3G711

Co-crystal structure of bruceantin bound to the large ribosomal subunit
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3g71100
2OTJ1 3CCLZ 2QEXZ 3CD6Z 1KD12 1VQ4Z 1VQN1 3CCMZ 2OTJZ 3I561 1QVGZ 1N8R2 1JJ2Y 1VQ51 1Q861 1YJ91 1NJI2 1YITZ 3I56Z 2QEX1 3CCJ1 3CCS1 1VQ6Z 1VQ5Z 1YJW1 1S721 3CCJZ 3CCSZ 1M1K1 1Q821 1QVGY 1M902 1YJN1 3I551 3CCQ1 3CC71 1YJWZ 3CCE1 1KC81 1KQSZ 2QA41 1YIT1 3CMA1 1S72Z 3OW2Z 1K8A2 1KC82 1YJNZ 3I55Z 3G6E1 3CCQZ 3CC7Z 3CCEZ 2QA4Z 1VQ41 3CMAZ 1VQL1 1K9M2 3G6EZ 1YIJ1 1W2BZ 1VQLZ 1Q811 3CPWZ 1VQ71 1KQSY 1Q7Y1 3OW2Y 1K731 3CC21 1YIJZ 1VQKZ 1VQ7Z 3CC41 1YI21 1KD11 3CC2Z 3G4S1 1QVFZ 1W2BY 3G711 1N8R1 3CME1 3CC4Z 3CPWY 1K8A1 1YI2Z 1NJI1 3CCR1 1Q862 1VQO1 3G4SZ 1VQ81 1VQK1 3G71Z 1VQM1 1K9M1 3CMEZ 1VQP1 3CCRZ 3CCV1 1VQOZ 1VQ91 2OTL1 1YHQ1 1VQ8Z 3CCU1 1VQ61 1VQNZ 1VQMZ 1JJ2Z 3CCL1 1QVFY 1VQPZ 1Q812 3CXCY 1M901 3CD61 1M1K2 3CCVZ 1Q7Y2 1Q822 1YJ9Z 1VQ9Z 1K732 1YHQZ 2OTLZ 3CCUZ 3CCM1 3CXCZ
chains in the Genus database with same CATH superfamily
5AN9F 2W04A 2Q4ZA 1VQ4Z 3HKZA 4NB9A 4NBBA 1VQ51 3VMIA 3FQMA 2DE7A 3U50C 2JA7I 4A3JI 3HOYI 2R6MA 2QEX1 5IT9f 2W03A 4Y52I 3P5JB 2M6NA 2QRDB 2IV2X 2JIOA 2HF1A 3IX0A 2DE6A 1M1K1 2VPZA 1Q821 1QVGY 4NFRA 1Y1WI 1ZH1A 2P3YA 1YIT1 1S72Z 1Z02A 5T64A 1PFTA 2JUBA 1YJNZ 3I55Z 2G2KA 3PO2I 5D1OB 1X3WA 1YIJ1 1TWFI 1LQLA 1Q16A 1VQ71 2GTIA 1KQSY 3FQQA 5D1PA 1Z03A 4NBHA 3M3YI 2V3VA 1K731 1QYPA 3NH4A 4RVFA 2JNYA 3HOUI 1R9TI 2GU2A 2ZAEB 2I3CA 2VPYA 4A3BI 3G4S1 2QR1B 1W2BY 3VMHA 3G711 1K83I 3NDJA 1YI2Z 4HGYA 2E2II 5C3EI 1NP6A 1VQK1 4A3KI 3F3FC 3CMEZ 1SFOI 1Z01A 1WW9A 1ZB8A 1VQ91 1VQMZ 1JJ2Z 3H0GI 1SIWA 4QTUA 4NBCA 4BBRI 3CXCY 4MH4A 1M1K2 3CCVZ 5D1OA 1Q7Y2 1Q822 4DGLA 3GTLI 2OTLZ 1YHQZ 1VQ41 2RHBA 1VQ6Z 3CXCZ 1I6HI 2JIMA 3MZLB 4NBAA 4AYBA 3S1NI 1VQN1 2OTJZ 1TWAI 1N8R2 3S17I 1ZB9A 5FLXf 1Y1VS 1USPB 3LUSA 2OOYB 3S14I 2DE5A 1ML8A 3TE5B 2KPIA 4E30A 5IP7I 1S721 3CCJZ 3CCSZ 2O4HA 3F3PC 1TWCI 2JIQA 3RZOI 2NVTI 1YJN1 3I551 1WZNA 1YJWZ 3HOWI 3M4OI 1KC81 1WIIA 3OW2Z 2GTHA 2JIPA 3Q87A 3S1QI 1YUKA 2LIYA 2QA4Z 4BY7I 1Y1VI 2BJOA 3KIHA 4MONA 4NBFA 2IZ3A 2V8JA 3VMGA 3GKQA 3GTPI 4DQYB 2RT9A 4RVHA 5C44I 3HOXI 3IR7A 1Q7Y1 2YADA 3I07A 2PMZA 3NH5A 1RNIA 1YI21 3IFUA 2E2HI 1USPA 2K5RA 2JA8I 1N8R1 3CME1 2Y0SA 1FDIA 3T4NB 2NVQI 3GTJI 1VQM1 1K9M1 3HOZI 4S1TA 2J6AA 3CCRZ 3CCV1 3H3VJ 3BG1B 4NB8A 4E2ZA 4A93I 2JMOA 2OTL1 1YHQ1 1VQ61 2M48A 4RS4A 2LEXA 1VQPZ 1Q812 1L1OC 4DK1A 1S7MA 1VLAA 3BG0B 4MD8A 2H85A 1KC82 2OTJ1 3CCLZ 2E7ZA 2QEXZ 3CD6Z 1X3ZA 2QRCB 1KD12 2NVXI 2RIQA 3CCMZ 3GTOI 1JJ2Y 3TDHB 3D2LA 1Q861 1YJ91 3S15I 1NJI2 3S1MI 3MZKB 2E9HA 1RLYA 4A3FI 4A3MI 1YITZ 3I56Z 4A3DI 3VB9A 3CCJ1 3CCS1 2E2JI 4EWCA 4NBEA 1QF8A 3K7AI 4E32A 1YJW1 4RVDA 3JAMb 1DL6A 4XX2A 2RBLA 3J80b 2YU9I 2NAPA 1M902 2F4MA 2KI7B 2WAQA 3NDIA 4NOZA 2QA41 3D6WA 3J80f 5CM2M 1WJ2A 3CCQZ 4E31A 3CC7Z 3CCEZ 3CMAZ 1K9M2 3NFZA 2JR6A 5FLMI 5LL6f 3GTQI 1NUIA 3G6EZ 3HOVI 3EERA 1VQLZ 1Q811 3CPWZ 3I4MI 3OW2Y 2VPXA 1TWHI 2WB1A 4RV9A 2B63I 2PK7A 1VQKZ 3GTGI 4CL1A 4E2YA 1KD11 3GTKI 3I4NI 3CC2Z 2AKLA 4NH1C 4NBDA 1QVFZ 4BXXI 2JS4A 3CC4Z 1QXFA 1K8A1 1NJI1 3CCR1 1Q862 4E33A 3D9XA 1VQP1 5IT9b 2JIRA 1VQOZ 4A3CI 1VQ8Z 2JA6I 3S2DI 1VQNZ 2AYDA 3CCL1 2OZKA 1N2FA 1RO2A 1TFIA 1M901 3CD61 5IP9I 3CCUZ 3CCM1 3GTMS 5T67A 2F4OA 4TNUA 4QTTA 2O53A 5A2Qb 4MXUA 3S2HI 2VUMI 1KRLA 2IZ4A 3I561 1QVGZ 3J81b 4A3LI 4E2XA 5A2Qf 2QREB 3ESWA 2NVYI 4X6AI 4RVGA 1VQ5Z 3J81f 4MRIA 4NBGA 1RQFA 1AA6A 1JWHC 3S1RI 2JA5I 3S16I 4HGZA 3FKII 3GTMI 3CCQ1 2V8IA 3CC71 2VPWA 3CCE1 3RZDI 1KQSZ 3MONA 3CMA1 3PO3S 4E2WA 4Y7NI 1X0TA 1K8A2 5C4JI 3G6E1 1YUAA 3QWUA 5T6BA 1VQL1 1P9NA 2VUGA 4A3II 1W2BZ 3CQZI 4A3GI 1RO4A 3EEDA 4MD7A 2RPRA 3CC21 1YIJZ 2R93I 4BBSI 1RO0A 1VQ7Z 2LFUA 3JAMf 3CC41 2OOXB 1FDOA 3PO3I 2R7ZI 2K3RA 4HH4A 4A3EI 3IF8A 1I3QI 3KIFA 2QLVB 2EGTA 2HU9A 3CPWY 2R92I 5FLXb 5C4XI 4BY1I 4MD9A 1VQO1 2QKDA 3G4SZ 1VQ81 3G71Z 2V8KA 3J7A4 3GCFA 1Y8CA 3CCU1 3NH8A 1QVFY 3VTNA 2P28A 1TWGI 1WCMI 2VF1A 1YJ9Z 1I50I 2V45A 2Q51A 1VQ9Z 1K732 2PM9A
chains in the Genus database with same CATH topology
5AN9F 2W04A 2Q4ZA 1VQ4Z 3HKZA 4NB9A 4NBBA 1VQ51 3VMIA 3FQMA 2DE7A 3U50C 2JA7I 4A3JI 3HOYI 2R6MA 2QEX1 5IT9f 2W03A 4Y52I 3P5JB 2M6NA 2QRDB 2HF1A 3IX0A 2DE6A 1M1K1 1Q821 1QVGY 4NFRA 1Y1WI 1ZH1A 2P3YA 1YIT1 1S72Z 1Z02A 5T64A 1PFTA 2JUBA 1YJNZ 3I55Z 2G2KA 3PO2I 5D1OB 1X3WA 1YIJ1 1TWFI 1LQLA 1VQ71 2GTIA 1KQSY 3FQQA 5D1PA 1Z03A 4NBHA 3M3YI 1K731 1QYPA 3NH4A 4RVFA 2JNYA 3HOUI 1R9TI 2GU2A 2ZAEB 2I3CA 4A3BI 3G4S1 2QR1B 1W2BY 3VMHA 3G711 1K83I 3NDJA 1YI2Z 4HGYA 2E2II 5C3EI 1NP6A 1VQK1 4A3KI 3F3FC 3CMEZ 1SFOI 1Z01A 1WW9A 1ZB8A 1VQ91 1VQMZ 1JJ2Z 3H0GI 4QTUA 4NBCA 4BBRI 3CXCY 4MH4A 1M1K2 3CCVZ 5D1OA 1Q7Y2 1Q822 4DGLA 3GTLI 2OTLZ 1YHQZ 1VQ41 2RHBA 1VQ6Z 3CXCZ 1I6HI 3MZLB 4NBAA 4AYBA 3S1NI 1VQN1 2OTJZ 1TWAI 1N8R2 3S17I 1ZB9A 5FLXf 1Y1VS 1USPB 3LUSA 2OOYB 3S14I 2DE5A 1ML8A 3TE5B 2KPIA 4E30A 5IP7I 1S721 3CCJZ 3CCSZ 2O4HA 3F3PC 1TWCI 3RZOI 2NVTI 1YJN1 3I551 1YJWZ 3HOWI 3M4OI 1KC81 1WIIA 3OW2Z 2GTHA 3Q87A 3S1QI 1YUKA 2LIYA 2QA4Z 4BY7I 1Y1VI 2BJOA 3KIHA 4MONA 4NBFA 2IZ3A 2V8JA 3VMGA 3GKQA 3GTPI 4DQYB 2RT9A 4RVHA 5C44I 3HOXI 1Q7Y1 2YADA 3I07A 2PMZA 3NH5A 1RNIA 1YI21 3IFUA 2E2HI 1USPA 2K5RA 2JA8I 1N8R1 3CME1 2Y0SA 3T4NB 2NVQI 3GTJI 1VQM1 1K9M1 3HOZI 4S1TA 2J6AA 3CCRZ 3CCV1 3H3VJ 3BG1B 4NB8A 4E2ZA 4A93I 2JMOA 2OTL1 1YHQ1 1VQ61 2M48A 4RS4A 1VQPZ 1Q812 1L1OC 4DK1A 1S7MA 1VLAA 3BG0B 4MD8A 2H85A 1KC82 2OTJ1 3CCLZ 2QEXZ 3CD6Z 1X3ZA 2QRCB 1KD12 2NVXI 2RIQA 3CCMZ 3GTOI 1JJ2Y 3TDHB 1Q861 1YJ91 3S15I 1NJI2 3S1MI 3MZKB 2E9HA 1RLYA 4A3FI 4A3MI 1YITZ 3I56Z 4A3DI 3VB9A 3CCJ1 3CCS1 2E2JI 4EWCA 4NBEA 1QF8A 3K7AI 4E32A 1YJW1 4RVDA 3JAMb 1DL6A 4XX2A 2RBLA 3J80b 2YU9I 1M902 2F4MA 2KI7B 2WAQA 3NDIA 4NOZA 2QA41 3D6WA 3J80f 5CM2M 3CCQZ 3CC7Z 4E31A 3CCEZ 3CMAZ 1K9M2 3NFZA 2JR6A 5FLMI 5LL6f 3GTQI 1NUIA 3G6EZ 3HOVI 3EERA 1VQLZ 1Q811 3CPWZ 3I4MI 3OW2Y 1TWHI 2WB1A 4RV9A 2B63I 2PK7A 1VQKZ 3GTGI 4CL1A 4E2YA 1KD11 3GTKI 3I4NI 3CC2Z 2AKLA 4NH1C 4NBDA 1QVFZ 4BXXI 2JS4A 3CC4Z 1K8A1 1NJI1 3CCR1 1Q862 4E33A 3D9XA 1VQP1 5IT9b 1VQOZ 4A3CI 1VQ8Z 2JA6I 3S2DI 1VQNZ 3CCL1 2OZKA 1N2FA 1RO2A 1TFIA 1M901 3CD61 5IP9I 3CCUZ 3CCM1 3GTMS 5T67A 2F4OA 4TNUA 4QTTA 2O53A 5A2Qb 4MXUA 3S2HI 2VUMI 1KRLA 2IZ4A 3I561 1QVGZ 3J81b 4A3LI 4E2XA 5A2Qf 2QREB 3ESWA 2NVYI 4X6AI 4RVGA 1VQ5Z 3J81f 4MRIA 4NBGA 1RQFA 1JWHC 3S1RI 2JA5I 3S16I 4HGZA 3FKII 3GTMI 3CCQ1 2V8IA 3CC71 3CCE1 3RZDI 1KQSZ 3MONA 3CMA1 3PO3S 4E2WA 4Y7NI 1X0TA 1K8A2 5C4JI 3G6E1 1YUAA 3QWUA 5T6BA 1VQL1 1P9NA 2VUGA 4A3II 1W2BZ 3CQZI 4A3GI 1RO4A 3EEDA 4MD7A 2RPRA 3CC21 1YIJZ 2R93I 4BBSI 1RO0A 1VQ7Z 2LFUA 3JAMf 3CC41 2OOXB 3PO3I 2R7ZI 2K3RA 4HH4A 4A3EI 3IF8A 1I3QI 3KIFA 2QLVB 2EGTA 2HU9A 3CPWY 2R92I 5FLXb 5C4XI 4BY1I 4MD9A 1VQO1 2QKDA 3G4SZ 1VQ81 3G71Z 2V8KA 3J7A4 3GCFA 3CCU1 3NH8A 1QVFY 3VTNA 2P28A 1TWGI 1WCMI 2VF1A 1YJ9Z 1I50I 2Q51A 1VQ9Z 1K732 2PM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTJ 1;  3CCL Z;  2QEX Z;  3CD6 Z;  1KD1 2;  1VQ4 Z;  1VQN 1;  3CCM Z;  2OTJ Z;  3I56 1;  1QVG Z;  1N8R 2;  1JJ2 Y;  1VQ5 1;  1Q86 1;  1YJ9 1;  1NJI 2;  1YIT Z;  3I56 Z;  2QEX 1;  3CCJ 1;  3CCS 1;  1VQ6 Z;  1VQ5 Z;  1YJW 1;  1S72 1;  3CCJ Z;  3CCS Z;  1M1K 1;  1Q82 1;  1QVG Y;  1M90 2;  1YJN 1;  3I55 1;  3CCQ 1;  3CC7 1;  1YJW Z;  3CCE 1;  1KC8 1;  1KQS Z;  2QA4 1;  1YIT 1;  3CMA 1;  1S72 Z;  3OW2 Z;  1K8A 2;  1KC8 2;  1YJN Z;  3I55 Z;  3G6E 1;  3CCQ Z;  3CC7 Z;  3CCE Z;  2QA4 Z;  1VQ4 1;  3CMA Z;  1VQL 1;  1K9M 2;  3G6E Z;  1YIJ 1;  1W2B Z;  1VQL Z;  1Q81 1;  3CPW Z;  1VQ7 1;  1KQS Y;  1Q7Y 1;  3OW2 Y;  1K73 1;  3CC2 1;  1YIJ Z;  1VQK Z;  1VQ7 Z;  3CC4 1;  1YI2 1;  1KD1 1;  3CC2 Z;  3G4S 1;  1QVF Z;  1W2B Y;  3G71 1;  1N8R 1;  3CME 1;  3CC4 Z;  3CPW Y;  1K8A 1;  1YI2 Z;  1NJI 1;  3CCR 1;  1Q86 2;  1VQO 1;  3G4S Z;  1VQ8 1;  1VQK 1;  3G71 Z;  1VQM 1;  1K9M 1;  3CME Z;  1VQP 1;  3CCR Z;  3CCV 1;  1VQO Z;  1VQ9 1;  2OTL 1;  1YHQ 1;  1VQ8 Z;  3CCU 1;  1VQ6 1;  1VQN Z;  1VQM Z;  1JJ2 Z;  3CCL 1;  1QVF Y;  1VQP Z;  1Q81 2;  3CXC Y;  1M90 1;  3CD6 1;  1M1K 2;  3CCV Z;  1Q7Y 2;  1Q82 2;  1YJ9 Z;  1VQ9 Z;  1K73 2;  1YHQ Z;  2OTL Z;  3CCU Z;  3CCM 1;  3CXC Z; 
#chains in the Genus database with same CATH topology
 5AN9 F;  2W04 A;  2Q4Z A;  1VQ4 Z;  3HKZ A;  4NB9 A;  4NBB A;  1VQ5 1;  3VMI A;  3FQM A;  2DE7 A;  3U50 C;  2JA7 I;  4A3J I;  3HOY I;  2R6M A;  2QEX 1;  5IT9 f;  2W03 A;  4Y52 I;  3P5J B;  2M6N A;  2QRD B;  2IV2 X;  2JIO A;  2HF1 A;  3IX0 A;  2DE6 A;  1M1K 1;  2VPZ A;  1Q82 1;  1QVG Y;  4NFR A;  1Y1W I;  1ZH1 A;  2P3Y A;  1YIT 1;  1S72 Z;  1Z02 A;  5T64 A;  1PFT A;  2JUB A;  1YJN Z;  3I55 Z;  2G2K A;  3PO2 I;  5D1O B;  1X3W A;  1YIJ 1;  1TWF I;  1LQL A;  1Q16 A;  1VQ7 1;  2GTI A;  1KQS Y;  3FQQ A;  5D1P A;  1Z03 A;  4NBH A;  3M3Y I;  2V3V A;  1K73 1;  1QYP A;  3NH4 A;  4RVF A;  2JNY A;  3HOU I;  1R9T I;  2GU2 A;  2ZAE B;  2I3C A;  2VPY A;  4A3B I;  3G4S 1;  2QR1 B;  1W2B Y;  3VMH A;  3G71 1;  1K83 I;  3NDJ A;  1YI2 Z;  4HGY A;  2E2I I;  5C3E I;  1NP6 A;  1VQK 1;  4A3K I;  3F3F C;  3CME Z;  1SFO I;  1Z01 A;  1WW9 A;  1ZB8 A;  1VQ9 1;  1VQM Z;  1JJ2 Z;  3H0G I;  1SIW A;  4QTU A;  4NBC A;  4BBR I;  3CXC Y;  4MH4 A;  1M1K 2;  3CCV Z;  5D1O A;  1Q7Y 2;  1Q82 2;  4DGL A;  3GTL I;  2OTL Z;  1YHQ Z;  1VQ4 1;  2RHB A;  1VQ6 Z;  3CXC Z;  1I6H I;  2JIM A;  3MZL B;  4NBA A;  4AYB A;  3S1N I;  1VQN 1;  2OTJ Z;  1TWA I;  1N8R 2;  3S17 I;  1ZB9 A;  5FLX f;  1Y1V S;  1USP B;  3LUS A;  2OOY B;  3S14 I;  2DE5 A;  1ML8 A;  3TE5 B;  2KPI A;  4E30 A;  5IP7 I;  1S72 1;  3CCJ Z;  3CCS Z;  2O4H A;  3F3P C;  1TWC I;  2JIQ A;  3RZO I;  2NVT I;  1YJN 1;  3I55 1;  1WZN A;  1YJW Z;  3HOW I;  3M4O I;  1KC8 1;  1WII A;  3OW2 Z;  2GTH A;  2JIP A;  3Q87 A;  3S1Q I;  1YUK A;  2LIY A;  2QA4 Z;  4BY7 I;  1Y1V I;  2BJO A;  3KIH A;  4MON A;  4NBF A;  2IZ3 A;  2V8J A;  3VMG A;  3GKQ A;  3GTP I;  4DQY B;  2RT9 A;  4RVH A;  5C44 I;  3HOX I;  3IR7 A;  1Q7Y 1;  2YAD A;  3I07 A;  2PMZ A;  3NH5 A;  1RNI A;  1YI2 1;  3IFU A;  2E2H I;  1USP A;  2K5R A;  2JA8 I;  1N8R 1;  3CME 1;  2Y0S A;  1FDI A;  3T4N B;  2NVQ I;  3GTJ I;  1VQM 1;  1K9M 1;  3HOZ I;  4S1T A;  2J6A A;  3CCR Z;  3CCV 1;  3H3V J;  3BG1 B;  4NB8 A;  4E2Z A;  4A93 I;  2JMO A;  2OTL 1;  1YHQ 1;  1VQ6 1;  2M48 A;  4RS4 A;  2LEX A;  1VQP Z;  1Q81 2;  1L1O C;  4DK1 A;  1S7M A;  1VLA A;  3BG0 B;  4MD8 A;  2H85 A;  1KC8 2;  2OTJ 1;  3CCL Z;  2E7Z A;  2QEX Z;  3CD6 Z;  1X3Z A;  2QRC B;  1KD1 2;  2NVX I;  2RIQ A;  3CCM Z;  3GTO I;  1JJ2 Y;  3TDH B;  3D2L A;  1Q86 1;  1YJ9 1;  3S15 I;  1NJI 2;  3S1M I;  3MZK B;  2E9H A;  1RLY A;  4A3F I;  4A3M I;  1YIT Z;  3I56 Z;  4A3D I;  3VB9 A;  3CCJ 1;  3CCS 1;  2E2J I;  4EWC A;  4NBE A;  1QF8 A;  3K7A I;  4E32 A;  1YJW 1;  4RVD A;  3JAM b;  1DL6 A;  4XX2 A;  2RBL A;  3J80 b;  2YU9 I;  2NAP A;  1M90 2;  2F4M A;  2KI7 B;  2WAQ A;  3NDI A;  4NOZ A;  2QA4 1;  3D6W A;  3J80 f;  5CM2 M;  1WJ2 A;  3CCQ Z;  4E31 A;  3CC7 Z;  3CCE Z;  3CMA Z;  1K9M 2;  3NFZ A;  2JR6 A;  5FLM I;  5LL6 f;  3GTQ I;  1NUI A;  3G6E Z;  3HOV I;  3EER A;  1VQL Z;  1Q81 1;  3CPW Z;  3I4M I;  3OW2 Y;  2VPX A;  1TWH I;  2WB1 A;  4RV9 A;  2B63 I;  2PK7 A;  1VQK Z;  3GTG I;  4CL1 A;  4E2Y A;  1KD1 1;  3GTK I;  3I4N I;  3CC2 Z;  2AKL A;  4NH1 C;  4NBD A;  1QVF Z;  4BXX I;  2JS4 A;  3CC4 Z;  1QXF A;  1K8A 1;  1NJI 1;  3CCR 1;  1Q86 2;  4E33 A;  3D9X A;  1VQP 1;  5IT9 b;  2JIR A;  1VQO Z;  4A3C I;  1VQ8 Z;  2JA6 I;  3S2D I;  1VQN Z;  2AYD A;  3CCL 1;  2OZK A;  1N2F A;  1RO2 A;  1TFI A;  1M90 1;  3CD6 1;  5IP9 I;  3CCU Z;  3CCM 1;  3GTM S;  5T67 A;  2F4O A;  4TNU A;  4QTT A;  2O53 A;  5A2Q b;  4MXU A;  3S2H I;  2VUM I;  1KRL A;  2IZ4 A;  3I56 1;  1QVG Z;  3J81 b;  4A3L I;  4E2X A;  5A2Q f;  2QRE B;  3ESW A;  2NVY I;  4X6A I;  4RVG A;  1VQ5 Z;  3J81 f;  4MRI A;  4NBG A;  1RQF A;  1AA6 A;  1JWH C;  3S1R I;  2JA5 I;  3S16 I;  4HGZ A;  3FKI I;  3GTM I;  3CCQ 1;  2V8I A;  3CC7 1;  2VPW A;  3CCE 1;  3RZD I;  1KQS Z;  3MON A;  3CMA 1;  3PO3 S;  4E2W A;  4Y7N I;  1X0T A;  1K8A 2;  5C4J I;  3G6E 1;  1YUA A;  3QWU A;  5T6B A;  1VQL 1;  1P9N A;  2VUG A;  4A3I I;  1W2B Z;  3CQZ I;  4A3G I;  1RO4 A;  3EED A;  4MD7 A;  2RPR A;  3CC2 1;  1YIJ Z;  2R93 I;  4BBS I;  1RO0 A;  1VQ7 Z;  2LFU A;  3JAM f;  3CC4 1;  2OOX B;  1FDO A;  3PO3 I;  2R7Z I;  2K3R A;  4HH4 A;  4A3E I;  3IF8 A;  1I3Q I;  3KIF A;  2QLV B;  2EGT A;  2HU9 A;  3CPW Y;  2R92 I;  5FLX b;  5C4X I;  4BY1 I;  4MD9 A;  1VQO 1;  2QKD A;  3G4S Z;  1VQ8 1;  3G71 Z;  2V8K A;  3J7A 4;  3GCF A;  1Y8C A;  3CCU 1;  3NH8 A;  1QVF Y;  3VTN A;  2P28 A;  1TWG I;  1WCM I;  2VF1 A;  1YJ9 Z;  1I50 I;  2V45 A;  2Q51 A;  1VQ9 Z;  1K73 2;  2PM9 A; 
#chains in the Genus database with same CATH homology
 5AN9 F;  2W04 A;  2Q4Z A;  1VQ4 Z;  3HKZ A;  4NB9 A;  4NBB A;  1VQ5 1;  3VMI A;  3FQM A;  2DE7 A;  3U50 C;  2JA7 I;  4A3J I;  3HOY I;  2R6M A;  2QEX 1;  5IT9 f;  2W03 A;  4Y52 I;  3P5J B;  2M6N A;  2QRD B;  2HF1 A;  3IX0 A;  2DE6 A;  1M1K 1;  1Q82 1;  1QVG Y;  4NFR A;  1Y1W I;  1ZH1 A;  2P3Y A;  1YIT 1;  1S72 Z;  1Z02 A;  5T64 A;  1PFT A;  2JUB A;  1YJN Z;  3I55 Z;  2G2K A;  3PO2 I;  5D1O B;  1X3W A;  1YIJ 1;  1TWF I;  1LQL A;  1VQ7 1;  2GTI A;  1KQS Y;  3FQQ A;  5D1P A;  1Z03 A;  4NBH A;  3M3Y I;  1K73 1;  1QYP A;  3NH4 A;  4RVF A;  2JNY A;  3HOU I;  1R9T I;  2GU2 A;  2ZAE B;  2I3C A;  4A3B I;  3G4S 1;  2QR1 B;  1W2B Y;  3VMH A;  3G71 1;  1K83 I;  3NDJ A;  1YI2 Z;  4HGY A;  2E2I I;  5C3E I;  1NP6 A;  1VQK 1;  4A3K I;  3F3F C;  3CME Z;  1SFO I;  1Z01 A;  1WW9 A;  1ZB8 A;  1VQ9 1;  1VQM Z;  1JJ2 Z;  3H0G I;  4QTU A;  4NBC A;  4BBR I;  3CXC Y;  4MH4 A;  1M1K 2;  3CCV Z;  5D1O A;  1Q7Y 2;  1Q82 2;  4DGL A;  3GTL I;  2OTL Z;  1YHQ Z;  1VQ4 1;  2RHB A;  1VQ6 Z;  3CXC Z;  1I6H I;  3MZL B;  4NBA A;  4AYB A;  3S1N I;  1VQN 1;  2OTJ Z;  1TWA I;  1N8R 2;  3S17 I;  1ZB9 A;  5FLX f;  1Y1V S;  1USP B;  3LUS A;  2OOY B;  3S14 I;  2DE5 A;  1ML8 A;  3TE5 B;  2KPI A;  4E30 A;  5IP7 I;  1S72 1;  3CCJ Z;  3CCS Z;  2O4H A;  3F3P C;  1TWC I;  3RZO I;  2NVT I;  1YJN 1;  3I55 1;  1YJW Z;  3HOW I;  3M4O I;  1KC8 1;  1WII A;  3OW2 Z;  2GTH A;  3Q87 A;  3S1Q I;  1YUK A;  2LIY A;  2QA4 Z;  4BY7 I;  1Y1V I;  2BJO A;  3KIH A;  4MON A;  4NBF A;  2IZ3 A;  2V8J A;  3VMG A;  3GKQ A;  3GTP I;  4DQY B;  2RT9 A;  4RVH A;  5C44 I;  3HOX I;  1Q7Y 1;  2YAD A;  3I07 A;  2PMZ A;  3NH5 A;  1RNI A;  1YI2 1;  3IFU A;  2E2H I;  1USP A;  2K5R A;  2JA8 I;  1N8R 1;  3CME 1;  2Y0S A;  3T4N B;  2NVQ I;  3GTJ I;  1VQM 1;  1K9M 1;  3HOZ I;  4S1T A;  2J6A A;  3CCR Z;  3CCV 1;  3H3V J;  3BG1 B;  4NB8 A;  4E2Z A;  4A93 I;  2JMO A;  2OTL 1;  1YHQ 1;  1VQ6 1;  2M48 A;  4RS4 A;  1VQP Z;  1Q81 2;  1L1O C;  4DK1 A;  1S7M A;  1VLA A;  3BG0 B;  4MD8 A;  2H85 A;  1KC8 2;  2OTJ 1;  3CCL Z;  2QEX Z;  3CD6 Z;  1X3Z A;  2QRC B;  1KD1 2;  2NVX I;  2RIQ A;  3CCM Z;  3GTO I;  1JJ2 Y;  3TDH B;  1Q86 1;  1YJ9 1;  3S15 I;  1NJI 2;  3S1M I;  3MZK B;  2E9H A;  1RLY A;  4A3F I;  4A3M I;  1YIT Z;  3I56 Z;  4A3D I;  3VB9 A;  3CCJ 1;  3CCS 1;  2E2J I;  4EWC A;  4NBE A;  1QF8 A;  3K7A I;  4E32 A;  1YJW 1;  4RVD A;  3JAM b;  1DL6 A;  4XX2 A;  2RBL A;  3J80 b;  2YU9 I;  1M90 2;  2F4M A;  2KI7 B;  2WAQ A;  3NDI A;  4NOZ A;  2QA4 1;  3D6W A;  3J80 f;  5CM2 M;  3CCQ Z;  3CC7 Z;  4E31 A;  3CCE Z;  3CMA Z;  1K9M 2;  3NFZ A;  2JR6 A;  5FLM I;  5LL6 f;  3GTQ I;  1NUI A;  3G6E Z;  3HOV I;  3EER A;  1VQL Z;  1Q81 1;  3CPW Z;  3I4M I;  3OW2 Y;  1TWH I;  2WB1 A;  4RV9 A;  2B63 I;  2PK7 A;  1VQK Z;  3GTG I;  4CL1 A;  4E2Y A;  1KD1 1;  3GTK I;  3I4N I;  3CC2 Z;  2AKL A;  4NH1 C;  4NBD A;  1QVF Z;  4BXX I;  2JS4 A;  3CC4 Z;  1K8A 1;  1NJI 1;  3CCR 1;  1Q86 2;  4E33 A;  3D9X A;  1VQP 1;  5IT9 b;  1VQO Z;  4A3C I;  1VQ8 Z;  2JA6 I;  3S2D I;  1VQN Z;  3CCL 1;  2OZK A;  1N2F A;  1RO2 A;  1TFI A;  1M90 1;  3CD6 1;  5IP9 I;  3CCU Z;  3CCM 1;  3GTM S;  5T67 A;  2F4O A;  4TNU A;  4QTT A;  2O53 A;  5A2Q b;  4MXU A;  3S2H I;  2VUM I;  1KRL A;  2IZ4 A;  3I56 1;  1QVG Z;  3J81 b;  4A3L I;  4E2X A;  5A2Q f;  2QRE B;  3ESW A;  2NVY I;  4X6A I;  4RVG A;  1VQ5 Z;  3J81 f;  4MRI A;  4NBG A;  1RQF A;  1JWH C;  3S1R I;  2JA5 I;  3S16 I;  4HGZ A;  3FKI I;  3GTM I;  3CCQ 1;  2V8I A;  3CC7 1;  3CCE 1;  3RZD I;  1KQS Z;  3MON A;  3CMA 1;  3PO3 S;  4E2W A;  4Y7N I;  1X0T A;  1K8A 2;  5C4J I;  3G6E 1;  1YUA A;  3QWU A;  5T6B A;  1VQL 1;  1P9N A;  2VUG A;  4A3I I;  1W2B Z;  3CQZ I;  4A3G I;  1RO4 A;  3EED A;  4MD7 A;  2RPR A;  3CC2 1;  1YIJ Z;  2R93 I;  4BBS I;  1RO0 A;  1VQ7 Z;  2LFU A;  3JAM f;  3CC4 1;  2OOX B;  3PO3 I;  2R7Z I;  2K3R A;  4HH4 A;  4A3E I;  3IF8 A;  1I3Q I;  3KIF A;  2QLV B;  2EGT A;  2HU9 A;  3CPW Y;  2R92 I;  5FLX b;  5C4X I;  4BY1 I;  4MD9 A;  1VQO 1;  2QKD A;  3G4S Z;  1VQ8 1;  3G71 Z;  2V8K A;  3J7A 4;  3GCF A;  3CCU 1;  3NH8 A;  1QVF Y;  3VTN A;  2P28 A;  1TWG I;  1WCM I;  2VF1 A;  1YJ9 Z;  1I50 I;  2Q51 A;  1VQ9 Z;  1K73 2;  2PM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...