3G711

Co-crystal structure of bruceantin bound to the large ribosomal subunit
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
b'TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
molecule tags Ribosome
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3g71100
3CPWZ 2QA41 1YHQ1 1VQKZ 3CMA1 1Q821 1VQM1 1Q7Y1 3CCEZ 1YITZ 1VQPZ 3G6E1 2QEXZ 1QVGZ 3CCM1 1QVFZ 1VQ5Z 3CXCZ 1JJ2Y 1Q7Y2 2OTJ1 1KQSY 1Q811 1Q861 1K8A2 3CCR1 1YIJZ 3OW2Y 1KD11 3CCJ1 1VQ81 3CCU1 3G71Z 1M1K1 3CC41 1VQL1 1KQSZ 3CCL1 3CCVZ 2OTLZ 3CC7Z 1YJW1 3CD61 1VQ61 1N8R1 1VQ71 3CC2Z 1JJ2Z 1VQ91 1YHQZ 1NJI1 1QVGY 1M1K2 1YJN1 3CPWY 3CCQ1 1VQMZ 1W2BY 1W2BZ 1YI2Z 3CCS1 1S721 1VQP1 2QEX1 3I551 3CCMZ 1VQO1 1Q812 1N8R2 1Q862 1VQ4Z 1VQ51 1YJ9Z 2OTJZ 1VQNZ 3G4SZ 1M901 1YIJ1 1K732 3OW2Z 3CCUZ 3I561 3CMEZ 2QA4Z 1KD12 1VQK1 1QVFY 3CMAZ 1VQ7Z 1NJI2 3CCE1 1YIT1 3CXCY 3G6EZ 1VQ9Z 1K9M1 1KC81 1YJNZ 3CCQZ 3CCRZ 1YI21 3CCJZ 1VQ8Z 1KC82 3CCSZ 1S72Z 3G711 1K8A1 3I55Z 1VQOZ 1VQLZ 1VQ41 3CC4Z 3CCV1 3CCLZ 2OTL1 1M902 1K731 1YJ91 3CC71 1VQN1 1YJWZ 1K9M2 3G4S1 3CD6Z 1VQ6Z 3CC21 3I56Z 3CME1 1Q822
chains in the Genus database with same CATH superfamily
3CPWZ 4CL1A 1TWGI 5C44I 4A3CI 2J6AA 4HH4A 2HU9A 2JA8I 1VLAA 1WZNA 1VQM1 3GKQA 2PM9A 3CCM1 1QVFZ 2IV2X 1VQ5Z 3JAMf 5T6BA 2H85A 1KQSY 1USPA 1Q811 1Q861 2RBLA 3CCR1 2OOYB 1YIJZ 3OW2Y 4NBBA 3CCU1 1TFIA 1TWAI 1KQSZ 2DE5A 2VPYA 2P28A 4NBEA 1N8R1 1VQ71 2BJOA 4E32A 1ZH1A 2GTIA 1Z03A 1YHQZ 3EEDA 1QVGY 3PO3S 1M1K2 3GTPI 5CM2M 1FDIA 5IP7I 2JA7I 1W2BZ 1N8R2 2JIPA 2QLVB 2QRCB 1TWCI 3ESWA 2DE7A 3VMHA 3IF8A 4E2ZA 2WAQA 1M901 3OW2Z 3I561 1AA6A 2G2KA 2Q4ZA 1TWFI 1KRLA 1KD12 4MRIA 3GTKI 2W03A 3JAMb 3NDIA 5FLXf 5FLMI 5A2Qb 2VPWA 2EGTA 2O53A 4A3EI 3U50C 3GTMI 2JA5I 3CCQZ 1I6HI 4NB9A 1VQ8Z 1KC82 4BBRI 2NVQI 1Y1VI 3I55Z 2JIOA 1VQOZ 2OTL1 4E30A 4MD9A 5D1PA 1K731 1RQFA 2JUBA 1QYPA 3D2LA 1VQ6Z 2VUGA 3CC21 1P9NA 3CME1 1X3ZA 4XX2A 2K5RA 3NH5A 4QTTA 3CMA1 2ZAEB 4A3GI 4BBSI 2V8KA 1YITZ 1VQPZ 4A3LI 3GTMS 1JJ2Y 1Q7Y2 2OTJ1 3HOZI 4A3FI 5FLXb 3CCJ1 1Y1VS 2NAPA 2DE6A 1USPB 1VQL1 3CCL1 2M48A 3CC7Z 1YJW1 3MONA 3FKII 1VQ91 1NJI1 1ML8A 2Y0SA 3GTOI 1ZB8A 1WIIA 4A3BI 3S14I 1S721 4E2YA 1S7MA 2R6MA 2AKLA 2QEX1 1X0TA 1VQ4Z 1Q862 4RVHA 5LL6f 4MONA 4NBDA 3CQZI 5C4XI 3KIHA 3G4SZ 2E7ZA 3HOUI 1WCMI 2OZKA 2JIRA 5A2Qf 3EERA 1RO2A 4NBHA 2JIMA 5AN9F 1RLYA 4MH4A 4DQYB 4BY1I 1Z01A 1I50I 2RPRA 3IX0A 3VTNA 1Y8CA 1FDOA 2JNYA 1YJNZ 3I4NI 2VPXA 3CCRZ 1NUIA 1YI21 3NH4A 3GTJI 3CCSZ 4E33A 2PMZA 5IT9b 1YJ91 1VQN1 2JA6I 2M6NA 2AYDA 4EWCA 3MZLB 2V3VA 2R92I 4E2XA 2QA41 1YHQ1 1VQKZ 2E9HA 3GTLI 4QTUA 4RV9A 4NBAA 2E2JI 3QWUA 1Q821 4MD8A 1QF8A 1RNIA 2NVYI 2O4HA 3BG1B 3TE5B 3CCEZ 3HOYI 2PK7A 3BG0B 3G6E1 3RZDI 1QVGZ 1PFTA 4NFRA 2V8IA 1X3WA 3CXCZ 3S2DI 1K8A2 4MD7A 3FQQA 3G71Z 1M1K1 3CC41 1Q16A 2VUMI 3CCVZ 2JS4A 2F4MA 2R7ZI 5D1OB 4NBFA 5C4JI 4Y7NI 4TNUA 4DGLA 2KPIA 3CD61 2IZ3A 4A3JI 1R9TI 3J81b 3IFUA 3J80f 1N2FA 3D9XA 3CCQ1 3NDJA 1VQMZ 2NVXI 3F3PC 3RZOI 3S1RI 1L1OC 1SIWA 3I551 3CCMZ 1VQO1 1Q812 3S1QI 1K83I 1VQ51 2QKDA 3NFZA 1YIJ1 1WJ2A 3CCUZ 2OOXB 2HF1A 3CMEZ 2QREB 1Y1WI 3I4MI 1Z02A 3GTGI 1SFOI 2GTHA 2JR6A 3GCFA 3I07A 1QVFY 3CMAZ 3J80b 2Q51A 1VQ7Z 2VF1A 1YIT1 3S1NI 1TWHI 3H0GI 1K9M1 4DK1A 1KC81 4BXXI 4A3MI 2RT9A 4S1TA 1ZB9A 2NVTI 4RVDA 1DL6A 3CCJZ 1RO0A 3VB9A 1VQLZ 4BY7I 3CCLZ 3T4NB 3CC71 1YJWZ 1K9M2 2B63I 1RO4A 4MXUA 3I56Z 5T64A 4Y52I 4NB8A 4AYBA 2QRDB 3M4OI 1Q7Y1 2R93I 1I3QI 3M3YI 2QEXZ 4A3II 2RIQA 1LQLA 4A3KI 3HOVI 5IT9f 2YU9I 2F4OA 1JWHC 2V45A 1KD11 1VQ81 3P5JB 2E2HI 2IZ4A 2JMOA 2YADA 2I3CA 2RHBA 3LUSA 3NH8A 2OTLZ 3K7AI 1VQ61 3S15I 3HOWI 3CC2Z 5D1OA 1JJ2Z 2VPZA 1NP6A 1YUKA 2W04A 1YJN1 3CPWY 4RS4A 1W2BY 1YI2Z 3CCS1 1VQP1 3PO3I 4A3DI 1YJ9Z 3KIFA 2OTJZ 1VQNZ 2JIQA 4NH1C 4A93I 3F3FC 3MZKB 1K732 5T67A 4HGZA 2QA4Z 2LEXA 1VQK1 3H3VJ 2WB1A 2V8JA 3PO2I 2KI7B 3S17I 1WW9A 3D6WA 1NJI2 3CCE1 3GTQI 3Q87A 3TDHB 3CXCY 3IR7A 1YUAA 3G6EZ 1VQ9Z 5IP9I 3J7A4 3S1MI 2P3YA 4RVFA 2LIYA 4E31A 3S16I 4HGYA 3VMIA 3HKZA 1S72Z 3G711 2QR1B 1K8A1 2GU2A 5C3EI 3J81f 4NBCA 1VQ41 3CC4Z 3HOXI 4NBGA 4RVGA 3CCV1 1M902 1QXFA 2LFUA 3FQMA 3G4S1 4NOZA 2K3RA 3S2HI 3CD6Z 3VMGA 2E2II 4E2WA 4X6AI 1Q822
chains in the Genus database with same CATH topology
3CPWZ 4CL1A 1TWGI 5C44I 4A3CI 2J6AA 4HH4A 2HU9A 2JA8I 1VLAA 1VQM1 3GKQA 2PM9A 3CCM1 1QVFZ 1VQ5Z 3JAMf 5T6BA 2H85A 1KQSY 1USPA 1Q811 1Q861 2RBLA 3CCR1 2OOYB 1YIJZ 3OW2Y 4NBBA 3CCU1 1TFIA 1TWAI 1KQSZ 2DE5A 2P28A 4NBEA 1N8R1 1VQ71 2BJOA 4E32A 1ZH1A 2GTIA 1Z03A 1YHQZ 3EEDA 1QVGY 3PO3S 1M1K2 3GTPI 5CM2M 5IP7I 2JA7I 1W2BZ 1N8R2 2QLVB 2QRCB 1TWCI 3ESWA 2DE7A 3VMHA 3IF8A 4E2ZA 2WAQA 1M901 3OW2Z 3I561 2G2KA 2Q4ZA 1TWFI 1KRLA 1KD12 4MRIA 3GTKI 2W03A 3JAMb 3NDIA 5FLXf 5FLMI 5A2Qb 2EGTA 2O53A 4A3EI 3U50C 3GTMI 2JA5I 3CCQZ 1I6HI 4NB9A 1VQ8Z 1KC82 4BBRI 2NVQI 1Y1VI 3I55Z 1VQOZ 2OTL1 4E30A 4MD9A 5D1PA 1K731 1RQFA 2JUBA 1QYPA 1VQ6Z 2VUGA 3CC21 1P9NA 3CME1 1X3ZA 4XX2A 2K5RA 3NH5A 4QTTA 3CMA1 2ZAEB 4A3GI 4BBSI 2V8KA 1YITZ 1VQPZ 4A3LI 3GTMS 1JJ2Y 1Q7Y2 2OTJ1 3HOZI 4A3FI 5FLXb 3CCJ1 1Y1VS 2DE6A 1USPB 1VQL1 3CCL1 2M48A 3CC7Z 1YJW1 3MONA 3FKII 1VQ91 1NJI1 1ML8A 2Y0SA 3GTOI 1ZB8A 1WIIA 4A3BI 3S14I 1S721 4E2YA 1S7MA 2R6MA 2AKLA 2QEX1 1X0TA 1VQ4Z 1Q862 4RVHA 5LL6f 4MONA 4NBDA 3CQZI 5C4XI 3KIHA 3G4SZ 3HOUI 1WCMI 2OZKA 5A2Qf 3EERA 1RO2A 4NBHA 5AN9F 1RLYA 4MH4A 4DQYB 4BY1I 1Z01A 1I50I 2RPRA 3IX0A 3VTNA 2JNYA 1YJNZ 3I4NI 3CCRZ 1NUIA 1YI21 3NH4A 3GTJI 3CCSZ 4E33A 2PMZA 5IT9b 1YJ91 1VQN1 2JA6I 2M6NA 4EWCA 3MZLB 2R92I 4E2XA 2QA41 1YHQ1 1VQKZ 2E9HA 3GTLI 4QTUA 4RV9A 4NBAA 2E2JI 3QWUA 1Q821 4MD8A 1QF8A 1RNIA 2NVYI 2O4HA 3BG1B 3TE5B 3CCEZ 3HOYI 2PK7A 3BG0B 3G6E1 3RZDI 1QVGZ 1PFTA 4NFRA 2V8IA 1X3WA 3CXCZ 3S2DI 1K8A2 4MD7A 3FQQA 3G71Z 1M1K1 3CC41 2VUMI 3CCVZ 2JS4A 2F4MA 2R7ZI 5D1OB 4NBFA 5C4JI 4Y7NI 4TNUA 4DGLA 2KPIA 3CD61 2IZ3A 4A3JI 1R9TI 3J81b 3IFUA 3J80f 1N2FA 3D9XA 3CCQ1 3NDJA 1VQMZ 2NVXI 3F3PC 3RZOI 3S1RI 1L1OC 3I551 3CCMZ 1VQO1 1Q812 3S1QI 1K83I 1VQ51 2QKDA 3NFZA 1YIJ1 3CCUZ 2OOXB 1Y1WI 3CMEZ 2HF1A 2QREB 3I4MI 1Z02A 3GTGI 1SFOI 2GTHA 2JR6A 3GCFA 3I07A 1QVFY 3CMAZ 3J80b 2Q51A 1VQ7Z 2VF1A 1YIT1 3S1NI 1TWHI 3H0GI 1K9M1 4DK1A 1KC81 4BXXI 4A3MI 2RT9A 4S1TA 1ZB9A 2NVTI 4RVDA 1DL6A 3CCJZ 1RO0A 3VB9A 1VQLZ 4BY7I 3CCLZ 3T4NB 3CC71 1YJWZ 1K9M2 2B63I 1RO4A 4MXUA 3I56Z 5T64A 4Y52I 4NB8A 4AYBA 2QRDB 3M4OI 1Q7Y1 2R93I 1I3QI 3M3YI 2QEXZ 4A3II 2RIQA 1LQLA 4A3KI 3HOVI 5IT9f 2YU9I 2F4OA 1JWHC 1KD11 1VQ81 3P5JB 2E2HI 2IZ4A 2JMOA 2YADA 2I3CA 2RHBA 3LUSA 3NH8A 2OTLZ 3K7AI 1VQ61 3S15I 3HOWI 3CC2Z 5D1OA 1JJ2Z 1NP6A 1YUKA 2W04A 1YJN1 3CPWY 4RS4A 1W2BY 1YI2Z 3CCS1 1VQP1 3PO3I 4A3DI 1YJ9Z 3KIFA 2OTJZ 1VQNZ 4A93I 4NH1C 3F3FC 3MZKB 1K732 5T67A 4HGZA 2QA4Z 1VQK1 3H3VJ 2WB1A 2V8JA 3PO2I 2KI7B 3S17I 1WW9A 3D6WA 1NJI2 3CCE1 3GTQI 3Q87A 3TDHB 3CXCY 3G6EZ 1YUAA 1VQ9Z 5IP9I 3J7A4 3S1MI 2P3YA 4RVFA 2LIYA 4E31A 3S16I 4HGYA 3VMIA 3HKZA 1S72Z 3G711 2QR1B 1K8A1 2GU2A 5C3EI 3J81f 4NBCA 1VQ41 3CC4Z 3HOXI 4NBGA 4RVGA 3CCV1 1M902 2LFUA 3FQMA 3G4S1 4NOZA 2K3RA 3S2HI 3CD6Z 3VMGA 2E2II 4E2WA 4X6AI 1Q822
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPW Z;  2QA4 1;  1YHQ 1;  1VQK Z;  3CMA 1;  1Q82 1;  1VQM 1;  1Q7Y 1;  3CCE Z;  1YIT Z;  1VQP Z;  3G6E 1;  2QEX Z;  1QVG Z;  3CCM 1;  1QVF Z;  1VQ5 Z;  3CXC Z;  1JJ2 Y;  1Q7Y 2;  2OTJ 1;  1KQS Y;  1Q81 1;  1Q86 1;  1K8A 2;  3CCR 1;  1YIJ Z;  3OW2 Y;  1KD1 1;  3CCJ 1;  1VQ8 1;  3CCU 1;  3G71 Z;  1M1K 1;  3CC4 1;  1VQL 1;  1KQS Z;  3CCL 1;  3CCV Z;  2OTL Z;  3CC7 Z;  1YJW 1;  3CD6 1;  1VQ6 1;  1N8R 1;  1VQ7 1;  3CC2 Z;  1JJ2 Z;  1VQ9 1;  1YHQ Z;  1NJI 1;  1QVG Y;  1M1K 2;  1YJN 1;  3CPW Y;  3CCQ 1;  1VQM Z;  1W2B Y;  1W2B Z;  1YI2 Z;  3CCS 1;  1S72 1;  1VQP 1;  2QEX 1;  3I55 1;  3CCM Z;  1VQO 1;  1Q81 2;  1N8R 2;  1Q86 2;  1VQ4 Z;  1VQ5 1;  1YJ9 Z;  2OTJ Z;  1VQN Z;  3G4S Z;  1M90 1;  1YIJ 1;  1K73 2;  3OW2 Z;  3CCU Z;  3I56 1;  3CME Z;  2QA4 Z;  1KD1 2;  1VQK 1;  1QVF Y;  3CMA Z;  1VQ7 Z;  1NJI 2;  3CCE 1;  1YIT 1;  3CXC Y;  3G6E Z;  1VQ9 Z;  1K9M 1;  1KC8 1;  1YJN Z;  3CCQ Z;  3CCR Z;  1YI2 1;  3CCJ Z;  1VQ8 Z;  1KC8 2;  3CCS Z;  1S72 Z;  3G71 1;  1K8A 1;  3I55 Z;  1VQO Z;  1VQL Z;  1VQ4 1;  3CC4 Z;  3CCV 1;  3CCL Z;  2OTL 1;  1M90 2;  1K73 1;  1YJ9 1;  3CC7 1;  1VQN 1;  1YJW Z;  1K9M 2;  3G4S 1;  3CD6 Z;  1VQ6 Z;  3CC2 1;  3I56 Z;  3CME 1;  1Q82 2; 
#chains in the Genus database with same CATH topology
 3CPW Z;  4CL1 A;  1TWG I;  5C44 I;  4A3C I;  2J6A A;  4HH4 A;  2HU9 A;  2JA8 I;  1VLA A;  1WZN A;  1VQM 1;  3GKQ A;  2PM9 A;  3CCM 1;  1QVF Z;  2IV2 X;  1VQ5 Z;  3JAM f;  5T6B A;  2H85 A;  1KQS Y;  1USP A;  1Q81 1;  1Q86 1;  2RBL A;  3CCR 1;  2OOY B;  1YIJ Z;  3OW2 Y;  4NBB A;  3CCU 1;  1TFI A;  1TWA I;  1KQS Z;  2DE5 A;  2VPY A;  2P28 A;  4NBE A;  1N8R 1;  1VQ7 1;  2BJO A;  4E32 A;  1ZH1 A;  2GTI A;  1Z03 A;  1YHQ Z;  3EED A;  1QVG Y;  3PO3 S;  1M1K 2;  3GTP I;  5CM2 M;  1FDI A;  5IP7 I;  2JA7 I;  1W2B Z;  1N8R 2;  2JIP A;  2QLV B;  2QRC B;  1TWC I;  3ESW A;  2DE7 A;  3VMH A;  3IF8 A;  4E2Z A;  2WAQ A;  1M90 1;  3OW2 Z;  3I56 1;  1AA6 A;  2G2K A;  2Q4Z A;  1TWF I;  1KRL A;  1KD1 2;  4MRI A;  3GTK I;  2W03 A;  3JAM b;  3NDI A;  5FLX f;  5FLM I;  5A2Q b;  2VPW A;  2EGT A;  2O53 A;  4A3E I;  3U50 C;  3GTM I;  2JA5 I;  3CCQ Z;  1I6H I;  4NB9 A;  1VQ8 Z;  1KC8 2;  4BBR I;  2NVQ I;  1Y1V I;  3I55 Z;  2JIO A;  1VQO Z;  2OTL 1;  4E30 A;  4MD9 A;  5D1P A;  1K73 1;  1RQF A;  2JUB A;  1QYP A;  3D2L A;  1VQ6 Z;  2VUG A;  3CC2 1;  1P9N A;  3CME 1;  1X3Z A;  4XX2 A;  2K5R A;  3NH5 A;  4QTT A;  3CMA 1;  2ZAE B;  4A3G I;  4BBS I;  2V8K A;  1YIT Z;  1VQP Z;  4A3L I;  3GTM S;  1JJ2 Y;  1Q7Y 2;  2OTJ 1;  3HOZ I;  4A3F I;  5FLX b;  3CCJ 1;  1Y1V S;  2NAP A;  2DE6 A;  1USP B;  1VQL 1;  3CCL 1;  2M48 A;  3CC7 Z;  1YJW 1;  3MON A;  3FKI I;  1VQ9 1;  1NJI 1;  1ML8 A;  2Y0S A;  3GTO I;  1ZB8 A;  1WII A;  4A3B I;  3S14 I;  1S72 1;  4E2Y A;  1S7M A;  2R6M A;  2AKL A;  2QEX 1;  1X0T A;  1VQ4 Z;  1Q86 2;  4RVH A;  5LL6 f;  4MON A;  4NBD A;  3CQZ I;  5C4X I;  3KIH A;  3G4S Z;  2E7Z A;  3HOU I;  1WCM I;  2OZK A;  2JIR A;  5A2Q f;  3EER A;  1RO2 A;  4NBH A;  2JIM A;  5AN9 F;  1RLY A;  4MH4 A;  4DQY B;  4BY1 I;  1Z01 A;  1I50 I;  2RPR A;  3IX0 A;  3VTN A;  1Y8C A;  1FDO A;  2JNY A;  1YJN Z;  3I4N I;  2VPX A;  3CCR Z;  1NUI A;  1YI2 1;  3NH4 A;  3GTJ I;  3CCS Z;  4E33 A;  2PMZ A;  5IT9 b;  1YJ9 1;  1VQN 1;  2JA6 I;  2M6N A;  2AYD A;  4EWC A;  3MZL B;  2V3V A;  2R92 I;  4E2X A;  2QA4 1;  1YHQ 1;  1VQK Z;  2E9H A;  3GTL I;  4QTU A;  4RV9 A;  4NBA A;  2E2J I;  3QWU A;  1Q82 1;  4MD8 A;  1QF8 A;  1RNI A;  2NVY I;  2O4H A;  3BG1 B;  3TE5 B;  3CCE Z;  3HOY I;  2PK7 A;  3BG0 B;  3G6E 1;  3RZD I;  1QVG Z;  1PFT A;  4NFR A;  2V8I A;  1X3W A;  3CXC Z;  3S2D I;  1K8A 2;  4MD7 A;  3FQQ A;  3G71 Z;  1M1K 1;  3CC4 1;  1Q16 A;  2VUM I;  3CCV Z;  2JS4 A;  2F4M A;  2R7Z I;  5D1O B;  4NBF A;  5C4J I;  4Y7N I;  4TNU A;  4DGL A;  2KPI A;  3CD6 1;  2IZ3 A;  4A3J I;  1R9T I;  3J81 b;  3IFU A;  3J80 f;  1N2F A;  3D9X A;  3CCQ 1;  3NDJ A;  1VQM Z;  2NVX I;  3F3P C;  3RZO I;  3S1R I;  1L1O C;  1SIW A;  3I55 1;  3CCM Z;  1VQO 1;  1Q81 2;  3S1Q I;  1K83 I;  1VQ5 1;  2QKD A;  3NFZ A;  1YIJ 1;  1WJ2 A;  3CCU Z;  2OOX B;  2HF1 A;  3CME Z;  2QRE B;  1Y1W I;  3I4M I;  1Z02 A;  3GTG I;  1SFO I;  2GTH A;  2JR6 A;  3GCF A;  3I07 A;  1QVF Y;  3CMA Z;  3J80 b;  2Q51 A;  1VQ7 Z;  2VF1 A;  1YIT 1;  3S1N I;  1TWH I;  3H0G I;  1K9M 1;  4DK1 A;  1KC8 1;  4BXX I;  4A3M I;  2RT9 A;  4S1T A;  1ZB9 A;  2NVT I;  4RVD A;  1DL6 A;  3CCJ Z;  1RO0 A;  3VB9 A;  1VQL Z;  4BY7 I;  3CCL Z;  3T4N B;  3CC7 1;  1YJW Z;  1K9M 2;  2B63 I;  1RO4 A;  4MXU A;  3I56 Z;  5T64 A;  4Y52 I;  4NB8 A;  4AYB A;  2QRD B;  3M4O I;  1Q7Y 1;  2R93 I;  1I3Q I;  3M3Y I;  2QEX Z;  4A3I I;  2RIQ A;  1LQL A;  4A3K I;  3HOV I;  5IT9 f;  2YU9 I;  2F4O A;  1JWH C;  2V45 A;  1KD1 1;  1VQ8 1;  3P5J B;  2E2H I;  2IZ4 A;  2JMO A;  2YAD A;  2I3C A;  2RHB A;  3LUS A;  3NH8 A;  2OTL Z;  3K7A I;  1VQ6 1;  3S15 I;  3HOW I;  3CC2 Z;  5D1O A;  1JJ2 Z;  2VPZ A;  1NP6 A;  1YUK A;  2W04 A;  1YJN 1;  3CPW Y;  4RS4 A;  1W2B Y;  1YI2 Z;  3CCS 1;  1VQP 1;  3PO3 I;  4A3D I;  1YJ9 Z;  3KIF A;  2OTJ Z;  1VQN Z;  2JIQ A;  4NH1 C;  4A93 I;  3F3F C;  3MZK B;  1K73 2;  5T67 A;  4HGZ A;  2QA4 Z;  2LEX A;  1VQK 1;  3H3V J;  2WB1 A;  2V8J A;  3PO2 I;  2KI7 B;  3S17 I;  1WW9 A;  3D6W A;  1NJI 2;  3CCE 1;  3GTQ I;  3Q87 A;  3TDH B;  3CXC Y;  3IR7 A;  1YUA A;  3G6E Z;  1VQ9 Z;  5IP9 I;  3J7A 4;  3S1M I;  2P3Y A;  4RVF A;  2LIY A;  4E31 A;  3S16 I;  4HGY A;  3VMI A;  3HKZ A;  1S72 Z;  3G71 1;  2QR1 B;  1K8A 1;  2GU2 A;  5C3E I;  3J81 f;  4NBC A;  1VQ4 1;  3CC4 Z;  3HOX I;  4NBG A;  4RVG A;  3CCV 1;  1M90 2;  1QXF A;  2LFU A;  3FQM A;  3G4S 1;  4NOZ A;  2K3R A;  3S2H I;  3CD6 Z;  3VMG A;  2E2I I;  4E2W A;  4X6A I;  1Q82 2; 
#chains in the Genus database with same CATH homology
 3CPW Z;  4CL1 A;  1TWG I;  5C44 I;  4A3C I;  2J6A A;  4HH4 A;  2HU9 A;  2JA8 I;  1VLA A;  1VQM 1;  3GKQ A;  2PM9 A;  3CCM 1;  1QVF Z;  1VQ5 Z;  3JAM f;  5T6B A;  2H85 A;  1KQS Y;  1USP A;  1Q81 1;  1Q86 1;  2RBL A;  3CCR 1;  2OOY B;  1YIJ Z;  3OW2 Y;  4NBB A;  3CCU 1;  1TFI A;  1TWA I;  1KQS Z;  2DE5 A;  2P28 A;  4NBE A;  1N8R 1;  1VQ7 1;  2BJO A;  4E32 A;  1ZH1 A;  2GTI A;  1Z03 A;  1YHQ Z;  3EED A;  1QVG Y;  3PO3 S;  1M1K 2;  3GTP I;  5CM2 M;  5IP7 I;  2JA7 I;  1W2B Z;  1N8R 2;  2QLV B;  2QRC B;  1TWC I;  3ESW A;  2DE7 A;  3VMH A;  3IF8 A;  4E2Z A;  2WAQ A;  1M90 1;  3OW2 Z;  3I56 1;  2G2K A;  2Q4Z A;  1TWF I;  1KRL A;  1KD1 2;  4MRI A;  3GTK I;  2W03 A;  3JAM b;  3NDI A;  5FLX f;  5FLM I;  5A2Q b;  2EGT A;  2O53 A;  4A3E I;  3U50 C;  3GTM I;  2JA5 I;  3CCQ Z;  1I6H I;  4NB9 A;  1VQ8 Z;  1KC8 2;  4BBR I;  2NVQ I;  1Y1V I;  3I55 Z;  1VQO Z;  2OTL 1;  4E30 A;  4MD9 A;  5D1P A;  1K73 1;  1RQF A;  2JUB A;  1QYP A;  1VQ6 Z;  2VUG A;  3CC2 1;  1P9N A;  3CME 1;  1X3Z A;  4XX2 A;  2K5R A;  3NH5 A;  4QTT A;  3CMA 1;  2ZAE B;  4A3G I;  4BBS I;  2V8K A;  1YIT Z;  1VQP Z;  4A3L I;  3GTM S;  1JJ2 Y;  1Q7Y 2;  2OTJ 1;  3HOZ I;  4A3F I;  5FLX b;  3CCJ 1;  1Y1V S;  2DE6 A;  1USP B;  1VQL 1;  3CCL 1;  2M48 A;  3CC7 Z;  1YJW 1;  3MON A;  3FKI I;  1VQ9 1;  1NJI 1;  1ML8 A;  2Y0S A;  3GTO I;  1ZB8 A;  1WII A;  4A3B I;  3S14 I;  1S72 1;  4E2Y A;  1S7M A;  2R6M A;  2AKL A;  2QEX 1;  1X0T A;  1VQ4 Z;  1Q86 2;  4RVH A;  5LL6 f;  4MON A;  4NBD A;  3CQZ I;  5C4X I;  3KIH A;  3G4S Z;  3HOU I;  1WCM I;  2OZK A;  5A2Q f;  3EER A;  1RO2 A;  4NBH A;  5AN9 F;  1RLY A;  4MH4 A;  4DQY B;  4BY1 I;  1Z01 A;  1I50 I;  2RPR A;  3IX0 A;  3VTN A;  2JNY A;  1YJN Z;  3I4N I;  3CCR Z;  1NUI A;  1YI2 1;  3NH4 A;  3GTJ I;  3CCS Z;  4E33 A;  2PMZ A;  5IT9 b;  1YJ9 1;  1VQN 1;  2JA6 I;  2M6N A;  4EWC A;  3MZL B;  2R92 I;  4E2X A;  2QA4 1;  1YHQ 1;  1VQK Z;  2E9H A;  3GTL I;  4QTU A;  4RV9 A;  4NBA A;  2E2J I;  3QWU A;  1Q82 1;  4MD8 A;  1QF8 A;  1RNI A;  2NVY I;  2O4H A;  3BG1 B;  3TE5 B;  3CCE Z;  3HOY I;  2PK7 A;  3BG0 B;  3G6E 1;  3RZD I;  1QVG Z;  1PFT A;  4NFR A;  2V8I A;  1X3W A;  3CXC Z;  3S2D I;  1K8A 2;  4MD7 A;  3FQQ A;  3G71 Z;  1M1K 1;  3CC4 1;  2VUM I;  3CCV Z;  2JS4 A;  2F4M A;  2R7Z I;  5D1O B;  4NBF A;  5C4J I;  4Y7N I;  4TNU A;  4DGL A;  2KPI A;  3CD6 1;  2IZ3 A;  4A3J I;  1R9T I;  3J81 b;  3IFU A;  3J80 f;  1N2F A;  3D9X A;  3CCQ 1;  3NDJ A;  1VQM Z;  2NVX I;  3F3P C;  3RZO I;  3S1R I;  1L1O C;  3I55 1;  3CCM Z;  1VQO 1;  1Q81 2;  3S1Q I;  1K83 I;  1VQ5 1;  2QKD A;  3NFZ A;  1YIJ 1;  3CCU Z;  2OOX B;  1Y1W I;  3CME Z;  2HF1 A;  2QRE B;  3I4M I;  1Z02 A;  3GTG I;  1SFO I;  2GTH A;  2JR6 A;  3GCF A;  3I07 A;  1QVF Y;  3CMA Z;  3J80 b;  2Q51 A;  1VQ7 Z;  2VF1 A;  1YIT 1;  3S1N I;  1TWH I;  3H0G I;  1K9M 1;  4DK1 A;  1KC8 1;  4BXX I;  4A3M I;  2RT9 A;  4S1T A;  1ZB9 A;  2NVT I;  4RVD A;  1DL6 A;  3CCJ Z;  1RO0 A;  3VB9 A;  1VQL Z;  4BY7 I;  3CCL Z;  3T4N B;  3CC7 1;  1YJW Z;  1K9M 2;  2B63 I;  1RO4 A;  4MXU A;  3I56 Z;  5T64 A;  4Y52 I;  4NB8 A;  4AYB A;  2QRD B;  3M4O I;  1Q7Y 1;  2R93 I;  1I3Q I;  3M3Y I;  2QEX Z;  4A3I I;  2RIQ A;  1LQL A;  4A3K I;  3HOV I;  5IT9 f;  2YU9 I;  2F4O A;  1JWH C;  1KD1 1;  1VQ8 1;  3P5J B;  2E2H I;  2IZ4 A;  2JMO A;  2YAD A;  2I3C A;  2RHB A;  3LUS A;  3NH8 A;  2OTL Z;  3K7A I;  1VQ6 1;  3S15 I;  3HOW I;  3CC2 Z;  5D1O A;  1JJ2 Z;  1NP6 A;  1YUK A;  2W04 A;  1YJN 1;  3CPW Y;  4RS4 A;  1W2B Y;  1YI2 Z;  3CCS 1;  1VQP 1;  3PO3 I;  4A3D I;  1YJ9 Z;  3KIF A;  2OTJ Z;  1VQN Z;  4A93 I;  4NH1 C;  3F3F C;  3MZK B;  1K73 2;  5T67 A;  4HGZ A;  2QA4 Z;  1VQK 1;  3H3V J;  2WB1 A;  2V8J A;  3PO2 I;  2KI7 B;  3S17 I;  1WW9 A;  3D6W A;  1NJI 2;  3CCE 1;  3GTQ I;  3Q87 A;  3TDH B;  3CXC Y;  3G6E Z;  1YUA A;  1VQ9 Z;  5IP9 I;  3J7A 4;  3S1M I;  2P3Y A;  4RVF A;  2LIY A;  4E31 A;  3S16 I;  4HGY A;  3VMI A;  3HKZ A;  1S72 Z;  3G71 1;  2QR1 B;  1K8A 1;  2GU2 A;  5C3E I;  3J81 f;  4NBC A;  1VQ4 1;  3CC4 Z;  3HOX I;  4NBG A;  4RVG A;  3CCV 1;  1M90 2;  2LFU A;  3FQM A;  3G4S 1;  4NOZ A;  2K3R A;  3S2H I;  3CD6 Z;  3VMG A;  2E2I I;  4E2W A;  4X6A I;  1Q82 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...