2JA6I

Cpd lesion containing rna polymerase ii elongation complex b
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
116
structure length
116
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title CPD damage recognition by transcribing RNA polymerase II.
pubmed doi rcsb
molecule tags Transferase
total genus 8
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2ja6I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2ja6I02
1YUAA 2AKLA 4BY1I 4A93I 5C44I 1RO4A 3GTOI 2VUMI 2J6AA 3D6WA 3S1NI 4NB9A 4X6AI 4A3JI 3VMIA 1N2FA 4NBDA 2K5RA 2HF1A 1USPA 3I4NI 4Y52I 2E2JI 2JA7I 1L1OC 4NBAA 1TWGI 3VMHA 3S14I 3S17I 4A3KI 4BXXI 4NOZA 2DE6A 1K83I 3RZDI 1DL6A 3S1MI 4XX2A 3VB9A 5FLMI 4NB8A 3HOZI 4QTUA 4A3BI 3K7AI 4A3EI 1X3WA 3PO3S 4QTTA 4NBHA 3U50C 2BJOA 4NBFA 1Y1VS 3HOWI 4NBBA 1WCMI 1TWFI 3GTJI 1ZB9A 3S15I 3CQZI 3FKII 3I07A 3H0GI 1TWCI 3I4MI 4A3FI 4NBGA 3PO2I 1I6HI 3GTMI 3Q87A 2JA5I 1NUIA 3GCFA 3VMGA 1X3ZA 1USPB 4NBCA 3HOVI 2JS4A 2KPIA 1R9TI 1Y1WI 3GTQI 3M4OI 2RBLA 2F4MA 3GTKI 3ESWA 3GKQA 2YU9I 3HOYI 2R7ZI 3H3VJ 3HOUI 3S2DI 3S1RI 2PK7A 5C4XI 3EERA 1QYPA 5C3EI 1RLYA 1WW9A 4NBEA 4BBSI 2E2HI 2R93I 1TWHI 2B63I 2NVYI 5CM2M 2E2II 1LQLA 2R92I 1I50I 4BY7I 4A3DI 5IP7I 3PO3I 3GTMS 1PFTA 2JA6I 3GTLI 3M3YI 2NVXI 1I3QI 3RZOI 4A3MI 1ML8A 1Y1VI 2NVQI 3S16I 5IP9I 2DE7A 2JA8I 4MH4A 3S2HI 1TFIA 3LUSA 2JR6A 4A3CI 4A3II 2F4OA 4Y7NI 2NVTI 1TWAI 2DE5A 2JNYA 2P3YA 1ZB8A 3HOXI 3GTPI 3S1QI 4A3GI 4BBRI 1VLAA 4A3LI 1SFOI 5C4JI 3GTGI
chains in the Genus database with same CATH superfamily
1YUAA 1YHQZ 3CCUZ 1RO4A 2M48A 3D6WA 1M1K1 4E2XA 2AYDA 2QKDA 3CC2Z 4MXUA 1USPA 2V3VA 2WB1A 4RVFA 2E2JI 4DK1A 4RS4A 2E7ZA 2QA41 3S17I 5T6BA 4NOZA 3RZDI 2JUBA 1YHQ1 3CCU1 2OTLZ 4EWCA 4E33A 5FLMI 3U50C 2BJOA 3CC21 3J7A4 3HOWI 2R6MA 2OTJZ 3G4SZ 3CXCZ 3CC7Z 3I07A 3I4MI 4A3FI 1FDOA 3CCJZ 4MD9A 3NFZA 3CD6Z 3QWUA 1X3ZA 1USPB 3IX0A 4E32A 2V8JA 2JS4A 4MRIA 2H85A 4RVHA 1Y1WI 1VQ5Z 2RBLA 2P28A 3HOYI 3S2DI 1WJ2A 1QVFY 2OTJ1 2PK7A 3G6EZ 3G4S1 1QYPA 3CC71 1VQ9Z 1WW9A 1NJI1 1TWHI 2NVYI 2IV2X 4BY7I 3CD61 2QRDB 1QVGZ 3GTLI 4DQYB 4A3MI 2NVQI 1VQ51 1Y8CA 1JJ2Y 4A3CI 4RVGA 1YI2Z 3G6E1 3CC4Z 1VQ91 1K8A2 1Q862 3S1QI 4A3GI 5T64A 5C4JI 3I56Z 1Q811 2EGTA 1YIT1 2YADA 2OZKA 3S1NI 2RT9A 4RVDA 2V8IA 1YI21 3IR7A 3OW2Z 3VMIA 2HF1A 3NH8A 3CC41 3I4NI 1VQ7Z 2JA7I 1L1OC 2QR1B 1TWGI 1RQFA 1KC82 3S14I 3I561 2DE6A 3NH5A 4NH1C 4XX2A 3TE5B 2G2KA 3JAMf 1VQL1 3CMA1 2M6NA 3MZKB 1VQNZ 1RO2A 1VQPZ 1X3WA 4QTTA 2IZ3A 2VPYA 4NBBA 3D2LA 1TWFI 2GU2A 1VQ8Z 2V8KA 3S15I 2NAPA 3PO2I 4MONA 3HKZA 3JAMb 5D1PA 1NUIA 3GCFA 3VMGA 3NDIA 2LIYA 1VQN1 1NP6A 1VQP1 4NBCA 2JIQA 2KPIA 4RV9A 4E2WA 4MD7A 2JIMA 4S1TA 3CCSZ 1VQ81 3CCVZ 2E2II 1I50I 1YJNZ 2GTIA 5IP7I 3BG0B 3GTMS 5D1OA 1SIWA 2IZ4A 2OTL1 1YJ9Z 1KQSY 1VQ4Z 2JA8I 2JIOA 3J80f 1YUKA 2K3RA 3CCS1 1S72Z 2RHBA 2JNYA 4AYBA 3CCV1 3HOXI 1VLAA 2VPWA 1YJN1 3CCJ1 2AKLA 4BY1I 1QVFZ 4A93I 1YJ91 1QF8A 1VQ41 3VTNA 3F3FC 4NB9A 1P9NA 3MONA 3J80b 1N8R2 1K732 1N2FA 1VQMZ 2V45A 3I55Z 1Q861 1AA6A 4NBAA 1VQOZ 3VMHA 2GTHA 1K83I 5IT9f 4TNUA 1JJ2Z 3S1MI 1Z03A 3HOZI 4QTUA 3K7AI 4A3EI 4E31A 1Q822 2PMZA 3EEDA 4NBHA 2QRCB 1VQM1 2JMOA 3I551 1JWHC 1W2BY 1ZB9A 1KC81 1Q7Y2 3FKII 1YJWZ 3H0GI 2I3CA 1K9M2 5IT9b 4NBGA 1M902 2VPZA 1YIJZ 1WIIA 3Q87A 5T67A 3IF8A 1Q16A 2JA5I 3CPWY 1Q812 4CL1A 1KD12 4HGZA 3HOVI 1RNIA 3GTQI 1WZNA 3CCRZ 3M4OI 2Q4ZA 2LEXA 3GTKI 3ESWA 2YU9I 3HOUI 1ZH1A 2Y0SA 3EERA 1RLYA 1VQ71 4DGLA 3TDHB 1YJW1 4NBEA 4BBSI 2E2HI 2B63I 5CM2M 2R92I 1LQLA 1YIJ1 2W04A 4A3DI 2QLVB 3BG1B 3P5JB 2KI7B 3RZOI 1ML8A 3S16I 5IP9I 3CCR1 1S7MA 3S2HI 3LUSA 3CCQZ 2JR6A 4A3II 1M1K2 3D9XA 2F4OA 3NH4A 2JIRA 2P3YA 3GTPI 2O53A 1SFOI 3GTGI 2VUGA 2ZAEB 5C44I 3CXCY 3GTOI 2VUMI 3FQQA 2J6AA 3CCQ1 5FLXf 4X6AI 4E2YA 4A3JI 3F3PC 5LL6f 4NBDA 2K5RA 2Q51A 4Y52I 3T4NB 3J81f 2QEXZ 3CCMZ 1KQSZ 4A3KI 4BXXI 1DL6A 2VF1A 3MZLB 3VB9A 2VPXA 4NB8A 3CCLZ 3KIFA 5FLXb 3G71Z 1N8R1 4A3BI 1K731 3IFUA 3PO3S 3CMEZ 4NBFA 4E2ZA 1Y1VS 1QVGY 1WCMI 1K8A1 3GTJI 1S721 3J81b 3KIHA 3CQZI 4NFRA 2QEX1 5D1OB 3CCM1 1VQKZ 1TWCI 2OOYB 3CCEZ 1I6HI 3GTMI 1Z02A 4E30A 1NJI2 1FDIA 4HH4A 1Q821 1YITZ 3CCL1 3G711 1X0TA 1VQ6Z 3FQMA 1QXFA 3CME1 1R9TI 2F4MA 3GKQA 1Q7Y1 4HGYA 2R7ZI 3H3VJ 1KRLA 3S1RI 1K9M1 5C4XI 1Z01A 1M901 5C3EI 2OOXB 5A2Qf 1VQK1 2R93I 1VQO1 3CCE1 3OW2Y 1RO0A 2WAQA 1KD11 2HU9A 2JIPA 2RPRA 3PO3I 1PFTA 1VQLZ 2JA6I 3CMAZ 1W2BZ 3M3YI 1VQ61 2RIQA 2NVXI 1I3QI 1Y1VI 2O4HA 2DE7A 4MH4A 1TFIA 2PM9A 3NDJA 2E9HA 5A2Qb 3CPWZ 4Y7NI 2NVTI 2LFUA 1TWAI 2W03A 2DE5A 5AN9F 2QREB 1ZB8A 4BBRI 2QA4Z 4A3LI 4MD8A
chains in the Genus database with same CATH topology
1YUAA 1YHQZ 3CCUZ 1RO4A 2M48A 3D6WA 1M1K1 4E2XA 2QKDA 3CC2Z 4MXUA 1USPA 2WB1A 4RVFA 2E2JI 4DK1A 4RS4A 2QA41 3S17I 5T6BA 4NOZA 3RZDI 2JUBA 1YHQ1 3CCU1 2OTLZ 4EWCA 4E33A 5FLMI 3U50C 2BJOA 3CC21 3J7A4 3HOWI 2R6MA 2OTJZ 3G4SZ 3CXCZ 3CC7Z 3I07A 3I4MI 4A3FI 3CCJZ 4MD9A 3NFZA 3CD6Z 3QWUA 1X3ZA 1USPB 3IX0A 4E32A 2V8JA 2JS4A 4MRIA 2H85A 4RVHA 1Y1WI 1VQ5Z 2RBLA 2P28A 3HOYI 3S2DI 1QVFY 2OTJ1 2PK7A 3G6EZ 3G4S1 1QYPA 3CC71 1VQ9Z 1WW9A 1NJI1 1TWHI 2NVYI 4BY7I 3CD61 2QRDB 1QVGZ 3GTLI 4DQYB 4A3MI 2NVQI 1VQ51 1JJ2Y 4A3CI 4RVGA 1YI2Z 3G6E1 3CC4Z 1VQ91 1K8A2 1Q862 3S1QI 4A3GI 5T64A 5C4JI 3I56Z 1Q811 2EGTA 1YIT1 2YADA 2OZKA 3S1NI 2RT9A 4RVDA 2V8IA 1YI21 3OW2Z 3VMIA 2HF1A 3NH8A 3CC41 3I4NI 1VQ7Z 2JA7I 1L1OC 2QR1B 1TWGI 1RQFA 1KC82 3S14I 3I561 2DE6A 3NH5A 4NH1C 4XX2A 3TE5B 2G2KA 3JAMf 1VQL1 3CMA1 2M6NA 3MZKB 1VQNZ 1RO2A 1VQPZ 1X3WA 4QTTA 2IZ3A 4NBBA 1TWFI 2GU2A 1VQ8Z 2V8KA 3S15I 3PO2I 4MONA 3HKZA 3JAMb 5D1PA 1NUIA 3GCFA 3VMGA 3NDIA 2LIYA 1VQN1 1NP6A 1VQP1 4NBCA 2KPIA 4RV9A 4E2WA 4MD7A 4S1TA 3CCSZ 1VQ81 3CCVZ 2E2II 1I50I 1YJNZ 2GTIA 5IP7I 3BG0B 3GTMS 5D1OA 2OTL1 2IZ4A 1YJ9Z 1KQSY 1VQ4Z 2JA8I 3J80f 2K3RA 1YUKA 3CCS1 1S72Z 2RHBA 2JNYA 4AYBA 3CCV1 3HOXI 1VLAA 1YJN1 3CCJ1 2AKLA 4BY1I 1QVFZ 4A93I 1YJ91 1QF8A 1VQ41 3VTNA 3F3FC 4NB9A 1P9NA 3MONA 3J80b 1N8R2 1K732 1N2FA 1VQMZ 3I55Z 1Q861 4NBAA 1VQOZ 3VMHA 2GTHA 1K83I 5IT9f 4TNUA 1JJ2Z 3S1MI 1Z03A 3HOZI 4QTUA 3K7AI 4A3EI 4E31A 1Q822 2PMZA 3EEDA 4NBHA 2QRCB 1VQM1 2JMOA 3I551 1JWHC 1W2BY 1ZB9A 1KC81 1Q7Y2 3FKII 1YJWZ 3H0GI 2I3CA 1K9M2 5IT9b 4NBGA 1M902 1YIJZ 1WIIA 3Q87A 5T67A 3IF8A 2JA5I 3CPWY 1Q812 4CL1A 1KD12 4HGZA 3HOVI 1RNIA 3GTQI 3CCRZ 3M4OI 2Q4ZA 3GTKI 3ESWA 2YU9I 3HOUI 1ZH1A 2Y0SA 3EERA 1RLYA 1VQ71 4DGLA 3TDHB 1YJW1 4NBEA 4BBSI 2E2HI 2B63I 5CM2M 2R92I 1LQLA 1YIJ1 2W04A 4A3DI 2QLVB 3BG1B 3P5JB 2KI7B 3RZOI 1ML8A 3S16I 5IP9I 3CCR1 1S7MA 3S2HI 3LUSA 3CCQZ 2JR6A 4A3II 1M1K2 3D9XA 2F4OA 3NH4A 2P3YA 3GTPI 2O53A 1SFOI 3GTGI 2VUGA 2ZAEB 5C44I 3CXCY 3GTOI 2VUMI 3FQQA 2J6AA 3CCQ1 5FLXf 4X6AI 4E2YA 4A3JI 3F3PC 5LL6f 4NBDA 2K5RA 2Q51A 4Y52I 3T4NB 3J81f 2QEXZ 3CCMZ 1KQSZ 4A3KI 4BXXI 1DL6A 2VF1A 3MZLB 3VB9A 4NB8A 3CCLZ 3KIFA 5FLXb 3G71Z 1N8R1 4A3BI 1K731 3IFUA 3PO3S 3CMEZ 4NBFA 4E2ZA 1Y1VS 1QVGY 1WCMI 1K8A1 3GTJI 1S721 3J81b 3KIHA 3CQZI 4NFRA 2QEX1 5D1OB 3CCM1 1VQKZ 1TWCI 2OOYB 3CCEZ 1I6HI 3GTMI 1Z02A 4E30A 1NJI2 4HH4A 1Q821 1YITZ 3CCL1 3G711 1X0TA 1VQ6Z 3FQMA 3CME1 1R9TI 2F4MA 3GKQA 1Q7Y1 4HGYA 2R7ZI 3H3VJ 1KRLA 3S1RI 1K9M1 5C4XI 1Z01A 1M901 5C3EI 2OOXB 5A2Qf 1VQK1 2R93I 1VQO1 3CCE1 3OW2Y 1RO0A 2WAQA 1KD11 2HU9A 2RPRA 3PO3I 1PFTA 1VQLZ 2JA6I 3CMAZ 1W2BZ 3M3YI 1VQ61 2RIQA 2NVXI 1I3QI 1Y1VI 2O4HA 2DE7A 4MH4A 1TFIA 2PM9A 3NDJA 2E9HA 5A2Qb 3CPWZ 4Y7NI 2NVTI 2LFUA 1TWAI 2W03A 2DE5A 5AN9F 2QREB 1ZB8A 4BBRI 2QA4Z 4A3LI 4MD8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YUA A;  2AKL A;  4BY1 I;  4A93 I;  5C44 I;  1RO4 A;  3GTO I;  2VUM I;  2J6A A;  3D6W A;  3S1N I;  4NB9 A;  4X6A I;  4A3J I;  3VMI A;  1N2F A;  4NBD A;  2K5R A;  2HF1 A;  1USP A;  3I4N I;  4Y52 I;  2E2J I;  2JA7 I;  1L1O C;  4NBA A;  1TWG I;  3VMH A;  3S14 I;  3S17 I;  4A3K I;  4BXX I;  4NOZ A;  2DE6 A;  1K83 I;  3RZD I;  1DL6 A;  3S1M I;  4XX2 A;  3VB9 A;  5FLM I;  4NB8 A;  3HOZ I;  4QTU A;  4A3B I;  3K7A I;  4A3E I;  1X3W A;  3PO3 S;  4QTT A;  4NBH A;  3U50 C;  2BJO A;  4NBF A;  1Y1V S;  3HOW I;  4NBB A;  1WCM I;  1TWF I;  3GTJ I;  1ZB9 A;  3S15 I;  3CQZ I;  3FKI I;  3I07 A;  3H0G I;  1TWC I;  3I4M I;  4A3F I;  4NBG A;  3PO2 I;  1I6H I;  3GTM I;  3Q87 A;  2JA5 I;  1NUI A;  3GCF A;  3VMG A;  1X3Z A;  1USP B;  4NBC A;  3HOV I;  2JS4 A;  2KPI A;  1R9T I;  1Y1W I;  3GTQ I;  3M4O I;  2RBL A;  2F4M A;  3GTK I;  3ESW A;  3GKQ A;  2YU9 I;  3HOY I;  2R7Z I;  3H3V J;  3HOU I;  3S2D I;  3S1R I;  2PK7 A;  5C4X I;  3EER A;  1QYP A;  5C3E I;  1RLY A;  1WW9 A;  4NBE A;  4BBS I;  2E2H I;  2R93 I;  1TWH I;  2B63 I;  2NVY I;  5CM2 M;  2E2I I;  1LQL A;  2R92 I;  1I50 I;  4BY7 I;  4A3D I;  5IP7 I;  3PO3 I;  3GTM S;  1PFT A;  2JA6 I;  3GTL I;  3M3Y I;  2NVX I;  1I3Q I;  3RZO I;  4A3M I;  1ML8 A;  1Y1V I;  2NVQ I;  3S16 I;  5IP9 I;  2DE7 A;  2JA8 I;  4MH4 A;  3S2H I;  1TFI A;  3LUS A;  2JR6 A;  4A3C I;  4A3I I;  2F4O A;  4Y7N I;  2NVT I;  1TWA I;  2DE5 A;  2JNY A;  2P3Y A;  1ZB8 A;  3HOX I;  3GTP I;  3S1Q I;  4A3G I;  4BBR I;  1VLA A;  4A3L I;  1SFO I;  5C4J I;  3GTG I; 
#chains in the Genus database with same CATH topology
 1YUA A;  1YHQ Z;  3CCU Z;  1RO4 A;  2M48 A;  3D6W A;  1M1K 1;  4E2X A;  2AYD A;  2QKD A;  3CC2 Z;  4MXU A;  1USP A;  2V3V A;  2WB1 A;  4RVF A;  2E2J I;  4DK1 A;  4RS4 A;  2E7Z A;  2QA4 1;  3S17 I;  5T6B A;  4NOZ A;  3RZD I;  2JUB A;  1YHQ 1;  3CCU 1;  2OTL Z;  4EWC A;  4E33 A;  5FLM I;  3U50 C;  2BJO A;  3CC2 1;  3J7A 4;  3HOW I;  2R6M A;  2OTJ Z;  3G4S Z;  3CXC Z;  3CC7 Z;  3I07 A;  3I4M I;  4A3F I;  1FDO A;  3CCJ Z;  4MD9 A;  3NFZ A;  3CD6 Z;  3QWU A;  1X3Z A;  1USP B;  3IX0 A;  4E32 A;  2V8J A;  2JS4 A;  4MRI A;  2H85 A;  4RVH A;  1Y1W I;  1VQ5 Z;  2RBL A;  2P28 A;  3HOY I;  3S2D I;  1WJ2 A;  1QVF Y;  2OTJ 1;  2PK7 A;  3G6E Z;  3G4S 1;  1QYP A;  3CC7 1;  1VQ9 Z;  1WW9 A;  1NJI 1;  1TWH I;  2NVY I;  2IV2 X;  4BY7 I;  3CD6 1;  2QRD B;  1QVG Z;  3GTL I;  4DQY B;  4A3M I;  2NVQ I;  1VQ5 1;  1Y8C A;  1JJ2 Y;  4A3C I;  4RVG A;  1YI2 Z;  3G6E 1;  3CC4 Z;  1VQ9 1;  1K8A 2;  1Q86 2;  3S1Q I;  4A3G I;  5T64 A;  5C4J I;  3I56 Z;  1Q81 1;  2EGT A;  1YIT 1;  2YAD A;  2OZK A;  3S1N I;  2RT9 A;  4RVD A;  2V8I A;  1YI2 1;  3IR7 A;  3OW2 Z;  3VMI A;  2HF1 A;  3NH8 A;  3CC4 1;  3I4N I;  1VQ7 Z;  2JA7 I;  1L1O C;  2QR1 B;  1TWG I;  1RQF A;  1KC8 2;  3S14 I;  3I56 1;  2DE6 A;  3NH5 A;  4NH1 C;  4XX2 A;  3TE5 B;  2G2K A;  3JAM f;  1VQL 1;  3CMA 1;  2M6N A;  3MZK B;  1VQN Z;  1RO2 A;  1VQP Z;  1X3W A;  4QTT A;  2IZ3 A;  2VPY A;  4NBB A;  3D2L A;  1TWF I;  2GU2 A;  1VQ8 Z;  2V8K A;  3S15 I;  2NAP A;  3PO2 I;  4MON A;  3HKZ A;  3JAM b;  5D1P A;  1NUI A;  3GCF A;  3VMG A;  3NDI A;  2LIY A;  1VQN 1;  1NP6 A;  1VQP 1;  4NBC A;  2JIQ A;  2KPI A;  4RV9 A;  4E2W A;  4MD7 A;  2JIM A;  4S1T A;  3CCS Z;  1VQ8 1;  3CCV Z;  2E2I I;  1I50 I;  1YJN Z;  2GTI A;  5IP7 I;  3BG0 B;  3GTM S;  5D1O A;  1SIW A;  2IZ4 A;  2OTL 1;  1YJ9 Z;  1KQS Y;  1VQ4 Z;  2JA8 I;  2JIO A;  3J80 f;  1YUK A;  2K3R A;  3CCS 1;  1S72 Z;  2RHB A;  2JNY A;  4AYB A;  3CCV 1;  3HOX I;  1VLA A;  2VPW A;  1YJN 1;  3CCJ 1;  2AKL A;  4BY1 I;  1QVF Z;  4A93 I;  1YJ9 1;  1QF8 A;  1VQ4 1;  3VTN A;  3F3F C;  4NB9 A;  1P9N A;  3MON A;  3J80 b;  1N8R 2;  1K73 2;  1N2F A;  1VQM Z;  2V45 A;  3I55 Z;  1Q86 1;  1AA6 A;  4NBA A;  1VQO Z;  3VMH A;  2GTH A;  1K83 I;  5IT9 f;  4TNU A;  1JJ2 Z;  3S1M I;  1Z03 A;  3HOZ I;  4QTU A;  3K7A I;  4A3E I;  4E31 A;  1Q82 2;  2PMZ A;  3EED A;  4NBH A;  2QRC B;  1VQM 1;  2JMO A;  3I55 1;  1JWH C;  1W2B Y;  1ZB9 A;  1KC8 1;  1Q7Y 2;  3FKI I;  1YJW Z;  3H0G I;  2I3C A;  1K9M 2;  5IT9 b;  4NBG A;  1M90 2;  2VPZ A;  1YIJ Z;  1WII A;  3Q87 A;  5T67 A;  3IF8 A;  1Q16 A;  2JA5 I;  3CPW Y;  1Q81 2;  4CL1 A;  1KD1 2;  4HGZ A;  3HOV I;  1RNI A;  3GTQ I;  1WZN A;  3CCR Z;  3M4O I;  2Q4Z A;  2LEX A;  3GTK I;  3ESW A;  2YU9 I;  3HOU I;  1ZH1 A;  2Y0S A;  3EER A;  1RLY A;  1VQ7 1;  4DGL A;  3TDH B;  1YJW 1;  4NBE A;  4BBS I;  2E2H I;  2B63 I;  5CM2 M;  2R92 I;  1LQL A;  1YIJ 1;  2W04 A;  4A3D I;  2QLV B;  3BG1 B;  3P5J B;  2KI7 B;  3RZO I;  1ML8 A;  3S16 I;  5IP9 I;  3CCR 1;  1S7M A;  3S2H I;  3LUS A;  3CCQ Z;  2JR6 A;  4A3I I;  1M1K 2;  3D9X A;  2F4O A;  3NH4 A;  2JIR A;  2P3Y A;  3GTP I;  2O53 A;  1SFO I;  3GTG I;  2VUG A;  2ZAE B;  5C44 I;  3CXC Y;  3GTO I;  2VUM I;  3FQQ A;  2J6A A;  3CCQ 1;  5FLX f;  4X6A I;  4E2Y A;  4A3J I;  3F3P C;  5LL6 f;  4NBD A;  2K5R A;  2Q51 A;  4Y52 I;  3T4N B;  3J81 f;  2QEX Z;  3CCM Z;  1KQS Z;  4A3K I;  4BXX I;  1DL6 A;  2VF1 A;  3MZL B;  3VB9 A;  2VPX A;  4NB8 A;  3CCL Z;  3KIF A;  5FLX b;  3G71 Z;  1N8R 1;  4A3B I;  1K73 1;  3IFU A;  3PO3 S;  3CME Z;  4NBF A;  4E2Z A;  1Y1V S;  1QVG Y;  1WCM I;  1K8A 1;  3GTJ I;  1S72 1;  3J81 b;  3KIH A;  3CQZ I;  4NFR A;  2QEX 1;  5D1O B;  3CCM 1;  1VQK Z;  1TWC I;  2OOY B;  3CCE Z;  1I6H I;  3GTM I;  1Z02 A;  4E30 A;  1NJI 2;  1FDI A;  4HH4 A;  1Q82 1;  1YIT Z;  3CCL 1;  3G71 1;  1X0T A;  1VQ6 Z;  3FQM A;  1QXF A;  3CME 1;  1R9T I;  2F4M A;  3GKQ A;  1Q7Y 1;  4HGY A;  2R7Z I;  3H3V J;  1KRL A;  3S1R I;  1K9M 1;  5C4X I;  1Z01 A;  1M90 1;  5C3E I;  2OOX B;  5A2Q f;  1VQK 1;  2R93 I;  1VQO 1;  3CCE 1;  3OW2 Y;  1RO0 A;  2WAQ A;  1KD1 1;  2HU9 A;  2JIP A;  2RPR A;  3PO3 I;  1PFT A;  1VQL Z;  2JA6 I;  3CMA Z;  1W2B Z;  3M3Y I;  1VQ6 1;  2RIQ A;  2NVX I;  1I3Q I;  1Y1V I;  2O4H A;  2DE7 A;  4MH4 A;  1TFI A;  2PM9 A;  3NDJ A;  2E9H A;  5A2Q b;  3CPW Z;  4Y7N I;  2NVT I;  2LFU A;  1TWA I;  2W03 A;  2DE5 A;  5AN9 F;  2QRE B;  1ZB8 A;  4BBR I;  2QA4 Z;  4A3L I;  4MD8 A; 
#chains in the Genus database with same CATH homology
 1YUA A;  1YHQ Z;  3CCU Z;  1RO4 A;  2M48 A;  3D6W A;  1M1K 1;  4E2X A;  2QKD A;  3CC2 Z;  4MXU A;  1USP A;  2WB1 A;  4RVF A;  2E2J I;  4DK1 A;  4RS4 A;  2QA4 1;  3S17 I;  5T6B A;  4NOZ A;  3RZD I;  2JUB A;  1YHQ 1;  3CCU 1;  2OTL Z;  4EWC A;  4E33 A;  5FLM I;  3U50 C;  2BJO A;  3CC2 1;  3J7A 4;  3HOW I;  2R6M A;  2OTJ Z;  3G4S Z;  3CXC Z;  3CC7 Z;  3I07 A;  3I4M I;  4A3F I;  3CCJ Z;  4MD9 A;  3NFZ A;  3CD6 Z;  3QWU A;  1X3Z A;  1USP B;  3IX0 A;  4E32 A;  2V8J A;  2JS4 A;  4MRI A;  2H85 A;  4RVH A;  1Y1W I;  1VQ5 Z;  2RBL A;  2P28 A;  3HOY I;  3S2D I;  1QVF Y;  2OTJ 1;  2PK7 A;  3G6E Z;  3G4S 1;  1QYP A;  3CC7 1;  1VQ9 Z;  1WW9 A;  1NJI 1;  1TWH I;  2NVY I;  4BY7 I;  3CD6 1;  2QRD B;  1QVG Z;  3GTL I;  4DQY B;  4A3M I;  2NVQ I;  1VQ5 1;  1JJ2 Y;  4A3C I;  4RVG A;  1YI2 Z;  3G6E 1;  3CC4 Z;  1VQ9 1;  1K8A 2;  1Q86 2;  3S1Q I;  4A3G I;  5T64 A;  5C4J I;  3I56 Z;  1Q81 1;  2EGT A;  1YIT 1;  2YAD A;  2OZK A;  3S1N I;  2RT9 A;  4RVD A;  2V8I A;  1YI2 1;  3OW2 Z;  3VMI A;  2HF1 A;  3NH8 A;  3CC4 1;  3I4N I;  1VQ7 Z;  2JA7 I;  1L1O C;  2QR1 B;  1TWG I;  1RQF A;  1KC8 2;  3S14 I;  3I56 1;  2DE6 A;  3NH5 A;  4NH1 C;  4XX2 A;  3TE5 B;  2G2K A;  3JAM f;  1VQL 1;  3CMA 1;  2M6N A;  3MZK B;  1VQN Z;  1RO2 A;  1VQP Z;  1X3W A;  4QTT A;  2IZ3 A;  4NBB A;  1TWF I;  2GU2 A;  1VQ8 Z;  2V8K A;  3S15 I;  3PO2 I;  4MON A;  3HKZ A;  3JAM b;  5D1P A;  1NUI A;  3GCF A;  3VMG A;  3NDI A;  2LIY A;  1VQN 1;  1NP6 A;  1VQP 1;  4NBC A;  2KPI A;  4RV9 A;  4E2W A;  4MD7 A;  4S1T A;  3CCS Z;  1VQ8 1;  3CCV Z;  2E2I I;  1I50 I;  1YJN Z;  2GTI A;  5IP7 I;  3BG0 B;  3GTM S;  5D1O A;  2OTL 1;  2IZ4 A;  1YJ9 Z;  1KQS Y;  1VQ4 Z;  2JA8 I;  3J80 f;  2K3R A;  1YUK A;  3CCS 1;  1S72 Z;  2RHB A;  2JNY A;  4AYB A;  3CCV 1;  3HOX I;  1VLA A;  1YJN 1;  3CCJ 1;  2AKL A;  4BY1 I;  1QVF Z;  4A93 I;  1YJ9 1;  1QF8 A;  1VQ4 1;  3VTN A;  3F3F C;  4NB9 A;  1P9N A;  3MON A;  3J80 b;  1N8R 2;  1K73 2;  1N2F A;  1VQM Z;  3I55 Z;  1Q86 1;  4NBA A;  1VQO Z;  3VMH A;  2GTH A;  1K83 I;  5IT9 f;  4TNU A;  1JJ2 Z;  3S1M I;  1Z03 A;  3HOZ I;  4QTU A;  3K7A I;  4A3E I;  4E31 A;  1Q82 2;  2PMZ A;  3EED A;  4NBH A;  2QRC B;  1VQM 1;  2JMO A;  3I55 1;  1JWH C;  1W2B Y;  1ZB9 A;  1KC8 1;  1Q7Y 2;  3FKI I;  1YJW Z;  3H0G I;  2I3C A;  1K9M 2;  5IT9 b;  4NBG A;  1M90 2;  1YIJ Z;  1WII A;  3Q87 A;  5T67 A;  3IF8 A;  2JA5 I;  3CPW Y;  1Q81 2;  4CL1 A;  1KD1 2;  4HGZ A;  3HOV I;  1RNI A;  3GTQ I;  3CCR Z;  3M4O I;  2Q4Z A;  3GTK I;  3ESW A;  2YU9 I;  3HOU I;  1ZH1 A;  2Y0S A;  3EER A;  1RLY A;  1VQ7 1;  4DGL A;  3TDH B;  1YJW 1;  4NBE A;  4BBS I;  2E2H I;  2B63 I;  5CM2 M;  2R92 I;  1LQL A;  1YIJ 1;  2W04 A;  4A3D I;  2QLV B;  3BG1 B;  3P5J B;  2KI7 B;  3RZO I;  1ML8 A;  3S16 I;  5IP9 I;  3CCR 1;  1S7M A;  3S2H I;  3LUS A;  3CCQ Z;  2JR6 A;  4A3I I;  1M1K 2;  3D9X A;  2F4O A;  3NH4 A;  2P3Y A;  3GTP I;  2O53 A;  1SFO I;  3GTG I;  2VUG A;  2ZAE B;  5C44 I;  3CXC Y;  3GTO I;  2VUM I;  3FQQ A;  2J6A A;  3CCQ 1;  5FLX f;  4X6A I;  4E2Y A;  4A3J I;  3F3P C;  5LL6 f;  4NBD A;  2K5R A;  2Q51 A;  4Y52 I;  3T4N B;  3J81 f;  2QEX Z;  3CCM Z;  1KQS Z;  4A3K I;  4BXX I;  1DL6 A;  2VF1 A;  3MZL B;  3VB9 A;  4NB8 A;  3CCL Z;  3KIF A;  5FLX b;  3G71 Z;  1N8R 1;  4A3B I;  1K73 1;  3IFU A;  3PO3 S;  3CME Z;  4NBF A;  4E2Z A;  1Y1V S;  1QVG Y;  1WCM I;  1K8A 1;  3GTJ I;  1S72 1;  3J81 b;  3KIH A;  3CQZ I;  4NFR A;  2QEX 1;  5D1O B;  3CCM 1;  1VQK Z;  1TWC I;  2OOY B;  3CCE Z;  1I6H I;  3GTM I;  1Z02 A;  4E30 A;  1NJI 2;  4HH4 A;  1Q82 1;  1YIT Z;  3CCL 1;  3G71 1;  1X0T A;  1VQ6 Z;  3FQM A;  3CME 1;  1R9T I;  2F4M A;  3GKQ A;  1Q7Y 1;  4HGY A;  2R7Z I;  3H3V J;  1KRL A;  3S1R I;  1K9M 1;  5C4X I;  1Z01 A;  1M90 1;  5C3E I;  2OOX B;  5A2Q f;  1VQK 1;  2R93 I;  1VQO 1;  3CCE 1;  3OW2 Y;  1RO0 A;  2WAQ A;  1KD1 1;  2HU9 A;  2RPR A;  3PO3 I;  1PFT A;  1VQL Z;  2JA6 I;  3CMA Z;  1W2B Z;  3M3Y I;  1VQ6 1;  2RIQ A;  2NVX I;  1I3Q I;  1Y1V I;  2O4H A;  2DE7 A;  4MH4 A;  1TFI A;  2PM9 A;  3NDJ A;  2E9H A;  5A2Q b;  3CPW Z;  4Y7N I;  2NVT I;  2LFU A;  1TWA I;  2W03 A;  2DE5 A;  5AN9 F;  2QRE B;  1ZB8 A;  4BBR I;  2QA4 Z;  4A3L I;  4MD8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...