2JA6I

Cpd lesion containing rna polymerase ii elongation complex b
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
116
structure length
116
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title CPD damage recognition by transcribing RNA polymerase II.
pubmed doi rcsb
molecule tags Transferase
total genus 8
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2ja6I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2ja6I02
3S1QI 2JS4A 4XX2A 3RZDI 4MH4A 5C4JI 3GTKI 1ZB8A 2HF1A 3S1RI 1R9TI 4A93I 1Y1WI 3VMIA 1WW9A 3FKII 3RZOI 2JR6A 3S16I 3S2HI 3I4MI 1QYPA 3Q87A 4QTTA 1Y1VI 2R7ZI 4BBRI 3GTLI 1DL6A 4NB8A 3M3YI 2AKLA 5C4XI 4A3BI 3VMGA 3GTJI 4NBAA 1SFOI 2JA8I 3CQZI 3HOVI 3GCFA 5C44I 2R93I 4A3JI 3S14I 3D6WA 2DE5A 2JA7I 2F4OA 1ML8A 2NVTI 3HOZI 3K7AI 3U50C 1PFTA 1RO4A 1X3WA 4NOZA 1VLAA 4A3KI 2NVYI 3ESWA 3S17I 4A3MI 4A3CI 1I50I 3H0GI 3GKQA 4NB9A 1Y1VS 2B63I 5IP9I 3GTPI 1NUIA 1USPA 2E2II 1K83I 2F4MA 4NBHA 4NBGA 4NBBA 5FLMI 2R92I 3GTOI 4A3LI 4BBSI 4BXXI 3I4NI 3VB9A 3EERA 3S15I 2JA5I 2NVQI 1TWCI 4NBCA 4NBEA 3PO3I 2E2HI 2YU9I 1I6HI 4Y52I 3VMHA 2J6AA 1X3ZA 3HOWI 3GTQI 1RLYA 4BY7I 1I3QI 3I07A 4A3FI 1YUAA 2K5RA 3H3VJ 4X6AI 1L1OC 2KPIA 1USPB 2NVXI 3GTMI 3HOYI 3PO2I 3S2DI 2BJOA 3LUSA 3S1MI 3HOXI 4QTUA 1WCMI 4A3II 2VUMI 4A3EI 5CM2M 3GTMS 1TWGI 4Y7NI 4A3DI 1N2FA 4NBDA 2PK7A 2DE6A 5C3EI 3GTGI 4BY1I 2DE7A 3HOUI 3S1NI 1TWAI 1TFIA 5IP7I 2JNYA 1TWHI 2RBLA 3M4OI 1TWFI 2JA6I 1ZB9A 1LQLA 3PO3S 4NBFA 4A3GI 2P3YA 2E2JI
chains in the Genus database with same CATH superfamily
3CCMZ 3CCVZ 2JS4A 4XX2A 2IV2X 3GTKI 1ZB8A 2HF1A 3CMAZ 2R6MA 5IT9b 1WW9A 4HGYA 2E9HA 2JR6A 3CCQ1 3S16I 2V45A 3I4MI 1QYPA 2QRCB 3T4NB 4BBRI 1K9M2 3KIHA 3GTLI 4MXUA 5AN9F 1DL6A 1VQN1 2VF1A 4NB8A 3M3YI 5C4XI 4A3BI 3VMGA 1JJ2Y 5T64A 4MD9A 3FQQA 2DE5A 5D1OA 1YHQZ 1YJN1 1PFTA 1RO4A 3U50C 1Q7Y2 4MD8A 1S7MA 4NH1C 3CXCZ 1K8A2 2AYDA 2EGTA 1VQ6Z 2NVYI 3ESWA 2VPXA 2W03A 3CCRZ 3FQMA 4A3MI 3G6EZ 1I50I 3CCS1 4NB9A 4EWCA 2JIOA 3GTPI 2OTJZ 3TE5B 3KIFA 4A3LI 3GTOI 4BBSI 3NDIA 3D9XA 3I4NI 4MONA 3S15I 2E7ZA 2QA4Z 4NBCA 1YITZ 1VQP1 3G4S1 3CC7Z 2H85A 3J7A4 2JUBA 1VQ91 1FDOA 4E2YA 1I3QI 3I07A 2NAPA 1L1OC 1USPB 1RNIA 2O4HA 1NJI2 3CC21 4QTUA 2VUGA 5D1OB 1VQ8Z 4RVHA 3GTMS 1TWGI 2VPYA 5IT9f 2QREB 2V8KA 2PK7A 3F3PC 2LEXA 3OW2Y 4MRIA 2Y0SA 2RBLA 3CME1 1Q822 2JA6I 1Y8CA 2JMOA 4DGLA 4A3GI 2P3YA 3S1QI 3NH4A 4NFRA 1YJNZ 1VQ41 1KQSY 2OTLZ 1VQL1 4MH4A 2OOYB 4HGZA 1YIJZ 2Q4ZA 3RZOI 1M1K1 4S1TA 4E31A 2VPZA 4E2WA 3F3FC 2KI7B 1YI2Z 1QVFY 2AKLA 2RHBA 1VQKZ 1KC81 3CQZI 4E2ZA 3GCFA 1YJ91 2V3VA 2IZ3A 2R93I 3CCJZ 4DQYB 1ML8A 2HU9A 1M902 3CCUZ 1Q862 2WAQA 3G71Z 1VLAA 1N8R2 1VQ7Z 2JIRA 1Y1VS 1QVGZ 2B63I 1USPA 1K732 1VQ5Z 2R92I 3VB9A 2RT9A 2QR1B 2JA5I 2LIYA 1VQOZ 2V8JA 3MZKB 1X3ZA 3HOWI 3CD61 2M6NA 2LFUA 3NH5A 3I551 1RLYA 1VQM1 4A3FI 1Z01A 2K5RA 1KC82 2KPIA 3CC41 2OZKA 3CCEZ 1VQLZ 1S72Z 3S1MI 2GU2A 3BG0B 1YUKA 4A3II 4A3EI 5CM2M 2P28A 3MZLB 2QEXZ 4Y7NI 1NP6A 2YADA 4NBDA 5C3EI 3GTGI 4RVDA 3S1NI 1YJWZ 1TFIA 2V8IA 3BG1B 2JIMA 4E33A 4RVFA 5T6BA 1Q811 3CXCY 1LQLA 3PO3S 3I561 3CCL1 1ZH1A 1W2BZ 3CCM1 3CCV1 4RS4A 1KD11 2IZ4A 3CCQZ 3S1RI 1R9TI 3CPWZ 4A93I 1FDIA 1Y1WI 3VMIA 2O53A 3S2HI 3CMA1 2QKDA 1VQNZ 3Q87A 4QTTA 1SIWA 2R7ZI 1Z02A 1RO2A 2GTHA 3D2LA 1WJ2A 3NDJA 4E32A 2RPRA 3J80b 1WZNA 4NBAA 1SFOI 2JA8I 5C44I 4A3JI 5FLXb 3MONA 2JA7I 2F4OA 2I3CA 3HOZI 3I55Z 1X3WA 1YHQ1 3CCSZ 3VTNA 3S17I 1Q16A 4A3CI 2W04A 1VQ61 3GKQA 1K9M1 4HH4A 3QWUA 3CCR1 3G6E1 2E2II 2F4MA 4NBHA 4NBBA 2OTJ1 1VQPZ 3G4SZ 4CL1A 1VQ9Z 4NBEA 1I6HI 2M48A 4Y52I 1Z03A 1YIT1 1RQFA 3GTQI 3CC71 1Q7Y1 1K8A1 3CC2Z 1JJ2Z 2NVXI 3J81f 2GTIA 3LUSA 1X0TA 1WCMI 3NH8A 2PM9A 4A3DI 1VQ81 3CMEZ 1M1K2 3HOUI 4TNUA 2JNYA 4RVGA 1TWHI 2PMZA 4RV9A 3J80f 2JIPA 1VQ4Z 2E2JI 2OOXB 5FLXf 3RZDI 1NJI1 1QVGY 5C4JI 5T67A 3EEDA 2OTL1 2QRDB 2QLVB 3FKII 1YIJ1 5A2Qf 1WIIA 1QF8A 1Y1VI 2RIQA 1Q821 3IR7A 4E30A 1JWHC 3TDHB 3GTJI 1YJ9Z 1YI21 3JAMb 3J81b 4MD7A 3HOVI 1VQK1 3S14I 3D6WA 1KRLA 3OW2Z 2NVTI 3K7AI 3CCJ1 4NOZA 4E2XA 3CCU1 4A3KI 3G711 2K3RA 5D1PA 2G2KA 3H0GI 1KQSZ 2Q51A 1QXFA 1VQ71 5IP9I 1NUIA 1K83I 1P9NA 4NBGA 5FLMI 4BXXI 3EERA 1VQ51 1W2BY 3IFUA 3NFZA 2NVQI 3CD6Z 1TWCI 1Q812 3CPWY 3PO3I 2E2HI 3IX0A 1VQMZ 2YU9I 3VMHA 2J6AA 1M901 1VQO1 3CC4Z 1QVFZ 5A2Qb 1Q861 4BY7I 1YUAA 3H3VJ 4X6AI 1N8R1 2VPWA 3P5JB 3GTMI 3HOYI 3PO2I 3S2DI 5LL6f 4AYBA 2BJOA 1KD12 3HOXI 3CCE1 1S721 2VUMI 2WB1A 1N2FA 1K731 2DE6A 4BY1I 2DE7A 1TWAI 2QEX1 3HKZA 5IP7I 1RO0A 3M4OI 2QA41 1TWFI 2JIQA 1YJW1 3I56Z 1ZB9A 3IF8A 1AA6A 2ZAEB 4NBFA 3CCLZ 4DK1A 3JAMf
chains in the Genus database with same CATH topology
3CCMZ 3CCVZ 2JS4A 4XX2A 3GTKI 1ZB8A 2HF1A 3CMAZ 2R6MA 5IT9b 1WW9A 4HGYA 2E9HA 2JR6A 3CCQ1 3S16I 3I4MI 1QYPA 2QRCB 3T4NB 4BBRI 1K9M2 3KIHA 3GTLI 4MXUA 5AN9F 1DL6A 1VQN1 2VF1A 4NB8A 3M3YI 5C4XI 4A3BI 3VMGA 1JJ2Y 5T64A 4MD9A 3FQQA 2DE5A 5D1OA 1YHQZ 1YJN1 1PFTA 1RO4A 3U50C 1Q7Y2 4MD8A 1S7MA 4NH1C 3CXCZ 1K8A2 2EGTA 1VQ6Z 2NVYI 3ESWA 2W03A 3CCRZ 3FQMA 4A3MI 3G6EZ 1I50I 3CCS1 4NB9A 4EWCA 2OTJZ 3GTPI 3TE5B 3KIFA 4A3LI 3GTOI 4BBSI 3NDIA 3D9XA 3I4NI 4MONA 3S15I 2QA4Z 4NBCA 1YITZ 1VQP1 3G4S1 3CC7Z 2H85A 3J7A4 2JUBA 1VQ91 4E2YA 1I3QI 3I07A 1L1OC 1USPB 1RNIA 2O4HA 1NJI2 3CC21 4QTUA 2VUGA 5D1OB 1VQ8Z 4RVHA 3GTMS 1TWGI 5IT9f 2QREB 2V8KA 2PK7A 3F3PC 3OW2Y 4MRIA 2Y0SA 2RBLA 3CME1 1Q822 2JA6I 2JMOA 4DGLA 4A3GI 2P3YA 3S1QI 3NH4A 4NFRA 1YJNZ 1VQ41 1KQSY 2OTLZ 1VQL1 4MH4A 2OOYB 4HGZA 1YIJZ 2Q4ZA 3RZOI 1M1K1 4S1TA 4E31A 4E2WA 3F3FC 2KI7B 1YI2Z 1QVFY 2AKLA 2RHBA 1VQKZ 1KC81 3CQZI 4E2ZA 3GCFA 1YJ91 2R93I 2IZ3A 3CCJZ 4DQYB 1ML8A 2HU9A 1M902 3CCUZ 1Q862 2WAQA 3G71Z 1VLAA 1N8R2 1VQ7Z 1Y1VS 1QVGZ 2B63I 1USPA 1K732 1VQ5Z 2R92I 3VB9A 2RT9A 2QR1B 2JA5I 2LIYA 1VQOZ 2V8JA 3MZKB 1X3ZA 3HOWI 3CD61 2M6NA 2LFUA 3NH5A 3I551 1RLYA 1VQM1 4A3FI 1Z01A 2K5RA 1KC82 2KPIA 3CC41 2OZKA 3CCEZ 1VQLZ 1S72Z 3S1MI 2GU2A 3BG0B 1YUKA 4A3II 4A3EI 5CM2M 2P28A 3MZLB 2QEXZ 4Y7NI 1NP6A 2YADA 4NBDA 5C3EI 3GTGI 4RVDA 3S1NI 1YJWZ 1TFIA 2V8IA 3BG1B 4E33A 4RVFA 5T6BA 1Q811 3CXCY 1LQLA 3PO3S 3I561 3CCL1 1ZH1A 1W2BZ 3CCM1 3CCV1 4RS4A 1KD11 2IZ4A 3CCQZ 3S1RI 1R9TI 3CPWZ 4A93I 1Y1WI 3VMIA 2O53A 3S2HI 3CMA1 2QKDA 1VQNZ 3Q87A 4QTTA 2R7ZI 1Z02A 1RO2A 2GTHA 3NDJA 4E32A 2RPRA 3J80b 4NBAA 1SFOI 2JA8I 5C44I 4A3JI 5FLXb 3MONA 2JA7I 2F4OA 2I3CA 3HOZI 3I55Z 1X3WA 1YHQ1 3CCSZ 3VTNA 3S17I 4A3CI 2W04A 1VQ61 3GKQA 1K9M1 4HH4A 3QWUA 3CCR1 3G6E1 2E2II 2F4MA 4NBHA 4NBBA 2OTJ1 1VQPZ 3G4SZ 4CL1A 1VQ9Z 4NBEA 1I6HI 2M48A 4Y52I 1Z03A 1YIT1 1RQFA 3GTQI 3CC71 1Q7Y1 1K8A1 3CC2Z 1JJ2Z 2NVXI 3J81f 2GTIA 3LUSA 1X0TA 1WCMI 3NH8A 2PM9A 4A3DI 1VQ81 3CMEZ 1M1K2 3HOUI 4TNUA 2JNYA 4RVGA 1TWHI 2PMZA 4RV9A 3J80f 1VQ4Z 2E2JI 2OOXB 5FLXf 3RZDI 1NJI1 1QVGY 5C4JI 5T67A 3EEDA 2OTL1 2QRDB 2QLVB 3FKII 1YIJ1 5A2Qf 1WIIA 1QF8A 1Y1VI 2RIQA 1Q821 4E30A 1JWHC 3TDHB 3GTJI 1YJ9Z 1YI21 3JAMb 3J81b 4MD7A 3HOVI 1VQK1 3S14I 3D6WA 1KRLA 3OW2Z 2NVTI 3K7AI 3CCJ1 4NOZA 4E2XA 3CCU1 4A3KI 3G711 2K3RA 5D1PA 2G2KA 3H0GI 1KQSZ 2Q51A 1VQ71 5IP9I 1NUIA 1K83I 1P9NA 4NBGA 5FLMI 4BXXI 3EERA 1VQ51 1W2BY 3IFUA 3NFZA 2NVQI 3CD6Z 1TWCI 1Q812 3CPWY 3PO3I 2E2HI 3IX0A 1VQMZ 2YU9I 3VMHA 2J6AA 1M901 1VQO1 3CC4Z 1QVFZ 5A2Qb 1Q861 4BY7I 1YUAA 3H3VJ 4X6AI 1N8R1 3P5JB 3GTMI 3HOYI 3PO2I 3S2DI 5LL6f 4AYBA 2BJOA 1KD12 3HOXI 3CCE1 1S721 2VUMI 2WB1A 1N2FA 1K731 2DE6A 4BY1I 2DE7A 1TWAI 2QEX1 3HKZA 5IP7I 1RO0A 3M4OI 2QA41 1TWFI 1YJW1 3I56Z 1ZB9A 3IF8A 2ZAEB 4NBFA 3CCLZ 4DK1A 3JAMf
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1Q I;  2JS4 A;  4XX2 A;  3RZD I;  4MH4 A;  5C4J I;  3GTK I;  1ZB8 A;  2HF1 A;  3S1R I;  1R9T I;  4A93 I;  1Y1W I;  3VMI A;  1WW9 A;  3FKI I;  3RZO I;  2JR6 A;  3S16 I;  3S2H I;  3I4M I;  1QYP A;  3Q87 A;  4QTT A;  1Y1V I;  2R7Z I;  4BBR I;  3GTL I;  1DL6 A;  4NB8 A;  3M3Y I;  2AKL A;  5C4X I;  4A3B I;  3VMG A;  3GTJ I;  4NBA A;  1SFO I;  2JA8 I;  3CQZ I;  3HOV I;  3GCF A;  5C44 I;  2R93 I;  4A3J I;  3S14 I;  3D6W A;  2DE5 A;  2JA7 I;  2F4O A;  1ML8 A;  2NVT I;  3HOZ I;  3K7A I;  3U50 C;  1PFT A;  1RO4 A;  1X3W A;  4NOZ A;  1VLA A;  4A3K I;  2NVY I;  3ESW A;  3S17 I;  4A3M I;  4A3C I;  1I50 I;  3H0G I;  3GKQ A;  4NB9 A;  1Y1V S;  2B63 I;  5IP9 I;  3GTP I;  1NUI A;  1USP A;  2E2I I;  1K83 I;  2F4M A;  4NBH A;  4NBG A;  4NBB A;  5FLM I;  2R92 I;  3GTO I;  4A3L I;  4BBS I;  4BXX I;  3I4N I;  3VB9 A;  3EER A;  3S15 I;  2JA5 I;  2NVQ I;  1TWC I;  4NBC A;  4NBE A;  3PO3 I;  2E2H I;  2YU9 I;  1I6H I;  4Y52 I;  3VMH A;  2J6A A;  1X3Z A;  3HOW I;  3GTQ I;  1RLY A;  4BY7 I;  1I3Q I;  3I07 A;  4A3F I;  1YUA A;  2K5R A;  3H3V J;  4X6A I;  1L1O C;  2KPI A;  1USP B;  2NVX I;  3GTM I;  3HOY I;  3PO2 I;  3S2D I;  2BJO A;  3LUS A;  3S1M I;  3HOX I;  4QTU A;  1WCM I;  4A3I I;  2VUM I;  4A3E I;  5CM2 M;  3GTM S;  1TWG I;  4Y7N I;  4A3D I;  1N2F A;  4NBD A;  2PK7 A;  2DE6 A;  5C3E I;  3GTG I;  4BY1 I;  2DE7 A;  3HOU I;  3S1N I;  1TWA I;  1TFI A;  5IP7 I;  2JNY A;  1TWH I;  2RBL A;  3M4O I;  1TWF I;  2JA6 I;  1ZB9 A;  1LQL A;  3PO3 S;  4NBF A;  4A3G I;  2P3Y A;  2E2J I; 
#chains in the Genus database with same CATH topology
 3CCM Z;  3CCV Z;  2JS4 A;  4XX2 A;  2IV2 X;  3GTK I;  1ZB8 A;  2HF1 A;  3CMA Z;  2R6M A;  5IT9 b;  1WW9 A;  4HGY A;  2E9H A;  2JR6 A;  3CCQ 1;  3S16 I;  2V45 A;  3I4M I;  1QYP A;  2QRC B;  3T4N B;  4BBR I;  1K9M 2;  3KIH A;  3GTL I;  4MXU A;  5AN9 F;  1DL6 A;  1VQN 1;  2VF1 A;  4NB8 A;  3M3Y I;  5C4X I;  4A3B I;  3VMG A;  1JJ2 Y;  5T64 A;  4MD9 A;  3FQQ A;  2DE5 A;  5D1O A;  1YHQ Z;  1YJN 1;  1PFT A;  1RO4 A;  3U50 C;  1Q7Y 2;  4MD8 A;  1S7M A;  4NH1 C;  3CXC Z;  1K8A 2;  2AYD A;  2EGT A;  1VQ6 Z;  2NVY I;  3ESW A;  2VPX A;  2W03 A;  3CCR Z;  3FQM A;  4A3M I;  3G6E Z;  1I50 I;  3CCS 1;  4NB9 A;  4EWC A;  2JIO A;  3GTP I;  2OTJ Z;  3TE5 B;  3KIF A;  4A3L I;  3GTO I;  4BBS I;  3NDI A;  3D9X A;  3I4N I;  4MON A;  3S15 I;  2E7Z A;  2QA4 Z;  4NBC A;  1YIT Z;  1VQP 1;  3G4S 1;  3CC7 Z;  2H85 A;  3J7A 4;  2JUB A;  1VQ9 1;  1FDO A;  4E2Y A;  1I3Q I;  3I07 A;  2NAP A;  1L1O C;  1USP B;  1RNI A;  2O4H A;  1NJI 2;  3CC2 1;  4QTU A;  2VUG A;  5D1O B;  1VQ8 Z;  4RVH A;  3GTM S;  1TWG I;  2VPY A;  5IT9 f;  2QRE B;  2V8K A;  2PK7 A;  3F3P C;  2LEX A;  3OW2 Y;  4MRI A;  2Y0S A;  2RBL A;  3CME 1;  1Q82 2;  2JA6 I;  1Y8C A;  2JMO A;  4DGL A;  4A3G I;  2P3Y A;  3S1Q I;  3NH4 A;  4NFR A;  1YJN Z;  1VQ4 1;  1KQS Y;  2OTL Z;  1VQL 1;  4MH4 A;  2OOY B;  4HGZ A;  1YIJ Z;  2Q4Z A;  3RZO I;  1M1K 1;  4S1T A;  4E31 A;  2VPZ A;  4E2W A;  3F3F C;  2KI7 B;  1YI2 Z;  1QVF Y;  2AKL A;  2RHB A;  1VQK Z;  1KC8 1;  3CQZ I;  4E2Z A;  3GCF A;  1YJ9 1;  2V3V A;  2IZ3 A;  2R93 I;  3CCJ Z;  4DQY B;  1ML8 A;  2HU9 A;  1M90 2;  3CCU Z;  1Q86 2;  2WAQ A;  3G71 Z;  1VLA A;  1N8R 2;  1VQ7 Z;  2JIR A;  1Y1V S;  1QVG Z;  2B63 I;  1USP A;  1K73 2;  1VQ5 Z;  2R92 I;  3VB9 A;  2RT9 A;  2QR1 B;  2JA5 I;  2LIY A;  1VQO Z;  2V8J A;  3MZK B;  1X3Z A;  3HOW I;  3CD6 1;  2M6N A;  2LFU A;  3NH5 A;  3I55 1;  1RLY A;  1VQM 1;  4A3F I;  1Z01 A;  2K5R A;  1KC8 2;  2KPI A;  3CC4 1;  2OZK A;  3CCE Z;  1VQL Z;  1S72 Z;  3S1M I;  2GU2 A;  3BG0 B;  1YUK A;  4A3I I;  4A3E I;  5CM2 M;  2P28 A;  3MZL B;  2QEX Z;  4Y7N I;  1NP6 A;  2YAD A;  4NBD A;  5C3E I;  3GTG I;  4RVD A;  3S1N I;  1YJW Z;  1TFI A;  2V8I A;  3BG1 B;  2JIM A;  4E33 A;  4RVF A;  5T6B A;  1Q81 1;  3CXC Y;  1LQL A;  3PO3 S;  3I56 1;  3CCL 1;  1ZH1 A;  1W2B Z;  3CCM 1;  3CCV 1;  4RS4 A;  1KD1 1;  2IZ4 A;  3CCQ Z;  3S1R I;  1R9T I;  3CPW Z;  4A93 I;  1FDI A;  1Y1W I;  3VMI A;  2O53 A;  3S2H I;  3CMA 1;  2QKD A;  1VQN Z;  3Q87 A;  4QTT A;  1SIW A;  2R7Z I;  1Z02 A;  1RO2 A;  2GTH A;  3D2L A;  1WJ2 A;  3NDJ A;  4E32 A;  2RPR A;  3J80 b;  1WZN A;  4NBA A;  1SFO I;  2JA8 I;  5C44 I;  4A3J I;  5FLX b;  3MON A;  2JA7 I;  2F4O A;  2I3C A;  3HOZ I;  3I55 Z;  1X3W A;  1YHQ 1;  3CCS Z;  3VTN A;  3S17 I;  1Q16 A;  4A3C I;  2W04 A;  1VQ6 1;  3GKQ A;  1K9M 1;  4HH4 A;  3QWU A;  3CCR 1;  3G6E 1;  2E2I I;  2F4M A;  4NBH A;  4NBB A;  2OTJ 1;  1VQP Z;  3G4S Z;  4CL1 A;  1VQ9 Z;  4NBE A;  1I6H I;  2M48 A;  4Y52 I;  1Z03 A;  1YIT 1;  1RQF A;  3GTQ I;  3CC7 1;  1Q7Y 1;  1K8A 1;  3CC2 Z;  1JJ2 Z;  2NVX I;  3J81 f;  2GTI A;  3LUS A;  1X0T A;  1WCM I;  3NH8 A;  2PM9 A;  4A3D I;  1VQ8 1;  3CME Z;  1M1K 2;  3HOU I;  4TNU A;  2JNY A;  4RVG A;  1TWH I;  2PMZ A;  4RV9 A;  3J80 f;  2JIP A;  1VQ4 Z;  2E2J I;  2OOX B;  5FLX f;  3RZD I;  1NJI 1;  1QVG Y;  5C4J I;  5T67 A;  3EED A;  2OTL 1;  2QRD B;  2QLV B;  3FKI I;  1YIJ 1;  5A2Q f;  1WII A;  1QF8 A;  1Y1V I;  2RIQ A;  1Q82 1;  3IR7 A;  4E30 A;  1JWH C;  3TDH B;  3GTJ I;  1YJ9 Z;  1YI2 1;  3JAM b;  3J81 b;  4MD7 A;  3HOV I;  1VQK 1;  3S14 I;  3D6W A;  1KRL A;  3OW2 Z;  2NVT I;  3K7A I;  3CCJ 1;  4NOZ A;  4E2X A;  3CCU 1;  4A3K I;  3G71 1;  2K3R A;  5D1P A;  2G2K A;  3H0G I;  1KQS Z;  2Q51 A;  1QXF A;  1VQ7 1;  5IP9 I;  1NUI A;  1K83 I;  1P9N A;  4NBG A;  5FLM I;  4BXX I;  3EER A;  1VQ5 1;  1W2B Y;  3IFU A;  3NFZ A;  2NVQ I;  3CD6 Z;  1TWC I;  1Q81 2;  3CPW Y;  3PO3 I;  2E2H I;  3IX0 A;  1VQM Z;  2YU9 I;  3VMH A;  2J6A A;  1M90 1;  1VQO 1;  3CC4 Z;  1QVF Z;  5A2Q b;  1Q86 1;  4BY7 I;  1YUA A;  3H3V J;  4X6A I;  1N8R 1;  2VPW A;  3P5J B;  3GTM I;  3HOY I;  3PO2 I;  3S2D I;  5LL6 f;  4AYB A;  2BJO A;  1KD1 2;  3HOX I;  3CCE 1;  1S72 1;  2VUM I;  2WB1 A;  1N2F A;  1K73 1;  2DE6 A;  4BY1 I;  2DE7 A;  1TWA I;  2QEX 1;  3HKZ A;  5IP7 I;  1RO0 A;  3M4O I;  2QA4 1;  1TWF I;  2JIQ A;  1YJW 1;  3I56 Z;  1ZB9 A;  3IF8 A;  1AA6 A;  2ZAE B;  4NBF A;  3CCL Z;  4DK1 A;  3JAM f; 
#chains in the Genus database with same CATH homology
 3CCM Z;  3CCV Z;  2JS4 A;  4XX2 A;  3GTK I;  1ZB8 A;  2HF1 A;  3CMA Z;  2R6M A;  5IT9 b;  1WW9 A;  4HGY A;  2E9H A;  2JR6 A;  3CCQ 1;  3S16 I;  3I4M I;  1QYP A;  2QRC B;  3T4N B;  4BBR I;  1K9M 2;  3KIH A;  3GTL I;  4MXU A;  5AN9 F;  1DL6 A;  1VQN 1;  2VF1 A;  4NB8 A;  3M3Y I;  5C4X I;  4A3B I;  3VMG A;  1JJ2 Y;  5T64 A;  4MD9 A;  3FQQ A;  2DE5 A;  5D1O A;  1YHQ Z;  1YJN 1;  1PFT A;  1RO4 A;  3U50 C;  1Q7Y 2;  4MD8 A;  1S7M A;  4NH1 C;  3CXC Z;  1K8A 2;  2EGT A;  1VQ6 Z;  2NVY I;  3ESW A;  2W03 A;  3CCR Z;  3FQM A;  4A3M I;  3G6E Z;  1I50 I;  3CCS 1;  4NB9 A;  4EWC A;  2OTJ Z;  3GTP I;  3TE5 B;  3KIF A;  4A3L I;  3GTO I;  4BBS I;  3NDI A;  3D9X A;  3I4N I;  4MON A;  3S15 I;  2QA4 Z;  4NBC A;  1YIT Z;  1VQP 1;  3G4S 1;  3CC7 Z;  2H85 A;  3J7A 4;  2JUB A;  1VQ9 1;  4E2Y A;  1I3Q I;  3I07 A;  1L1O C;  1USP B;  1RNI A;  2O4H A;  1NJI 2;  3CC2 1;  4QTU A;  2VUG A;  5D1O B;  1VQ8 Z;  4RVH A;  3GTM S;  1TWG I;  5IT9 f;  2QRE B;  2V8K A;  2PK7 A;  3F3P C;  3OW2 Y;  4MRI A;  2Y0S A;  2RBL A;  3CME 1;  1Q82 2;  2JA6 I;  2JMO A;  4DGL A;  4A3G I;  2P3Y A;  3S1Q I;  3NH4 A;  4NFR A;  1YJN Z;  1VQ4 1;  1KQS Y;  2OTL Z;  1VQL 1;  4MH4 A;  2OOY B;  4HGZ A;  1YIJ Z;  2Q4Z A;  3RZO I;  1M1K 1;  4S1T A;  4E31 A;  4E2W A;  3F3F C;  2KI7 B;  1YI2 Z;  1QVF Y;  2AKL A;  2RHB A;  1VQK Z;  1KC8 1;  3CQZ I;  4E2Z A;  3GCF A;  1YJ9 1;  2R93 I;  2IZ3 A;  3CCJ Z;  4DQY B;  1ML8 A;  2HU9 A;  1M90 2;  3CCU Z;  1Q86 2;  2WAQ A;  3G71 Z;  1VLA A;  1N8R 2;  1VQ7 Z;  1Y1V S;  1QVG Z;  2B63 I;  1USP A;  1K73 2;  1VQ5 Z;  2R92 I;  3VB9 A;  2RT9 A;  2QR1 B;  2JA5 I;  2LIY A;  1VQO Z;  2V8J A;  3MZK B;  1X3Z A;  3HOW I;  3CD6 1;  2M6N A;  2LFU A;  3NH5 A;  3I55 1;  1RLY A;  1VQM 1;  4A3F I;  1Z01 A;  2K5R A;  1KC8 2;  2KPI A;  3CC4 1;  2OZK A;  3CCE Z;  1VQL Z;  1S72 Z;  3S1M I;  2GU2 A;  3BG0 B;  1YUK A;  4A3I I;  4A3E I;  5CM2 M;  2P28 A;  3MZL B;  2QEX Z;  4Y7N I;  1NP6 A;  2YAD A;  4NBD A;  5C3E I;  3GTG I;  4RVD A;  3S1N I;  1YJW Z;  1TFI A;  2V8I A;  3BG1 B;  4E33 A;  4RVF A;  5T6B A;  1Q81 1;  3CXC Y;  1LQL A;  3PO3 S;  3I56 1;  3CCL 1;  1ZH1 A;  1W2B Z;  3CCM 1;  3CCV 1;  4RS4 A;  1KD1 1;  2IZ4 A;  3CCQ Z;  3S1R I;  1R9T I;  3CPW Z;  4A93 I;  1Y1W I;  3VMI A;  2O53 A;  3S2H I;  3CMA 1;  2QKD A;  1VQN Z;  3Q87 A;  4QTT A;  2R7Z I;  1Z02 A;  1RO2 A;  2GTH A;  3NDJ A;  4E32 A;  2RPR A;  3J80 b;  4NBA A;  1SFO I;  2JA8 I;  5C44 I;  4A3J I;  5FLX b;  3MON A;  2JA7 I;  2F4O A;  2I3C A;  3HOZ I;  3I55 Z;  1X3W A;  1YHQ 1;  3CCS Z;  3VTN A;  3S17 I;  4A3C I;  2W04 A;  1VQ6 1;  3GKQ A;  1K9M 1;  4HH4 A;  3QWU A;  3CCR 1;  3G6E 1;  2E2I I;  2F4M A;  4NBH A;  4NBB A;  2OTJ 1;  1VQP Z;  3G4S Z;  4CL1 A;  1VQ9 Z;  4NBE A;  1I6H I;  2M48 A;  4Y52 I;  1Z03 A;  1YIT 1;  1RQF A;  3GTQ I;  3CC7 1;  1Q7Y 1;  1K8A 1;  3CC2 Z;  1JJ2 Z;  2NVX I;  3J81 f;  2GTI A;  3LUS A;  1X0T A;  1WCM I;  3NH8 A;  2PM9 A;  4A3D I;  1VQ8 1;  3CME Z;  1M1K 2;  3HOU I;  4TNU A;  2JNY A;  4RVG A;  1TWH I;  2PMZ A;  4RV9 A;  3J80 f;  1VQ4 Z;  2E2J I;  2OOX B;  5FLX f;  3RZD I;  1NJI 1;  1QVG Y;  5C4J I;  5T67 A;  3EED A;  2OTL 1;  2QRD B;  2QLV B;  3FKI I;  1YIJ 1;  5A2Q f;  1WII A;  1QF8 A;  1Y1V I;  2RIQ A;  1Q82 1;  4E30 A;  1JWH C;  3TDH B;  3GTJ I;  1YJ9 Z;  1YI2 1;  3JAM b;  3J81 b;  4MD7 A;  3HOV I;  1VQK 1;  3S14 I;  3D6W A;  1KRL A;  3OW2 Z;  2NVT I;  3K7A I;  3CCJ 1;  4NOZ A;  4E2X A;  3CCU 1;  4A3K I;  3G71 1;  2K3R A;  5D1P A;  2G2K A;  3H0G I;  1KQS Z;  2Q51 A;  1VQ7 1;  5IP9 I;  1NUI A;  1K83 I;  1P9N A;  4NBG A;  5FLM I;  4BXX I;  3EER A;  1VQ5 1;  1W2B Y;  3IFU A;  3NFZ A;  2NVQ I;  3CD6 Z;  1TWC I;  1Q81 2;  3CPW Y;  3PO3 I;  2E2H I;  3IX0 A;  1VQM Z;  2YU9 I;  3VMH A;  2J6A A;  1M90 1;  1VQO 1;  3CC4 Z;  1QVF Z;  5A2Q b;  1Q86 1;  4BY7 I;  1YUA A;  3H3V J;  4X6A I;  1N8R 1;  3P5J B;  3GTM I;  3HOY I;  3PO2 I;  3S2D I;  5LL6 f;  4AYB A;  2BJO A;  1KD1 2;  3HOX I;  3CCE 1;  1S72 1;  2VUM I;  2WB1 A;  1N2F A;  1K73 1;  2DE6 A;  4BY1 I;  2DE7 A;  1TWA I;  2QEX 1;  3HKZ A;  5IP7 I;  1RO0 A;  3M4O I;  2QA4 1;  1TWF I;  1YJW 1;  3I56 Z;  1ZB9 A;  3IF8 A;  2ZAE B;  4NBF A;  3CCL Z;  4DK1 A;  3JAM f; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...