA6 A;  2QA4 1;  3CC2 Z;  3PF4 A;  3EN2 A;  3TEH B;  3RN2 A;  1S72 A;  2KEE A;  1SE4 A;  3M3Y I;  1Z6H A;  3CCJ Z;  2F0S A;  3W2D A;  3J7Z C;  5FLM H;  2QKI C;  1WTX A;  3P5J B;  2I46 A;  5C44 I;  1E1T A;  3W3A A;  1PH7 A;  3VB9 A;  3GP7 A;  2MFI A;  2CWA A;  5L37 A;  2YTV A;  3GTM H;  2F0P A;  1C4Q A;  3QR8 A;  3A8J E;  4CDD C;  1J5E Q;  4LJZ C;  4DK6 C;  3FDT A;  4ZK9 B;  1D5Z C;  5M5Y H;  3EVQ A;  4DR7 Q;  1RTN A;  3A54 A;  1HNW L;  4GNX A;  4IUQ A;  5M3M B;  2MPM A;  1NUI A;  1VQO 1;  1CHQ D;  4IFD I;  3VR4 A;  2LFN A;  1IW7 C;  4ID6 A;  2N88 A;  3S14 H;  4K2K A;  2Z0S A;  5CV5 A;  1VQO Z;  4NBF A;  2UXD Q;  1HPC A;  4ODG A;  1SYF A;  4X65 L;  4BBS G;  2GVA A;  2SOB A;  3CPW A;  3BYY B;  4R4I A;  2Z4H A;  3S16 I;  2F0I A;  1NMF A;  3VYS A;  1PH5 A;  2X69 A;  2OQ0 A;  2X6G A;  1U4P A;  4OX9 Q;  1NR2 A;  1VQ7 Z;  3I90 A;  1HR0 W;  2AQ1 B;  5C3E B;  4GKJ L;  1Y1V S;  3ZJY C;  1SNC A;  4GNX B;  1I4Q A;  1Y8N B;  5HGQ A;  5J22 A;  5C4J B;  2OTL 1;  3FPU B;  3HOW H;  3P1H A;  1PLF A;  4MD8 A;  2F0L A;  4MIU A;  1OXV A;  2VPY A;  1SE2 A;  3UDF A;  1P8L A;  1CSP A;  1F2M A;  1KHI A;  2DN8 A;  1JWH C;  4DK3 C;  1K73 C;  1AZP A;  4LFA L;  2JA7 G;  1E2V A;  4ULL A;  1MSH A;  1HNX Q;  3S1M I;  2HT1 A;  2UXC Q;  3CCS Z;  1WCM I;  3A7L A;  3IFT A;  1N8R 2;  4J6H A;  2K5H A;  3I56 Z;  4LK1 C;  4A3F G;  3GTK H;  1YNJ D;  1QB5 D;  2K5W A;  1SFO H;  4EVO A;  2VB3 X;  4A3G B;  2E75 C;  2Q51 A;  1SBB B;  1J8I A;  4IFD J;  4RWS C;  4OGQ C;  2GU2 A;  4A3E G;  3GTK I;  2JA7 B;  3FQQ A;  1R9T I;  1B44 D;  5FLM G;  1V1P B;  3G71 1;  4PNY A;  4JI2 L;  4HGY A;  3WDN A;  3NDJ A;  3IX0 A;  1HNX L;  1USP A;  4E2Z A;  4HN7 A;  3S2H B;  3S9W A;  1CKN B;  2HIV A;  4S3S A;  5FLX f;  3G4S Z;  1JJC B;  1QNU A;  2OEO A;  3CRK C;  1X54 A;  1I94 L;  4JBM A;  4DR7 L;  1STY A;  2PK7 A;  4AQY L;  4JV5 Q;  1AEX A;  3G4S 1;  1E24 A;  2L55 A;  2VQE L;  1S40 A;  1U4M A;  4KLK A;  5LMN Q;  2BOS A;  3M9B A;  3DEO A;  3D6C A;  4X3K A;  4LMQ D;  4IZ8 A;  3BG0 B;  1PVO A;  1TWA H;  4V0B A;  4A93 B;  1Y8P B;  5DM7 3;  4CDF C;  1LLR D;  3TDH B;  4WRD A;  3M3Y H;  2J0T D;  1E2W A;  1K9M C;  1E3P A;  2F0M A;  1SYE A;  2EVB A;  1L2F A;  1X3F A;  3M4Q A;  3PMF A;  1MKH A;  4JI1 L;  4DPG A;  5IP7 G;  4JYA L;  2K32 A;  3HS0 C;  1VQ7 A;  4A93 I;  3A56 A;  2OTL A;  1VQE A;  1K83 B;  4NBD A;  1VQ9 A;  3S1N B;  3OYY A;  3VR2 A;  4GLX A;  1WTP A;  4O0A A;  3A0J A;  5C6A A;  4A3K I;  1PDQ A;  3E9I A;  2F4O A;  1T5E A;  3D31 A;  2DE5 A;  3NSW A;  4DR1 Q;  2L12 A;  1SXT A;  2SNS A;  1AFP A;  1Z01 A;  3DEP A;  1L1O A;  3I4O A;  4A93 G;  2QKD A;  1Q7Y 1;  2N78 A;  1H9R A;  2VUM B;  1WVL A;  1SYB A;  4C2M H;  2QDB A;  1SJE D;  4FF2 A;  4O2D A;  2UXC L;  3F2U A;  3VMI A;  4LF5 Q;  5FKA C;  1I6H B;  4DV0 Q;  3H0G B;  1XPU A;  4C3H G;  1K9M 2;  4R4T A;  4NXN Q;  3HOX I;  2VPW A;  3CC4 Z;  1EIF A;  4DR3 L;  4BY1 G;  1Y1V B;  1JMC A;  2D62 A;  2K1B A;  1VQK A;  3M4O I;  4LFC L;  3K59 A;  5FO9 B;  4DR5 L;  1UAP A;  1KRS A;  4A3I H;  1PZK D;  2QEJ C;  2AYD A;  4X64 L;  3M4O H;  5BN3 A;  3KDF B;  4A3M I;  2LMC B;  4U67 3;  1UWV A;  1B3A A;  1YVC A;  4CDC C;  5IYB G;  3CC2 A;  4C3I H;  1EWC A;  3NTI A;  2GN5 A;  4JPB W;  1N9W A;  5D14 A;  3SGI A;  3WWV A;  1YNJ C;  2PQE A;  5BN4 A;  3A74 A;  4HED A;  1OXX K;  3IAY A;  4MD9 A;  2E5L Q;  2K75 A;  2WKC A;  4QUC A;  2QF7 A;  1A8V A;  3GTM S;  2F4V L;  2PI2 E;  5A2Q b;  1RKN A;  1VQL Z;  3CCE Z;  1ENF A;  1PYB A;  1MIU A;  4PMW A;  2JA5 B;  4X64 Q;  3P20 A;  3S2D H;  1VQO A;  4DUY L;  1VQL 1;  5C3E I;  5KYL A;  4HJ8 A;  3I73 A;  1I3Q H;  5HGT A;  5IT9 E;  3HRZ C;  3CMA Z;  1KLU D;  2WB1 G;  2IWH A;  3L3O C;  5C0X H;  3IL8 A;  2CH4 W;  4JYA Q;  4WJ4 A;  3GKQ A;  4BY7 B;  3CPW Y;  2A69 D;  2KED A;  3NBH B;  4MZ9 A;  2OTJ A;  1XTC D;  3Q87 A;  4OEL B;  3LNN A;  4ZLT F;  2E2D C;  4POG A;  1SAP A;  1G8Z D;  3QIA A;  3HOZ H;  3TS2 A;  3NWT A;  3HKZ G;  1F77 A;  2DJF C;  3TN2 A;  1A3U A;  4A3C G;  2BDN A;  2RVL A;  3CCR A;  1TWH B;  4BY7 G;  1FNV A;  3GTO H;  4JI6 L;  3I4N H;  4RMF A;  1Y8O B;  4G57 A;  5KIX A;  4Y7N H;  1X3W A;  3OHX C;  1HFG A;  1YHB A;  3EIV A;  2EYO A;  3E5S A;  3T1H L;  2A74 C;  3MZ5 A;  1CA6 A;  2I3C A;  3KJP A;  2IX1 A;  4KY5 A;  3CCQ Z;  5KGU A;  1CZG A;  4TSS A;  4OWW B;  2B2Y A;  2EXD A;  3UDG A;  4OO1 G;  3NH5 A;  1N2F A;  1BR9 A;  4GN4 B;  3VYR A;  2VS1 A;  5C3W A;  1K9M 1;  1D5M C;  2FIN B;  3AB9 A;  4CJ1 B;  3V96 A;  1Y1W G;  1IBL Q;  5NUC A;  2R6M A;  1VQD A;  4KY7 A;  2UU9 Q;  3K5L A;  3UI2 A;  2N55 A;  1STG A;  1H9M A;  1HZB A;  1FVI A;  2HCI A;  1OXS C;  3E9H A;  2XN9 C;  3ZYY X;  4C56 C;  4HJ5 A;  1E7Z A;  3GTL B;  4AYB G;  1B9N A;  1JB7 A;  4YY3 Q;  2FXQ A;  4CKC A;  1YJ9 Z;  1STH A;  1YHQ 1;  4R1J A;  2RDG A;  5I4D A;  1IBK Q;  2JA6 G;  3N6R A;  1ESF A;  2OOX B;  3T56 B;  1PH1 A;  4MTK A;  1SND A;  1SNO A;  1Y1W B;  2I5L X;  1W6J A;  4HIO A;  2ZJP A;  2Y0S B;  2WII B;  3SR1 A;  3PO2 H;  2JA9 A;  2K50 A;  3KBX A;  1A0I A;  3FKI B;  4C3J H;  5FJ8 G;  3TP8 A;  4JV5 L;  5CV8 A;  4C3H B;  2ID0 A;  2VB2 X;  5CV9 A;  1CKN A;  4OON A;  5M5W B;  3OPO A;  1ASZ A;  1HUM A;  1IL2 A;  1QVG A;  2CKZ B;  5D1O B;  5IE8 A;  2NVQ B;  3BG3 A;  1A3V A;  3CD6 Z;  4A3L I;  4KHZ A;  2NVQ I;  1QWY A;  5G3L F;  1LT6 D;  1PRT C;  1ESR A;  3GTL H;  2G9H D;  4DA2 A;  4LNQ A;  2JR6 A;  2RT9 A;  2O4X A;  1HH2 P;  4R8I A;  3HOW G;  4B9W A;  4F87 A;  4BXX G;  4B3R L;  4KHP L;  3TRE A;  4R4C A;  1EYC A;  4TNU A;  3DWQ A;  1CHP D;  1KDB A;  5EPJ A;  1VQ4 1;  3HGB A;  3DMU A;  5IWA L;  2E2H B;  3BDC A;  1Q1E A;  4X3U A;  4XXE A;  5T1G A;  1O80 A;  4LF7 L;  3I55 Z;  3G48 A;  2BCO A;  2XRS D;  4B3S Q;  3J7A F;  2UXB L;  4XYQ A;  3HOZ G;  2IPK D;  2A68 D;  1VQ4 Z;  3VR5 A;  4ME5 A;  4A3B H;  2UUC L;  5GRO A;  5GAD C;  4RS4 A;  1QVF Z;  3OMG A;  1X3E A;  4A3M G;  2VUM G;  3I55 1;  1HTL D;  1GUW A;  1Q86 1;  1TVX A;  4CHT B;  3PO3 S;  1EIG A;  1DYQ A;  2Z6K A;  4NKL A;  5C0X I;  4Y7N B;  2RHS B;  1HR0 Q;  5J1Z A;  4DXF A;  2B2U C;  2WAQ E;  1TWH H;  3PO3 G;  3F1Z A;  2JNY A;  1ET9 A;  1PFN A;  1VQH A;  3T13 A;  5M3F G;  2PZT A;  3A7A B;  1LTA D;  1JOR A;  5IGC A;  1JQY D;  4E32 A;  1TWF I;  4BY1 B;  4DAP A;  4CL1 A;  4PV1 C;  1IBM L;  2UXB Q;  3CU7 A;  4DR5 Q;  4FP5 D;  4QJF A;  3CCR 1;  4YHH Q;  2NYZ D;  4HMJ A;  2CQO A;  2AWO A;  1PTO D;  4JI1 Q;  2N8N A;  2E74 C;  3J81 f;  2JA8 B;  1HNW Q;  4A3E I;  1FD7 D;  4DF7 A;  1RCV D;  1MJE A;  2PQA B;  5IGG A;  3S2D I;  2I07 B;  3KBG A;  2QEX A;  1KDC A;  1CK1 A;  1A63 A;  2O2L D;  3D0F A;  2OOY B;  3EBE A;  2AUK A;  5IY0 A;  2ES2 A;  5M5X B;  3S2D B;  3ERQ A;  3T1Y Q;  2JN4 A;  1BUV T;  1VQ5 1;  1SR3 A;  4NB8 A;  1VQ6 Z;  3NBH A;  1IL8 A;  1L1O C;  2LXJ A;  4U68 A;  5CYU A;  1B70 B;  3NWS A;  3RLF A;  2YTX A;  3NEM A;  4DUZ Q;  4KHP Q;  5CM2 M;  1XPR A;  1EQR A;  4KD3 A;  2C9O A;  1VQ5 Z;  1F9R A;  2F4M A;  4A3F H;  3SE0 A;  3HG9 A;  4IPC A;  1U4L A;  2K7V A;  4BA1 I;  1RJT A;  2Q8R E;  1QVG Y;  1NUC A;  3MHB A;  5EPL A;  2R7Z B;  1Q82 2;  4NPS A;  2R93 G;  5C4J I;  1U9R A;  5C5M A;  2FMC A;  3M4O B;  2KPI A;  4JBW A;  2BDO A;  4A3I B;  2BJO A;  1Q81 C;  1XNQ Q;  1IZ6 A;  4B3T Q;  1KRL A;  3S1Q B;  1D6E C;  3PUX A;  2XVS A;  2KEN A;  4J8Q A;  3KF6 A;  1KD1 1;  3MFG A;  2YYZ A;  3ITP A;  4KHV A;  1KQS A;  5CC4 A;  3HOU I;  2NZ1 D;  2L0C A;  1PFT A;  1I6H H;  3D4D A;  3KYH C;  1TU2 B;  1VQN A;  1PRT B;  3RZO B;  2F4V Q;  2WB1 E;  4C2M B;  1VQI A;  2P3Y A;  4HH4 A;  2PCF B;  5IT9 f;  2Q2H A;  5ELE A;  1PH6 A;  2VUM H;  3BVG A;  2ZTD A;  3ND9 A;  3K57 A;  3JAM b;  3S17 I;  1VQM 1;  1R9T B;  1S72 1;  1STN A;  4IUN A;  1QF8 A;  1G2T A;  1ZXT A;  3G6J B;  4L63 B;  5JAV A;  2PI2 A;  3A8I E;  4H44 C;  5FLX E;  5ELD A;  1K8A 1;  1Q81 2;  2CQA A;  2R6G A;  5CGK A;  3G4S A;  3FHW A;  1S72 Z;  2MHV A;  1CM9 A;  5EAY A;  1C0A A;  1WCM B;  3I7F A;  3JAM E;  4JI7 Q;  3CCM Z;  1WTV A;  4LF8 Q;  3CPW Z;  1EEI D;  5COR A;  4JK1 C;  3T51 B;  3M85 A;  1VQB A;  1IKM A;  3TSS A;  4PMC A;  1N32 L;  5FOB B;  1IYJ B;  5EKL A;  4Z9C B;  5I9P A;  5IYC G;  1SNP A;  1Y1W I;  4B3M L;  5TSS A;  2V1C C;  3BS1 A;  4HJ9 A;  4RGT A;  1VQ9 Z;  4R8N A;  2LIY A;  3H09 A;  3KF6 B;  1PRT F;  3OIP A;  3UE0 A;  1L0W A;  1BBU A;  3HZX A;  5C4Z A;  4DV3 Q;  1Q8I A;  3H3V H;  4ME3 A;  1HQR D;  2VPZ A;  4A3B G;  4BBR I;  1DJR D;  2Z1C A;  3DWP A;  4I7A A;  1RL2 A;  1ZH1 A;  3S1Q H;  4JI8 L;  1VQP A;  4APV A;  2KVM A;  3HOY H;  5CV4 A;  1RO0 A;  2JXM B;  2JA7 H;  3MXU A;  1S3O A;  1MI2 A;  2R7F A;  2MGS A;  3OIQ A;  5IP9 I;  3CC2 1;  2BA0 A;  4DR2 Q;  3H3V J;  3AQQ A;  1HA5 A;  1RDP D;  1UEA B;  1Q90 A;  1W2B Y;  2ZXP A;  1N34 Q;  1PH9 A;  3GTK B;  2LEX A;  2EYH A;  2NAP A;  5IWA Q;  1GOZ A;  4A3K G;  2F0K A;  4X62 L;  5FLX b;  2R7Z I;  1I50 B;  1VQL A;  1KD1 2;  4DV7 L;  2KCM A;  5ELC A;  1EY8 A;  3Q22 A;  2A6E D;  1XMQ Q;  3I4M G;  2WAQ A;  3NHH A;  4A3F I;  4DV1 L;  1J6Q A;  4QIW E;  3R2I A;  2EJF C;  3A8K E;  1TWF H;  1HA6 A;  3M4P A;  4RVF A;  3NP8 A;  4P2C B;  3PF5 A;  1SYC A;  1Q8K A;  3VR6 A;  1HR0 L;  2JA8 I;  5JJZ A;  2ICI A;  2L9H A;  2DJG C;  3CCU Z;  5A35 A;  1TWC B;  3DM3 A;  3S1R B;  1RNI A;  2FJ2 A;  2F0T A;  1KIX A;  2R93 B;  1C7Y A;  2OTJ 1;  2UUB Q;  1IBM Q;  2PMZ E;  3CCU 1;  3LUS A;  1SYG A;  1M1K 1;  4M8A A;  4A3E H;  1O7Y A;  1XPO A;  4R9W A;  4B3M Q;  1YBY A;  4XQJ A;  1YJ9 1;  3RLN A;  1VQ7 1;  1YHQ Z;  1Y8C A;  3CXC A;  2DE7 A;  3PQI A;  2F03 A;  2A73 B;  5COY A;  1GHJ A;  3KOJ A;  4C3J B;  1KD1 C;  1RO4 A;  4BY1 H;  4Y52 H;  5IP7 H;  2IY5 B;  3MVV A;  2B2W C;  4NBB A;  3IKJ A;  2NB0 A;  5M3M H;  4A3J H;  3EER A;  1HNZ L;  4B3R Q;  1YJW 1;  2QA4 A;  2B63 G;  1O7Z A;  2K04 A;  5IOC A;  2EJM A;  4QF4 A;  3T1Y L;  2ZXR A;  2VQF Q;  4EX5 A;  1EU3 A;  4HSV A;  1EY0 A;  3J7A V;  1R4Q B;  1PTO B;  2UUC Q;  1J9O A;  2A19 A;  4IUT A;  3SXH A;  4Q5V A;  3HOU G;  3F2B A;  2HCC A;  3RZO H;  2JS4 A;  1LYL A;  3E6Z X;  1ICW A;  1UNS A;  2LXK A;  2VUM I;  1EOT A;  3NK9 A;  1PTO H;  4DAY A;  4NBG A;  2PW7 A;  2J7Z A;  1EWH A;  1LTL A;  3OWF A;  4JI3 L;  1EQQ A;  3D9X A;  5E1F A;  2D2C C;  4FXG C;  4A3I G;  3M7G A;  3SK4 A;  1VQ4 A;  4X66 L;  1EY5 A;  1BBX C;  3SHL A;  4DV1 Q;  4G4K A;  4HIM A;  1CUK A;  4KD4 A;  4C3H H;  1B8A A;  1F2Y A;  3S24 A;  1YJW A;  3PO2 B;  1BKB A;  3M7N A;  5FLX L;  1JJG A;  3SDZ A;  3S17 B;  5BR8 Q;  2N3S A;  1SN8 A;  2YU9 H;  2P28 A;  3VYT A;  2NVX I;  5K36 H;  3J7Y W;  3QG1 A;  1NJI C;  1QZH A;  3ERS X;  3RZD H;  1K73 2;  1BCP F;  2R3Z A;  3BZC A;  3C1F A;  3KIH A;  3CCR Z;  4M1U B;  3I4N I;  3NQT A;  1I3Q B;  3DM1 A;  1M90 1;  3ONA B;  3BU2 A;  2NWG A;  5JVH 3;  2WKD A;  1M1K 2;  2G9D A;  4PZ7 A;  1H9S B;  1G2S A;  3LX0 A;  2RCF A;  5ELB A;  5C44 G;  4Y52 I;  1GUN A;  1T5X D;  1W2B A;  3STB D;  2H1E A;  1AA6 A;  3MEH A;  3CXC Y;  1QIL A;  2CW0 C;  4A3D G;  5EBC A;  2K33 A;  5I6W A;  1S5E D;  1F2Z A;  2YU9 B;  1B7Y B;  1SRO A;  4QMG A;  2IV2 X;  3S2H I;  1EZ6 A;  3TDQ A;  2Q4Z A;  3PO3 I;  1WTO A;  3KLW A;  3U9S A;  3W1B A;  1O78 A;  2NN6 G;  2CW0 D;  1JOO A;  3R2T A;  1SJH D;  4DFA A;  4E2Y A;  2F0V A;  1TWA I;  5C4X I;  4HCE A;  1GM5 A;  3HOZ B;  1Z47 A;  1DGS A;  1Q12 A;  1EYA A;  4FDB A;  1M1K C;  4K6L A;  1ZEQ X;  3KLS X;  2NVT B;  2K05 A;  2AKL A;  4WJ3 M;  2IJ0 A;  1TY0 A;  1Y1V H;  2OF1 A;  2OCE A;  4DQY B;  3K5N A;  1MJC A;  1RHP A;  1VDZ A;  2XGT A;  4R4Q A;  3AEV A;  3J80 i;  3HOW I;  3NFZ A;  3C1E A;  2E2H H;  2L11 A;  4HJ7 A;  2UU9 L;  3GTP I;  3FRP B;  4DR6 L;  5C0X J;  2AHO B;  5FJ8 H;  2A68 C;  3K0X A;  1S5D D;  1KLG D;  2VW9 A;  4X3S A;  4LUO A;  5EJW A;  2LY7 A;  4DV5 Q;  3MFY A;  3J80 b;  2K28 A;  5IGB A;  1PFM A;  1CI3 M;  3VDY A;  2NTT A;  2ICE C;  3VMG A;  4RVH A;  4AIM A;  3OW7 A;  5D1O A;  2M00 A;  3MXN A;  1VQ6 A;  1IBK L;  3CP0 A;  4MN3 A;  3HOV G;  3J80 c;  3NUC A;  4A3J B;  1H9K A;  2MO1 A;  3H3V I;  5AN9 F;  1OXU A;  1QUQ B;  3T16 A;  3CMA 1;  3S17 H;  2V3V A;  1B9M A;  2YTY A;  4QCL A;  3HOY I;  1G51 A;  2TSS A;  1XNR Q;  3EFX D;  3K6O A;  3J7A 5;  4NBC A;  3R8B A;  4C3I B;  1X3P A;  1FR3 A;  4P75 A;  1Z03 A;  1YNX A;  5JOB A;  1Y1W H;  2BE5 C;  3IFU A;  4A3E B;  1M90 2;  3NH8 A;  1KC8 1;  1FDI A;  3J80 L;  5I9O A;  1SE8 A;  5LMU Q;  3PUY A;  4C3J G;  1DZ1 A;  2KBN A;  5LL6 X;  2VUG A;  3J81 i;  2NVY I;  4AYB A;  4N9P A;  4BBR G;  4GOP B;  4CKB A;  1VQN 1;  3I91 A;  2A8V A;  3S2H H;  4NXN L;  3QOL A;  5AJ3 Q;  2EYJ A;  3MA2 B;  3CCQ 1;  1A2T A;  2ZTE A;  5JEA J;  3JC6 6;  4DKA C;  3GCF A;  2Z6B A;  3CXC Z;  1X3Q A;  1P9N A;  3ERO A;  1QVF A;  1D2B A;  2F0J A;  3E3X A;  3PV0 A;  2ZJQ A;  4AYB E;  3K0Y A;  2PNH A;  2ZT9 C;  4PZ6 A;  1DD2 A;  5FLX c;  5A2Q E;  2JE6 I;  4DR6 Q;  1TY2 A;  2K5V A;  3FEW X;  2F1M A;  2VPX A;  3I4L A;  4MH4 A;  4G7H C;  5JJL A;  3FMC A;  4H0L C;  1BF4 A;  2KHI A;  2JUB A;  4RV9 A;  2H5X A;  4RGM A;  4POF A;  3RMH A;  1EYG A;  1LTR D;  5EPK A;  4DNT B;  5KRU A;  2ENB A;  3M3Y B;  2WAQ B;  1HUN A;  3QB3 A;  4P71 A;  2PZW A;  1TFI A;  4ILW A;  3CKI B;  1K8A C;  3HOV H;  1RF2 D;  3PSI A;  5FK9 C;  2C35 B;  5C4J H;  4QY7 A;  2R93 H;  3AFQ A;  2PMZ B;  5C5L A;  5HUR A;  1VCI A;  4DV4 Q;  3S1R H;  1CT1 D;  2OXP A;  3BVZ A;  3Q24 A;  1I5F A;  2XWB B;  2L4N A;  1T9H A;  1X32 A;  5IOD A;  3K7U C;  3H0G G;  3G7L A;  1E1O A;  5EQ0 A;  3KF8 B;  2ZAE B;  3I3C A;  3PUZ A;  4AQY Q;  3DXJ C;  2B3G A;  1VQK 1;  3PIP 3;  3K8A A;  2OTJ Z;  4HAE A;  1X3Z A;  3CD6 1;  3TQY A;  1YUA A;  1KNA A;  3NTK A;  1Q16 A;  3GD7 A;  3MWY W;  4GN3 B;  3OW2 Z;  1SSO A;  2XIW A;  2F3I A;  2F0H A;  1TS5 A;  4DN4 M;  1HCZ A;  2DY8 A;  3AYH B;  1LTG D;  4ZAI A;  3EED A;  2PMZ A;  4TKO B;  3BG1 B;  4I65 A;  1BNZ A;  1K8M A;  5DNF A;  3MZK B;  2QCP X;  1IYU A;  1CKM A;  4A3G G;  2PM9 A;  4A3B B;  1HRJ A;  3CC7 1;  1WYD A;  3D4R A;  1B53 A;  3QWU A;  1N8R 1;  2QDL A;  2QLV B;  2AKW B;  4NBH A;  3J81 L;  3HOY B;  1A62 A;  1BVS A;  1JIC A;  1NR4 A;  3CC7 Z;  2GVB A;  4A3J G;  5E4X A;  2J6A A;  5K5P A;  1D7Q A;  4EGV A;  1LT5 D;  2K01 A;  5C3E G;  4DR2 L;  3CME 1;  4A3I I;  1ICF B;  1BCP C;  2EY5 A;  2NUC A;  3RZO I;  4DXG A;  2E2J I;  4DR3 Q;  5DLQ E;  1A15 A;  5EBD A;  3Q6S A;  1EY4 A;  2A1A A;  1YHQ A;  5ELF A;  1YIJ A;  2WIN B;  4X6A I;  2O5I C;  3VYU A;  2IX3 A;  4RFB A;  5IGF A;  2R92 G;  2D0P A;  5M5W H;  1PZI D;  4RH6 A;  1TWG I;  4P74 A;  1TS2 A;  1PHJ A;  4EQO A;  2EYP A;  1JOQ A;  1GD7 A;  1C9O A;  2EE1 A;  1UEB A;  1LTS D;  2CH4 A;  3GDE A;  3LWU A;  1C48 A;  1Z9F A;  3D3R A;  1QYP A;  3ULL A;  3QWN A;  4A3F B;  2E5L L;  3DWA A;  4C1N K;  4B9X A;  3NPP A;  2K5R A;  1YJN 1;  4YCU A;  1EWI A;  2M6N A;  5CMD A;  1M8A A;  1QOH A;  1ASY A;  1R9T H;  3GTO I;  3OTO L;  4K0K L;  1NP6 A;  2KEC A;  3ICE A;  1Y69 U;  2EYL A;  1KRT A;  3FPP A;  1GUG A;  2EYM A;  4ZKB B;  3MXP A;  1S5B D;  1I4X A;  2F3V A;  1LUZ A;  2ZXO A;  4UPA A;  1I50 I;  3S1R I;  4DV6 Q;  1HJP A;  1Q7Y 2;  1BCP B;  2Y0S A;  4LWC A;  4FF3 A;  2CHB D;  1BOS A;  3OWE B;  4KN4 C;  4UHV A;  2F3W A;  2VL6 A;  5EGT A;  3KK7 A;  1TR5 A;  1MGS A;  4CGY B;  1M4V A;  4Q0F A;  3I07 A;  2QEX 1;  1KC8 C;  2RQX A;  2SEB D;  3VTN A;  4JOI C;  3ESW A;  3J81 c;  3I4N B;  4K8I A;  1WJJ A;  4KN7 C;  3HOZ I;  2L1B A;  5CBA E;  1NTG A;  1VMC A;  2LS0 1;  2QEX Z;  2Q2U A;  1AE2 A;  5M3M G;  1YJN A;  3RNU A;  4NXM Q;  2KCT A;  4NW2 A;  5IP9 H;  2AQ3 B;  1JJ2 Y;  2DE6 A;  1QVG Z;  2MQH A;  3GV6 A;  2JIR A;  2K5N A;  5FO8 B;  4X65 Q;  3BZD B;  4RKL A;  4F88 A;  3T53 B;  4E33 A;  1WI5 A;  3U4V A;  4RCN A;  3OW2 Y;  1GVP A;  3CCE A;  1V43 A;  3CCJ 1;  3HP3 A;  4YHH L;  4PG3 A;  1W3S A;  1TKW B;  3I4N G;  3H15 A;  5M5X H;  1UE5 A;  5J3B A;  2RKS A;  1X6O A;  2NZO A;  2FHT A;  1GJX A;  1I4P A;  3C46 A;  2EJG C;  3PUW A;  5GQO A;  3LWE A;  4GKK L;  3HOV I;  1WW9 A;  5DEH A;  1EIH A;  1DOL A;  1PXU A;  2QIL A;  1EL0 A;  3EA6 A;  5FLM I;  3CCM 1;  3CCE 1;  3BYT B;  3ND8 A;  1EZ8 A;  1I94 Q;  2NVQ H;  5IYB H;  1PH3 A;  3GTQ B;  2R7D A;  1AN8 A;  2DGY A;  4JG2 A;  3PO2 I;  4HR7 B;  1LQL A;  3DUZ A;  4OHJ A;  4XQN A;  1GUT A;  4NDX A;  5I2Y A;  3GTJ I;  1JWU D;  4EQP A;  2BA1 A;  3VA7 A;  1LT4 D;  3MON A;  3OTO Q;  4FF4 A;  1EY7 A;  2KQ3 A;  4K0K Q;  1KL9 A;  2SNM A;  3J81 j;  2IZ4 A;  4QTT A;  3S14 B;  3NEN A;  5AJ3 L;  5KYI A;  5M3F B;  3R93 A;  1HNZ Q;  3H3V C;  4TQU S;  3HKZ A;  4NB9 A;  1B2T A;  4NH1 C;  3CCQ A;  2B2T C;  1EYD A;  5KND A;  4B3T L;  2NN6 I;  5GAH C;  2D5D A;  4A76 A;  5I6Y A;  4XIG S;  5C3X A;  5E7N A;  1LO5 D;  4K14 A;  3CHB D;  1MHW C;  5F2D A;  4LF6 Q;  1KXL A;  4LF7 Q;  2JMO A;  3CCS 1;  1QNK A;  4NXM L;  1W6K A;  2RDF A;  4L6T B;  1E0B A;  4HSP A;  3I56 1;  4A75 A;  1LTB D;  2AWN A;  2DY7 A;  4JCV E;  1NAP A;  1G91 A;  4IJH A;  2A5H A;  3GTG H;  2CFM A;  3PIO A;  1N8R C;  1ONL A;  1SYD A;  3U9O A;  3S1Q I;  4UP9 A;  1XWE A;  1B1Z A;  3CC4 A;  2A6E C;  2A6H D;  4KKS A;  2V8I A;  2JP1 A;  4DK0 A;  4DAV A;  4RAU C;  3S1N H;  2XNA C;  4DGZ A;  4XDX A;  1CKO A;  3H91 A;  1G6Z A;  1PV4 A;  5JEA G;  3G71 Z;  3TS0 A;  2JEA I;  1QUQ A;  1TWH I;  1N36 Q;  2KOL A;  2R93 I;  4DNI A;  2E7Z A;  2H4O A;  1TWA B;  3QO2 A;  3MEF A;  1WCM G;  1NJI 2;  2JIO A;  1F2L A;  1CQF A;  4WOR A;  1RO2 A;  1PH4 A;  4LFB L;  1XMO Q;  2FFK B;  3IF8 A;  1FNW A;  4KY6 A;  2QRC B;  4NBE A;  2I5H A;  4N8F A;  1B3Q A;  1XMQ L;  3D8G A;  2M2L A;  2JA5 I;  1HQM C;  2VZA A;  1TWC H;  4A3L G;  1EUJ A;  1NNX A;  2EOT A;  1YUK A;  2OWO A;  1I4R A;  1SDF A;  1PH8 A;  4A3D I;  3QOJ A;  1YJW Z;  1DXM A;  4IPG A;  4AYB B;  4BY1 I;  1TWF B;  4V19 0;  2JYO A;  4HJA A;  5IT9 c;  2JA5 H;  1KQS Y;  3EQL C;  2A69 C;  2RIQ A;  4GLA C;  4BS9 A;  2I5M X;  4O42 A;  4LFC Q;  1KTK A;  1YNN C;  2I0Q A;  1YIJ 1;  2O5J C;  1EOV A;  2B29 A;  2JA6 H;  3BZK A;  5AFW A;  1I50 H;  4RCO A;  4HGZ A;  4GZY C;  1VQK Z;  5LMN L;  1OXT A;  4A3G H;  4DGL A;  3G6E 1;  1S7M A;  3X3M A;  5C4H A;  4ZYS A;  3E0E A;  4PZ8 A;  1ENA A;  1SFO B;  1CFM A;  2BE5 D;  2OQK A;  2Y0S G;  2NN6 H;  1K3R A;  1DL6 A;  4BBR B;  4A4I A;  3G6E Z;  3FKI G;  3TE5 B;  1TT2 A;  2EGT A;  1Z7T A;  4MD7 A;  4DU9 A;  2DNE A;  4IUU A;  5M9O A;  2K4K A;  2HDL A;  4KJO A;  3TP7 A;  4GN5 A;  4K5X A;  1AW7 A;  4FXK C;  1EFW A;  1A6X A;  1YEZ A;  5JPM C;  3CC4 1;  3TZU A;  3GTJ B;  1JCK B;  1DM0 B;  1VMP A;  2JA5 G;  1EQV A;  1A2U A;  2VQF L;  2IL8 A;  1ET6 A;  3GTP B;  1N33 L;  2WFW A;  1Y1V I;  1B50 A;  2F0D A;  2WV6 D;  4MON A;  2F0U A;  4IJL A;  4OWT B;  1PYW D;  1KDA A;  2ZM6 Q;  1V1O A;  3DLL A;  3D6W A;  3KIF A;  1Y1V G;  3OW2 A;  4RVG A;  3JAM L;  3S1M H;  3CME A;  2GTH A;  1SMX A;  1S5F D;  3L2P A;  5C4X B;  3Q23 A;  4RGN A;  2CCZ A;  2F0Q A;  1WCM H;  5G3L D;  5DM6 3;  1WTR A;  2B63 H;  4E2X A;  3OOC A;  5KEE A;  2E76 C;  3SVM A;  1NJI 1;  1PZJ D;  2F0N A;  2GTI A;  1TII D;  1VQ8 A;  3F3P C;  4HMI A;  3PO3 B;  2HF1 A;  4WJW A;  4XT3 B;  4DAY B;  4ZKC B;  4B08 A;  4MXU A;  1K3B C;  2Q2T A;  1P16 A;  1VQ6 1;  2B63 I;  2YU9 I;  3IRB A;  1TQO A;  5ELO A;  3RUZ A;  4FVM A;  1JC7 A;  4N8X 1;  4DR1 L;  2R7Z G;  1ILP A;  1WZN A;  3M4Y A;  2G2K A;  3CC7 A;  1M90 C;  2B63 B;  3GTM B;  1ML0 D;  1VQF A;  3AU7 A;  1PFS A;  2NTS A;  2NVY H;  2WP8 J;  4TRD A;  5E4W C;  1KAW A;  4HID A;  1I4H A;  1I6V C;  1Q82 C;  4K5V A;  1UE1 A;  1RTO A;  3S1M B;  1X55 A;  2QRE B;  5T67 A;  2JA8 G;  1KNE A;  4L8J A;  3H0G H;  5GAE C;  2JA7 I;  3JAM f;  3F3F C;  3HEJ A;  1FJG Q;  1LAC A;  2NVX H;  3HOU H;  1V9P A;  3UE1 A;  4H13 C;  3IFD A;  4OIK A;  3MAQ A;  1VQ8 Z;  2RHQ B;  1SRU A;  1G6P A;  3KLR A;  4ZUI A;  3CPF A;  5K36 G;  1SMY C;  3K7A H;  2JA6 I;  5IYD G;  4YCV A;  1VQP Z;  5KNC A;  3WOE A;  5D3D A;  2R7Z H;  2Y0S E;  3U58 A;  2EQS A;  3HKZ B;  3CMA A;  1W2B Z;  3W5O A;  3RLO A;  1XJV A;  4G7O C;  3S16 H;  1K83 H;  5IP9 G;  3UDX A;  3I4M I;  1E22 A;  2Q2I A;  4K6D A;  4CJ2 C;  5GAG C;  2RDH A;  4GKK Q;  1SEB D;  1N34 L;  1QXF A;  4BY7 I;  1V1P A;  5JJI A;  3J81 b;  4A3L H;  1K8A 2;  2B39 A;  5A2Q L;  1HHV A;  4A93 H;  4IUP A;  1LAB A;  2HHH L;  4N9T A;  2JSO A;  3NDI A;  1EY6 A;  1RIP A;  4I7Z C;  2NBF A;  3P75 A;  1WTQ A;  3URY A;  1VF7 A;  1JE4 A;  4YIJ A;  2JQO A;  2BH2 A;  4GKJ Q;  1DCZ A;  2B2U A;  1SE3 A;  1MSG A;  4OEM B;  5E3F A;  3VMH A;  1YHA A;  5ISR A;  3CCV Z;  2M9V A;  2JA8 H;  2RBL A;  3G6E A;  4MTN A;  1H9S A;  4PMB A;  4BXX H;  3I70 A;  4UP8 A;  1WD1 A;  3CCL A;  1GHK A;  3CCV 1;  5C44 B;  3BVM A;  3L0O A;  1JT8 A;  5T64 A;  5HY6 A;  3B6Y A;  2VQE Q;  4KMU C;  1GXD C;  2HHH Q;  4K5W A;  1K8O A;  2IHE A;  3NE5 B;  1I6H I;  4TVA B;  3H94 A;  1VQ9 1;  4ALP A;  4RG1 A;  2KUM A;  2QW7 A;  2C5C A;  5C0X G;  4L5R C;  1EIY B;  1SLJ A;  3J80 f;  4RGO S;  1EY9 A;  2JIQ A;  1Y14 B;  2O4H A;  1PTO F;  4RVD A;  2XTI A;  3CAM A;  4DNR B;  1HFN A;  1JE5 A;  1TWG H;  3PO2 G;  1U4R A;  1D1I A;  1K73 1;  1NE3 A;  4X6A H;  3GO5 A;  1KQS Z;  4QL5 A;  3CD6 A;  4A3K B;  2QGQ A;  2R61 A;  3BJU A;  1LT3 D;  3E0J A;  1G29 1;  1IW7 D;  3X3N A;  4KKT A;  4HCS A;  3STB C;  4KK7 A;  3I4M B;  1Z02 A;  2MP1 A;  2V4D A;  4JC0 A;  1WOC A;  2KA7 A;  1VQG A;  2E2I B;  2HU9 A;  1XNQ L;  4LUV A;  3S15 H;  2LFU A;  3GTQ I;  1LTT D;  4DR4 Q;  1UE6 A;  1Q3L A;  4YWM A;  5CV6 A;  3HOW B;  3RZD I;  5LHY 1;  2KI7 B;  3KJO A;  3U50 C;  1WTH A;  4LF5 L;  4YY3 L;  4XYO A;  1USP B;  3Q0A A;  4DV0 L;  2ALY B;  4OXP A;  1GKH A;  4LF4 Q;  3S15 I;  3TP6 A;  1Q86 2;  4UAI A;  1NY4 A;  3ER0 A;  1FNU A;  1K0R A;  1XYI A;  1JOK A;  4A3B I;  2P5Z X;  3U4Z A;  2B2V C;  1SIW A;  2F52 A;  1IHZ A;  1OO9 B;  4YCW A;  4KKU A;  1O7I A;  4A3K H;  1HZA A;  2RHB A;  2PNR C;  3K58 A;  1XMO L;  5T1I A;  3FKI H;  4H02 A;  4NP5 A;  1FGB D;  1YI2 1;  2EXZ A;  5DAU A;  1ENC A;  2R92 I;  1K83 I;  2YV5 A;  5M3F H;  1QZG A;  1VQM A;  4A3C H;  4FYD A;  2W04 A;  2A6H C;  4KI0 A;  3NTH A;  1YI2 Z;  5J39 A;  2UXD L;  2VY3 A;  5C4X G;  1AZQ A;  4JI4 L;  1VQA A;  5I2X A;  3JAM c;  4IFD H;  2R92 H;  1ROD A;  3PUV A;  1H9J A;  4BBS H;  2F0W A;  4NOZ A;  1O7L A;  5C44 H;  1Q86 C;  2IZ3 A;  2K5D A;  2LKV A;  4FXD A;  4DK1 A;  3AFP A;  1D1K A;  2L15 A;  3I56 A;  1NSN S;  3AMU A;  3V05 A;  2EIF A;  3L7Z C;  4O1N A;  2WB1 B;  4IOA A;  4H7B A;  2RPR A;  1ZKO A;  4CJ0 B;  4FF1 A;  3V2T A;  1YZ6 A;  5JVG 3;  3S15 B;  1OTC A;  2UUB L;  4A3C I;  4XT1 B;  3HKS A;  5IIF A;  4JI4 Q;  1PMR A;  3CRL C;  3TZD A;  4ABN A;  1YIJ Z;  2XSC A;  4EWC A;  1PYS B;  3NEL A;  3T4A C;  1YJ9 A;  4L5T A;  3CCJ A;  2EZV A;  3CME Z;  2PO4 A;  4BWG B;  3GTO B;  4EQN A;  4JI0 L;  1Q82 1;  1S4Z A;  4J15 A;  2ZM6 L;  1RQF A;  3MXG A;  4P73 A;  4LF4 L;  1JWS D;  4GOP C;  4X62 Q;  3KDF A;  1MD2 D;  5CR3 A;  5BR8 L;  1X0T A;  2F4I A;  1STA A;  2AUJ D;  3VA5 A;  1STB A;  1CA5 A;  4EQ5 A;  3H6M A;  3MXN B;  2WAQ G;  2MUY A;  3K7A B;  3MC0 B;  2L5T A;  5IT9 L;  4IOC A;  2VNU D;  2F0E A;  3NH4 A;  3KUP A;  3GTL I;  4JI2 Q;  3L9A X;  3PGZ A;  4BY7 H;  4L5Q A;  3TRZ A;  4NB3 A;  1BDO A;  4BXX I;  4F7X A;  3TP5 A;  3T4N B;  2IHF A;  1I4G A;  1IKL A;  1AP0 A;  4QQB X;  3CQZ H;  3N52 A;  4UDU C;  1VLA A;  3D2L A;  1LV9 A;  1FDO A;  1YJN Z;  1RD9 D;  2QRD B;  2E2J B;  1ZYR C;  2PZU A;  3TME A;  5T6B A;  1XXG A;  4HIK A;  4HTH A;  1GUO A;  3FQM A;  1X56 A;  5EKK A;  4XQQ A;  2JJQ A;  5D3I B;  4ZCK A;  2F0F A;  4JBK A;  1Q81 1;  2ASB A;  4A3D B;  4DUZ L;  4BBS B;  2EPB A;  1WD0 A;  3I55 A;  4X66 Q;  5D65 A;  4A3M B;  4GOP A;  2AQ2 B;  1WJ2 A;  4WFN 3;  3CCU A;  5IT9 b;  1EFI D;  2QR1 B;  4BBS I;  1B4O A;  2NZH A;  2Z4I A;  3OMC A;  1GUS A;  2HQL A;  3NXW A;  2F0G A;  5CV7 A;  1ZB9 A;  2JIM A;  4BA2 I;  2XRQ D;  1FJG L;  4JW0 A;  5H1S E;  1V8Q A;  3RD4 A;  3NBI A;  1MBY A;  4GS3 A;  4GLV B;  4Y7N I;  1X9N A;  5IGD A;  4DV2 Q;  3SEB A;  4DV7 Q;  4IFD G;  4LF8 L;  4FO2 A;  3K80 C;  2JEB I;  2OT2 A;  2FMM A;  1AE3 A;  2B8F A;  1K28 A;  2QA4 Z;  1VF5 C;  2UUA L;  5BN5 A;  3J7A 4;  1F9P A;  4IO9 A;  5JJK A;  4JI0 Q;  3H0G I;  3K7A I;  2HIX A;  2V45 A;  2HDM A;  3GTP H;  3SK8 A;  4E2W A;  4JI6 Q;  4FNF A;  4OO1 I;  4IPH A;  3HFZ B;  3S1N I;  3PIO 3;  2B2Y C;  1EEF D;  2KHJ A;  1E2Z A;  1JJ2 Z;  2E2I H;  2IT1 A;  1VQ8 1;  5IYC H;  3PIP A;  3A5Z B;  3I4M H;  4NFR A;  2RA4 A;  4IPD A;  1JJ2 A;  4K8J A;  4JI3 Q;  4E6I A;  3F8T A;  4QB4 A;  2X6L A;  4OWX B;  1VQP 1;  2ATW A;  4RA8 A;  2M48 A;  2WB1 A;  4XTC S;  4IQZ A;  3J81 E;  4OIJ A;  3MTS A;  3O13 A;  2RBM A;  4RHS A;  2PW5 A;  2DUD A;  1N36 L;  1R4P B;  3I8Z A;  3W1G A;  3TBI B;  2B2T A;  4A3M H;  4R4O A;  1ZYR D;  4A3G I;  2ZJR A;  2VF1 A;  1CZW A;  1NMG A;  3BDO A;  3ULP A;  2KJX A;  4JI7 L;  4C1N I;  1VS0 A;  1WFQ A;  1CTM A;  4JVZ A;  3HOX B;  4JBJ A;  1RLY A;  5LL6 S;  3S14 I;  3PCO B;  1QVF Y;  3A55 A;  4LW1 A;  1YI2 A;  3RR5 A;  4LAA A;  3IR7 A;  4ZRZ A;  1KAA A;  2OTL Z;  5JEA H;  1JR0 D;  3C3L A;  2RF4 A;  3G71 A;  3CCS A;  5LL6 f;  1JWM D;  4DV4 L;  4DV5 L;  3D4W A;  2EY6 A;  4X3T A;  2CWP A;  4LUZ A;  4E30 A;  4MRI A;  3HOX H;  1EU4 A;  3GTJ H;  4DV3 L;  3HOV B;  3OSO A;  4OX9 L;  1FL0 A;  1D8L A;  5EKI A;  1QE6 A;  1VQN Z;  2V8J A;  2LSS A;  1C8C A;  2G5D A;  4E31 A;  3I72 A;  3I2Z A;  2VXW A;  4GNX C;  2HUG A;  1SFO I;  1YNN D;  2MNA A;  2HD3 A;  4BBR H;  4C3I G;  1XTD A;  2JK8 A;  4DAM A;  1VQC A;  2AMC B;  3T1H Q;  1PFB A;  3GTG B;  1Q1B A;  1I3Q I;  5LMN W;  2MO0 A;  2E2I I;  2OZK A;  1X65 A;  1IBL L;  1IYV A;  2RSO A;  2EY2 A;  3F2C A;  5C3E H;  2NVX B;  1SMY D;  1HZ9 A;  1PTO C;  1TWC I;  1U5K A;  3C2P A;  2O53 A;  4F8M A;  3EJI A;  1WII A;  1VQ5 A;  3K5M A;  4LF6 L;  4OO1 H;  4ZQ3 A;  5IYD H;  1UE7 A;  4J1M A;  1ILQ A;  1VQJ A;  2K14 A;  2XWJ B;  3WOF A;  1KAB A;  2GA4 B;  4UY8 C;  2NVY B;  2J4X A;  1ML8 A;  4JOI A;  2B8G A;  4KTA A;  4NMZ A;  4AH6 A;  2V8K A;  4L5S A;  1STE A;  1GO3 E;  4DUY Q;  1TS4 A;  3J80 E;  1DOM A;  1L0X B;  3CCV A;  1YIT A;  3GTG I;  5M5Y B;  2IX0 A;  3PO3 H;  2H85 A;  1D5X C;  1XNR L;  4MNO A;  4NBA A;  4A3D H;  3NQI A;  5IP7 I;  1LTI D;  3HOY G;  4LF9 L;  2N49 A;  3KF8 A;  3SK6 A;  5C4X H;  5A2Q f;  1IXR A;  1FGU A;  4YWK A;  1YIT 1;  1K0S A;  4LFB Q;  1BBW A;  3CW2 C;  3MZL B;  3SK5 A;  1CQV A;  1CSQ A;  4A3J I;  1DOK A;  2D9U A;  3QJY A;  5LMU L;  3R3O A;  1SNM A;  2Z6K C;  2E2H I;  1TXY A;  1YIT Z;  3BDL A;  4QIW B;  4YWL A;  1PH2 A;  1SNQ A;  3DHQ A;  4IUV A;  3RN5 A;  1A3T A;  1FYC A;  4QGU A;  1JB3 A;  4IN3 A;  4DV6 L;  2NVT I;  4DV2 L;  4QTU A;  2D0O A;  4P72 A;  3CQZ I;  3GTM I;  1QJO A;  1AH9 A;  3CCL 1;  5D1P A;  1UUP A;  3LGJ A;  2HQE A;  2NVT H;  3HOX G;  4LF9 Q;  1K8G A;  3Q8D A;  2TMP A;  2EDG A;  1II3 A;  3CCL Z;  2UUA Q;  1WTW A;  2E8G A;  1N33 Q;  1TWG B;  5IGE A;  4CBV A;  5KNB A;  2KHS A;  2KCN A;  1H95 A;  2B2W A;  2K03 A;  4CKE A;  1QG7 A;  4CDE C;  3FVQ A;  1BO0 A;  1XX8 A;  1LM0 A;  1TS3 A;  4UP7 A;  1Q46 A;  1BXT A;  2IW3 A;  3CCM A;  3ULJ A;  1NBW A;  2JA6 B;  2EYF A;  4RHR A;  3GTQ H;  3GV3 A;  1BCP D;  1VQM Z;  2K52 A;  4KJN A;  4QUF A;  3VR3 A;  5CBE E;  3F2D A;  2E2J H;  1V1Q A;  2KCC A;  2PQA A;  4ZUJ A;  3K81 C;  3UDI A;  3FP9 A;  2BH8 A;  3CQZ B;  2WAC A;  4K2L A;  2RSN A;  4JI8 Q;  2K6A A;  1QVC A;  1NCV A;  1PRT D;  1DON A;  1HZC A;  4G7Z C;  1F9Q A;  4RKB A;  2R92 B;  1ZB8 A;  3JAM i;  2PYK A;  2YAD A;  2DNC A;  2F0O A;  4OL7 A;  2Q8T A;  2EY1 A;  3KFU A;  3RZD B;  1Q7Y C;  1N32 Q;  2W03 A;  3FKI I;  4S1T A;  2B2V A;  1HXY D;  5JPN C;  2PPB C;  1U0L A;  4JI5 Q;  4XX2 A;  3S16 B;  2CVR A;  1EQT A;  1KC8 2;  2Z8L A;  1S5C D;  2ZTC A; 
#chains in the Genus database with same CATH homology
 2K3R A;  1L1O B;  4LFA Q;  2E9H A;  4B3S L;  2RCN A;  3A5U A;  1J5E L;  5ELN A;  3CF5 A;  4DR4 L;  1X3G A;  3HKZ E;  4JI5 L;  1PA6 A;  2QA4 1;  3CC2 Z;  3PF4 A;  3EN2 A;  3TEH B;  3RN2 A;  1S72 A;  3M3Y I;  3CCJ Z;  3J7Z C;  5FLM H;  3P5J B;  5C44 I;  1E1T A;  1PH7 A;  3VB9 A;  2MFI A;  2CWA A;  2YTV A;  3GTM H;  1J5E Q;  4DK6 C;  5M5Y H;  4DR7 Q;  1HNW L;  4GNX A;  1NUI A;  1VQO 1;  4IFD I;  3S14 H;  2Z0S A;  1VQO Z;  4NBF A;  2UXD Q;  4X65 L;  4BBS G;  2GVA A;  3CPW A;  4R4I A;  3S16 I;  1NMF A;  1PH5 A;  2OQ0 A;  4OX9 Q;  1VQ7 Z;  1HR0 W;  4GKJ L;  1Y1V S;  3ZJY C;  4GNX B;  5HGQ A;  2OTL 1;  3HOW H;  4MD8 A;  1OXV A;  3UDF A;  1P8L A;  1CSP A;  1KHI A;  4LFA L;  1JWH C;  4DK3 C;  1K73 C;  2JA7 G;  1HNX Q;  3S1M I;  2HT1 A;  2UXC Q;  3CCS Z;  1WCM I;  1N8R 2;  2K5H A;  3I56 Z;  4A3F G;  3GTK H;  1SFO H;  2Q51 A;  4IFD J;  2GU2 A;  4A3E G;  3GTK I;  3FQQ A;  1R9T I;  5FLM G;  3G71 1;  4JI2 L;  4HGY A;  3NDJ A;  3IX0 A;  1HNX L;  1USP A;  4E2Z A;  1CKN B;  2HIV A;  5FLX f;  3G4S Z;  1JJC B;  1X54 A;  1I94 L;  4JBM A;  4DR7 L;  2PK7 A;  4AQY L;  4JV5 Q;  3G4S 1;  1E24 A;  2VQE L;  1S40 A;  4KLK A;  5LMN Q;  3M9B A;  3BG0 B;  1PVO A;  1TWA H;  3TDH B;  3M3Y H;  1K9M C;  1E3P A;  1L2F A;  1X3F A;  3M4Q A;  4JI1 L;  1MKH A;  4DPG A;  5IP7 G;  4JYA L;  1VQ7 A;  4A93 I;  2OTL A;  1VQE A;  4NBD A;  1VQ9 A;  3OYY A;  4GLX A;  4O0A A;  3A0J A;  4A3K I;  3E9I A;  2F4O A;  3D31 A;  2DE5 A;  4DR1 Q;  1Z01 A;  3I4O A;  1L1O A;  4A93 G;  2QKD A;  1Q7Y 1;  2N78 A;  4C2M H;  4O2D A;  2UXC L;  3VMI A;  4LF5 Q;  4DV0 Q;  1XPU A;  1K9M 2;  4R4T A;  4NXN Q;  3HOX I;  3CC4 Z;  1EIF A;  4DR3 L;  4BY1 G;  1VQK A;  1JMC A;  2D62 A;  3M4O I;  4LFC L;  4DR5 L;  1KRS A;  4A3I H;  4X64 L;  3M4O H;  3KDF B;  4A3M I;  1UWV A;  1YVC A;  5IYB G;  3CC2 A;  4C3I H;  2GN5 A;  1N9W A;  3SGI A;  3WWV A;  3A74 A;  1OXX K;  4MD9 A;  2E5L Q;  2K75 A;  1A8V A;  3GTM S;  2F4V L;  2PI2 E;  5A2Q b;  1VQL Z;  3CCE Z;  1PYB A;  1MIU A;  4PMW A;  4X64 Q;  3S2D H;  1VQO A;  4DUY L;  1VQL 1;  5C3E I;  4HJ8 A;  1I3Q H;  3CMA Z;  2WB1 G;  4WJ4 A;  4JYA Q;  3GKQ A;  3CPW Y;  3NBH B;  4MZ9 A;  2OTJ A;  3Q87 A;  4POG A;  3HOZ H;  3TS2 A;  3HKZ G;  4A3C G;  3CCR A;  4BY7 G;  3GTO H;  4JI6 L;  3I4N H;  4RMF A;  4Y7N H;  1X3W A;  1YHB A;  3EIV A;  3T1H L;  2I3C A;  3KJP A;  2IX1 A;  3CCQ Z;  4OWW B;  2EXD A;  3UDG A;  4OO1 G;  3NH5 A;  1N2F A;  4GN4 B;  2VS1 A;  1K9M 1;  1IBL Q;  1Y1W G;  2R6M A;  1VQD A;  2UU9 Q;  1HZB A;  1FVI A;  1OXS C;  3E9H A;  4HJ5 A;  1E7Z A;  4AYB G;  1JB7 A;  4YY3 Q;  2FXQ A;  1YJ9 Z;  1YHQ 1;  4R1J A;  1IBK Q;  2JA6 G;  2OOX B;  1PH1 A;  2I5L X;  4HIO A;  2ZJP A;  3PO2 H;  2JA9 A;  2K50 A;  4C3J H;  1A0I A;  5FJ8 G;  4JV5 L;  2ID0 A;  1CKN A;  4OON A;  1ASZ A;  1IL2 A;  1QVG A;  2CKZ B;  5D1O B;  5IE8 A;  3CD6 Z;  4A3L I;  4KHZ A;  2NVQ I;  3GTL H;  4LNQ A;  4BXX G;  2JR6 A;  2RT9 A;  3HOW G;  1HH2 P;  4KHP L;  4B3R L;  3TRE A;  4R4C A;  4TNU A;  5IWA L;  1VQ4 1;  1Q1E A;  4LF7 L;  3I55 Z;  3G48 A;  4B3S Q;  2UXB L;  3HOZ G;  1VQ4 Z;  4A3B H;  2UUC L;  5GRO A;  5GAD C;  4RS4 A;  1QVF Z;  4A3M G;  1X3E A;  2VUM G;  3I55 1;  1Q86 1;  3PO3 S;  2Z6K A;  5C0X I;  2RHS B;  1HR0 Q;  2WAQ E;  1TWH H;  3PO3 G;  3F1Z A;  2JNY A;  1VQH A;  5M3F G;  4E32 A;  1TWF I;  4CL1 A;  1IBM L;  2UXB Q;  4DR5 Q;  4QJF A;  3CCR 1;  4YHH Q;  2CQO A;  2AWO A;  4JI1 Q;  2N8N A;  3J81 f;  1HNW Q;  4A3E I;  1MJE A;  2PQA B;  3S2D I;  2QEX A;  1A63 A;  2ES2 A;  3D0F A;  2OOY B;  3EBE A;  5IY0 A;  3T1Y Q;  1VQ5 1;  1SR3 A;  4NB8 A;  1VQ6 Z;  2LXJ A;  1L1O C;  1B70 B;  3RLF A;  2YTX A;  3NEM A;  4DUZ Q;  4KHP Q;  5CM2 M;  1XPR A;  1EQR A;  1VQ5 Z;  2F4M A;  4A3F H;  4IPC A;  4BA1 I;  1QVG Y;  1Q82 2;  4NPS A;  2R93 G;  5C4J I;  2KPI A;  4JBW A;  1Q81 C;  1XNQ Q;  2BJO A;  1IZ6 A;  4B3T Q;  1KRL A;  3PUX A;  2KEN A;  3KF6 A;  1KD1 1;  2YYZ A;  1KQS A;  3HOU I;  1PFT A;  1I6H H;  3KYH C;  1VQN A;  2F4V Q;  2WB1 E;  1VQI A;  2P3Y A;  4HH4 A;  2Q2H A;  5IT9 f;  1PH6 A;  2VUM H;  2ZTD A;  3JAM b;  3S17 I;  1VQM 1;  1S72 1;  1QF8 A;  2PI2 A;  1K8A 1;  1Q81 2;  2R6G A;  3G4S A;  3FHW A;  1S72 Z;  5EAY A;  1C0A A;  3I7F A;  4JI7 Q;  3CCM Z;  4LF8 Q;  3CPW Z;  3M85 A;  1VQB A;  1N32 L;  1IYJ B;  5IYC G;  1Y1W I;  4B3M L;  2V1C C;  4HJ9 A;  1VQ9 Z;  2LIY A;  3KF6 B;  3UE0 A;  1L0W A;  1BBU A;  4DV3 Q;  3H3V H;  4ME3 A;  4A3B G;  4BBR I;  1RL2 A;  1ZH1 A;  3S1Q H;  4JI8 L;  1VQP A;  4APV A;  3HOY H;  1RO0 A;  2JA7 H;  1S3O A;  2R7F A;  5IP9 I;  3CC2 1;  2BA0 A;  4DR2 Q;  3H3V J;  3AQQ A;  1W2B Y;  1N34 Q;  1PH9 A;  5IWA Q;  4A3K G;  4X62 L;  5FLX b;  2R7Z I;  1VQL A;  1KD1 2;  4DV7 L;  2KCM A;  1XMQ Q;  3I4M G;  2WAQ A;  4DV1 L;  4A3F I;  1J6Q A;  4QIW E;  1TWF H;  3M4P A;  4RVF A;  3PF5 A;  1Q8K A;  1HR0 L;  2JA8 I;  3CCU Z;  3DM3 A;  1RNI A;  1KIX A;  1C7Y A;  2OTJ 1;  2UUB Q;  1IBM Q;  2PMZ E;  3CCU 1;  3LUS A;  1M1K 1;  4A3E H;  1XPO A;  4B3M Q;  1YBY A;  1YJ9 1;  3RLN A;  1VQ7 1;  1YHQ Z;  3CXC A;  2DE7 A;  1KD1 C;  3KOJ A;  1RO4 A;  4BY1 H;  4Y52 H;  5IP7 H;  2IY5 B;  4NBB A;  5M3M H;  4A3J H;  3EER A;  1HNZ L;  4B3R Q;  1YJW 1;  2QA4 A;  2B63 G;  3T1Y L;  2VQF Q;  4EX5 A;  2UUC Q;  2A19 A;  3HOU G;  3F2B A;  3RZO H;  2JS4 A;  1LYL A;  2LXK A;  2VUM I;  4NBG A;  1LTL A;  4JI3 L;  1EQQ A;  3D9X A;  4A3I G;  1VQ4 A;  4X66 L;  4DV1 Q;  4HIM A;  1CUK A;  4C3H H;  1B8A A;  3S24 A;  1YJW A;  1BKB A;  3M7N A;  1JJG A;  5BR8 Q;  2N3S A;  1SN8 A;  2YU9 H;  2P28 A;  2NVX I;  1NJI C;  1QZH A;  3ERS X;  3RZD H;  1K73 2;  3BZC A;  3KIH A;  3CCR Z;  3I4N I;  1M90 1;  3BU2 A;  1M1K 2;  4PZ7 A;  5C44 G;  4Y52 I;  1W2B A;  3STB D;  3CXC Y;  4A3D G;  1B7Y B;  1SRO A;  3S2H I;  2Q4Z A;  3PO3 I;  3KLW A;  3W1B A;  2NN6 G;  4E2Y A;  1TWA I;  5C4X I;  1GM5 A;  1Z47 A;  1DGS A;  1Q12 A;  4FDB A;  1M1K C;  2AKL A;  4WJ3 M;  1Y1V H;  2OCE A;  4DQY B;  1MJC A;  2XGT A;  4R4Q A;  3AEV A;  3J80 i;  3HOW I;  3NFZ A;  2E2H H;  4HJ7 A;  2UU9 L;  3GTP I;  4DR6 L;  5C0X J;  2AHO B;  5FJ8 H;  3K0X A;  2VW9 A;  4LUO A;  4DV5 Q;  3J80 b;  3VDY A;  3VMG A;  4RVH A;  4AIM A;  5D1O A;  1VQ6 A;  1IBK L;  3CP0 A;  3HOV G;  3J80 c;  2MO1 A;  3H3V I;  5AN9 F;  1OXU A;  1QUQ B;  3CMA 1;  3S17 H;  2YTY A;  3HOY I;  1G51 A;  1XNR Q;  3J7A 5;  4NBC A;  4P75 A;  1Z03 A;  1YNX A;  1Y1W H;  3IFU A;  1M90 2;  3NH8 A;  1KC8 1;  1SE8 A;  5LMU Q;  3PUY A;  2KBN A;  2VUG A;  3J81 i;  2NVY I;  4AYB A;  4BBR G;  4GOP B;  1VQN 1;  2A8V A;  3S2H H;  4NXN L;  5AJ3 Q;  3CCQ 1;  2ZTE A;  5JEA J;  3JC6 6;  4DKA C;  3GCF A;  3CXC Z;  1P9N A;  1QVF A;  3PV0 A;  2ZJQ A;  4AYB E;  2PNH A;  4PZ6 A;  5FLX c;  2JE6 I;  4DR6 Q;  2K5V A;  4MH4 A;  5JJL A;  2KHI A;  2JUB A;  4RV9 A;  2H5X A;  4POF A;  1EYG A;  4P71 A;  1TFI A;  1K8A C;  3HOV H;  3PSI A;  2C35 B;  5C4J H;  4QY7 A;  2R93 H;  3AFQ A;  1VCI A;  4DV4 Q;  3S1R H;  1I5F A;  1T9H A;  3K7U C;  3H0G G;  1E1O A;  3KF8 B;  2ZAE B;  3PUZ A;  4AQY Q;  2B3G A;  1VQK 1;  3K8A A;  2OTJ Z;  1X3Z A;  3CD6 1;  3TQY A;  1YUA A;  4GN3 B;  3GD7 A;  3OW2 Z;  2F3I A;  3AYH B;  3EED A;  2PMZ A;  3BG1 B;  3MZK B;  1CKM A;  4A3G G;  2PM9 A;  3CC7 1;  1WYD A;  3QWU A;  1N8R 1;  2QLV B;  2AKW B;  4NBH A;  1A62 A;  1BVS A;  3CC7 Z;  2GVB A;  4A3J G;  2J6A A;  1D7Q A;  5C3E G;  4DR2 L;  3CME 1;  4A3I I;  3RZO I;  2E2J I;  4DR3 Q;  5DLQ E;  1YHQ A;  2A1A A;  1YIJ A;  4X6A I;  2R92 G;  2D0P A;  5M5W H;  1TWG I;  4P74 A;  1PHJ A;  1GD7 A;  1C9O A;  1UEB A;  3GDE A;  1Z9F A;  1QYP A;  3ULL A;  2E5L L;  2K5R A;  1YJN 1;  4YCU A;  1EWI A;  2M6N A;  1ASY A;  1R9T H;  3GTO I;  3OTO L;  4K0K L;  1NP6 A;  3ICE A;  1KRT A;  1LUZ A;  4UPA A;  1I50 I;  3S1R I;  4DV6 Q;  1HJP A;  1Q7Y 2;  2Y0S A;  4LWC A;  2VL6 A;  3I07 A;  2QEX 1;  1KC8 C;  3VTN A;  4JOI C;  3ESW A;  3J81 c;  1WJJ A;  3HOZ I;  1NTG A;  2QEX Z;  2Q2U A;  1AE2 A;  5M3M G;  1YJN A;  3RNU A;  4NXM Q;  2KCT A;  5IP9 H;  1JJ2 Y;  2DE6 A;  1QVG Z;  2MQH A;  2K5N A;  4X65 Q;  4E33 A;  1WI5 A;  3U4V A;  3OW2 Y;  1GVP A;  3CCE A;  1V43 A;  3CCJ 1;  4YHH L;  4PG3 A;  1W3S A;  3I4N G;  3H15 A;  5M5X H;  1UE5 A;  5J3B A;  1X6O A;  2NZO A;  3PUW A;  5GQO A;  4GKK L;  3HOV I;  1WW9 A;  5FLM I;  3CCM 1;  3CCE 1;  1I94 Q;  2NVQ H;  5IYB H;  1PH3 A;  2R7D A;  2DGY A;  4JG2 A;  3PO2 I;  1LQL A;  3GTJ I;  2BA1 A;  3MON A;  3OTO Q;  4K0K Q;  1KL9 A;  3J81 j;  2IZ4 A;  4QTT A;  3NEN A;  5AJ3 L;  1HNZ Q;  4TQU S;  3HKZ A;  4NB9 A;  4NH1 C;  3CCQ A;  4B3T L;  2NN6 I;  5GAH C;  4A76 A;  4XIG S;  5E7N A;  4LF6 Q;  1KXL A;  4LF7 Q;  2JMO A;  3CCS 1;  4NXM L;  3I56 1;  4A75 A;  4JCV E;  2AWN A;  4IJH A;  3GTG H;  2CFM A;  3PIO A;  1N8R C;  3S1Q I;  4UP9 A;  3CC4 A;  2V8I A;  3S1N H;  1CKO A;  1PV4 A;  5JEA G;  3G71 Z;  3TS0 A;  2JEA I;  1QUQ A;  1TWH I;  1N36 Q;  2R93 I;  4DNI A;  3MEF A;  1WCM G;  1NJI 2;  1RO2 A;  1PH4 A;  4LFB L;  1XMO Q;  3IF8 A;  2QRC B;  4NBE A;  2I5H A;  1XMQ L;  2JA5 I;  2VZA A;  1TWC H;  4A3L G;  1EUJ A;  1YUK A;  2OWO A;  1PH8 A;  4A3D I;  1YJW Z;  4IPG A;  4BY1 I;  4HJA A;  5IT9 c;  2JA5 H;  1KQS Y;  2RIQ A;  4GLA C;  2I5M X;  4LFC Q;  2I0Q A;  1YIJ 1;  1EOV A;  2B29 A;  2JA6 H;  3BZK A;  1I50 H;  4HGZ A;  1VQK Z;  5LMN L;  1OXT A;  4A3G H;  4DGL A;  3G6E 1;  1S7M A;  3E0E A;  4PZ8 A;  2OQK A;  2Y0S G;  1K3R A;  1DL6 A;  4A4I A;  3G6E Z;  3FKI G;  3TE5 B;  2EGT A;  4MD7 A;  2K4K A;  4GN5 A;  1EFW A;  1YEZ A;  3CC4 1;  2JA5 G;  2VQF L;  1N33 L;  2WFW A;  1Y1V I;  4MON A;  4IJL A;  4OWT B;  2ZM6 Q;  3DLL A;  3D6W A;  3KIF A;  1Y1V G;  3OW2 A;  4RVG A;  3S1M H;  3CME A;  2GTH A;  1SMX A;  3L2P A;  2CCZ A;  1WCM H;  2B63 H;  4E2X A;  1NJI 1;  1VQ8 A;  2GTI A;  3F3P C;  2HF1 A;  4DAY B;  4MXU A;  2Q2T A;  1P16 A;  1VQ6 1;  2B63 I;  2YU9 I;  3IRB A;  5ELO A;  2R7Z G;  4DR1 L;  2G2K A;  3CC7 A;  1M90 C;  1VQF A;  1PFS A;  2NVY H;  2WP8 J;  1KAW A;  4HID A;  1Q82 C;  1UE1 A;  1X55 A;  2QRE B;  5T67 A;  2JA8 G;  3H0G H;  5GAE C;  2JA7 I;  3JAM f;  3F3F C;  1FJG Q;  2NVX H;  3HOU H;  1V9P A;  3UE1 A;  1VQ8 Z;  2RHQ B;  1SRU A;  1G6P A;  3CPF A;  5K36 G;  3K7A H;  2JA6 I;  5IYD G;  4YCV A;  1VQP Z;  2R7Z H;  2Y0S E;  3U58 A;  2EQS A;  3CMA A;  1W2B Z;  3W5O A;  3RLO A;  1XJV A;  3S16 H;  1K83 H;  5IP9 G;  3UDX A;  3I4M I;  1E22 A;  2Q2I A;  5GAG C;  4GKK Q;  1N34 L;  5JJI A;  4BY7 I;  3J81 b;  4A3L H;  1K8A 2;  4A93 H;  2HHH L;  3NDI A;  1RIP A;  4GKJ Q;  2JQO A;  2BH2 A;  3VMH A;  1YHA A;  3CCV Z;  2JA8 H;  2RBL A;  3G6E A;  4MTN A;  4BXX H;  4UP8 A;  3CCL A;  3CCV 1;  3L0O A;  1JT8 A;  5T64 A;  5HY6 A;  3B6Y A;  2VQE Q;  2HHH Q;  2IHE A;  1I6H I;  4TVA B;  4ALP A;  1VQ9 1;  4RG1 A;  5C0X G;  4L5R C;  1EIY B;  1SLJ A;  3J80 f;  1Y14 B;  2O4H A;  4RVD A;  2XTI A;  3CAM A;  1JE5 A;  1TWG H;  3PO2 G;  1K73 1;  1NE3 A;  4X6A H;  3GO5 A;  1KQS Z;  4QL5 A;  3CD6 A;  2QGQ A;  3BJU A;  1G29 1;  3STB C;  1Z02 A;  4JC0 A;  1WOC A;  1VQG A;  2HU9 A;  1XNQ L;  4LUV A;  3S15 H;  2LFU A;  3GTQ I;  4DR4 Q;  1UE6 A;  4YWM A;  3RZD I;  3KJO A;  2KI7 B;  3U50 C;  4LF5 L;  4YY3 L;  1USP B;  4DV0 L;  2ALY B;  4OXP A;  1GKH A;  4LF4 Q;  3S15 I;  1Q86 2;  1NY4 A;  3ER0 A;  1K0R A;  4A3B I;  3U4Z A;  2F52 A;  4YCW A;  1O7I A;  4A3K H;  1HZA A;  2RHB A;  1XMO L;  3FKI H;  4H02 A;  1YI2 1;  2R92 I;  1K83 I;  2YV5 A;  5M3F H;  1QZG A;  1VQM A;  4A3C H;  2W04 A;  4KI0 A;  1YI2 Z;  2UXD L;  2VY3 A;  5C4X G;  4JI4 L;  1VQA A;  3JAM c;  2R92 H;  3PUV A;  4BBS H;  4NOZ A;  5C44 H;  1Q86 C;  2IZ3 A;  4DK1 A;  3AFP A;  2L15 A;  3I56 A;  2EIF A;  3L7Z C;  4IOA A;  2RPR A;  1YZ6 A;  1OTC A;  2UUB L;  4A3C I;  3HKS A;  4JI4 Q;  1YIJ Z;  4EWC A;  1PYS B;  3NEL A;  1YJ9 A;  4L5T A;  3CCJ A;  3CME Z;  4JI0 L;  1Q82 1;  4J15 A;  2ZM6 L;  1RQF A;  4P73 A;  4LF4 L;  4GOP C;  4X62 Q;  3KDF A;  5BR8 L;  1X0T A;  4EQ5 A;  3MXN B;  2WAQ G;  4IOC A;  2VNU D;  3NH4 A;  3GTL I;  4JI2 Q;  3PGZ A;  4BY7 H;  4L5Q A;  3TRZ A;  4NB3 A;  4BXX I;  3T4N B;  2IHF A;  4QQB X;  3CQZ H;  1VLA A;  1YJN Z;  2QRD B;  5T6B A;  4HIK A;  3FQM A;  1X56 A;  2JJQ A;  4JBK A;  1Q81 1;  2ASB A;  4DUZ L;  3I55 A;  4X66 Q;  4GOP A;  3CCU A;  5IT9 b;  2QR1 B;  4BBS I;  2NZH A;  2HQL A;  1ZB9 A;  4BA2 I;  1FJG L;  5H1S E;  4GS3 A;  4GLV B;  4Y7N I;  1X9N A;  4DV2 Q;  4DV7 Q;  4IFD G;  4LF8 L;  3K80 C;  2JEB I;  1AE3 A;  2QA4 Z;  2UUA L;  3J7A 4;  4IO9 A;  5JJK A;  4JI0 Q;  3H0G I;  3K7A I;  2HIX A;  3GTP H;  4E2W A;  4JI6 Q;  4OO1 I;  4IPH A;  3HFZ B;  3S1N I;  2KHJ A;  2E2I H;  1JJ2 Z;  2IT1 A;  1VQ8 1;  5IYC H;  3PIP A;  3A5Z B;  3I4M H;  4NFR A;  4IPD A;  1JJ2 A;  4JI3 Q;  3F8T A;  4OWX B;  1VQP 1;  2ATW A;  2M48 A;  2WB1 A;  4XTC S;  2DUD A;  1N36 L;  3W1G A;  4A3M H;  4R4O A;  4A3G I;  2ZJR A;  2VF1 A;  1NMG A;  3ULP A;  4JI7 L;  1VS0 A;  1WFQ A;  4JBJ A;  1RLY A;  3S14 I;  3PCO B;  1QVF Y;  4LW1 A;  1YI2 A;  3RR5 A;  2OTL Z;  2RF4 A;  3G71 A;  3CCS A;  5LL6 f;  4DV4 L;  4DV5 L;  2CWP A;  4LUZ A;  4E30 A;  4MRI A;  3HOX H;  3GTJ H;  4DV3 L;  4OX9 L;  1FL0 A;  1D8L A;  1VQN Z;  2V8J A;  2LSS A;  4E31 A;  3I2Z A;  4GNX C;  1SFO I;  2MNA A;  4BBR H;  1XTD A;  2JK8 A;  4DAM A;  1VQC A;  2AMC B;  3T1H Q;  1Q1B A;  1I3Q I;  5LMN W;  2MO0 A;  2E2I I;  2OZK A;  1X65 A;  1IBL L;  3F2C A;  5C3E H;  1HZ9 A;  1TWC I;  1U5K A;  2O53 A;  1WII A;  1VQ5 A;  4LF6 L;  5IYD H;  1UE7 A;  1VQJ A;  2K14 A;  4UY8 C;  1ML8 A;  4JOI A;  4L5S A;  4AH6 A;  2V8K A;  1GO3 E;  4DUY Q;  3CCV A;  1YIT A;  3GTG I;  2IX0 A;  3PO3 H;  2H85 A;  1XNR L;  4MNO A;  4NBA A;  4A3D H;  5IP7 I;  3HOY G;  4LF9 L;  2N49 A;  5C4X H;  5A2Q f;  1IXR A;  1FGU A;  4YWK A;  1YIT 1;  4LFB Q;  1BBW A;  3CW2 C;  3MZL B;  1CSQ A;  4A3J I;  5LMU L;  2Z6K C;  2E2H I;  1TXY A;  1YIT Z;  4YWL A;  1PH2 A;  3RN5 A;  4QGU A;  4DV6 L;  2NVT I;  4DV2 L;  4QTU A;  2D0O A;  4P72 A;  3CQZ I;  3GTM I;  1AH9 A;  3CCL 1;  5D1P A;  3LGJ A;  2NVT H;  3HOX G;  4LF9 Q;  1K8G A;  3Q8D A;  2UUA Q;  3CCL Z;  1N33 Q;  2E8G A;  1H95 A;  1LM0 A;  4UP7 A;  1Q46 A;  3CCM A;  3ULJ A;  1NBW A;  3GTQ H;  2K52 A;  1VQM Z;  3F2D A;  2E2J H;  1V1Q A;  2PQA A;  3K81 C;  3UDI A;  3FP9 A;  2BH8 A;  4JI8 Q;  1QVC A;  1HZC A;  1ZB8 A;  3JAM i;  2YAD A;  3KFU A;  1Q7Y C;  1N32 Q;  2W03 A;  3FKI I;  4S1T A;  1U0L A;  4JI5 Q;  4XX2 A;  1KC8 2;  2ZTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...