1K9M1

Co-crystal structure of tylosin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
total genus 13
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2001-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1k9m100
3CCE1 3CCM1 1K9M1 1VQO1 1YJW1 1VQKZ 1Q861 1VQ6Z 1M901 3CME1 1NJI1 1KQSY 1KC81 1M1K1 3I55Z 1QVGY 3G71Z 3CC4Z 3CXCY 3OW2Y 1VQ71 1KQSZ 2OTJZ 1YIT1 3CXCZ 1VQ9Z 1VQL1 1Q821 3OW2Z 1S72Z 3CCSZ 1YIJZ 3I56Z 3CCRZ 2OTL1 2QA41 3CD6Z 3CCJ1 1K8A2 1N8R2 3CCU1 1K732 3CC21 1VQNZ 3G4S1 1VQM1 1YJNZ 3CCQZ 1W2BY 1YJ91 1JJ2Y 1Q812 1VQK1 1VQ61 1VQOZ 1W2BZ 1JJ2Z 3CCV1 1YI2Z 3I551 3G711 1VQ5Z 3CC41 1KD11 3G6EZ 1VQ81 1K8A1 3CC71 1N8R1 1VQ41 1VQPZ 1VQ91 3CMA1 1S721 1YIJ1 1VQLZ 3CCR1 3CCLZ 1Q811 1YHQZ 1QVFY 2QEXZ 3CCUZ 3CCEZ 3CCMZ 1VQN1 1YJWZ 1QVFZ 1YJN1 3CMEZ 1Q7Y2 1YJ9Z 3CPWY 1K9M2 2OTJ1 1K731 1YI21 1Q862 1VQ7Z 1VQ51 3G6E1 3CPWZ 1M902 3CCVZ 3CCS1 1YITZ 3I561 1NJI2 3CD61 1VQ8Z 1KC82 1M1K2 3CC7Z 1VQP1 2OTLZ 2QA4Z 3CCJZ 1VQ4Z 1QVGZ 3CMAZ 3CCL1 3CC2Z 1YHQ1 1Q822 1KD12 2QEX1 3G4SZ 3CCQ1 1VQMZ 1Q7Y1
chains in the Genus database with same CATH superfamily
3VMIA 3CCM1 2DE7A 2RIQA 2JR6A 3NFZA 3HOWI 3CME1 4E33A 1NJI1 3PO3S 1KC81 1M1K1 1QVGY 2BJOA 3S2HI 3JAMf 3OW2Y 1RO0A 2OTJZ 3GTMI 3S14I 1VQL1 2JIMA 3GTPI 2G2KA 3OW2Z 1S72Z 1I50I 4HGYA 3T4NB 2V8JA 5T6BA 2QA41 4BXXI 1N8R2 1VLAA 3J7A4 1YUAA 3LUSA 3TDHB 2NVTI 1K732 1ZB8A 1VQNZ 3HKZA 2AKLA 3RZDI 2I3CA 2WAQA 5D1OB 4NB9A 1Y1VI 5FLMI 2KI7B 1QYPA 4E32A 3IF8A 3M4OI 2M6NA 1WCMI 2HU9A 3CCV1 1YI2Z 3I551 3G711 1VQ5Z 3CC41 1VQ81 5IP7I 3FQQA 1WZNA 1N8R1 2RT9A 4X6AI 4HGZA 4BBSI 4NH1C 4NBDA 5A2Qf 1VQLZ 1Z03A 1USPA 3GTMS 1Y1WI 2EGTA 2QREB 2K5RA 2LIYA 4E2WA 4RVHA 1YJN1 1Q7Y2 2K3RA 1Y1VS 1Q862 3CCVZ 3CCS1 3NH8A 1YITZ 3I561 3H3VJ 3VB9A 3CD61 1VQ8Z 4XX2A 3D2LA 4TNUA 4NOZA 4A3DI 4A3BI 2B63I 2OOYB 1RNIA 1YHQ1 2JA6I 2QEX1 3NDIA 1VQMZ 4E2ZA 4E30A 1Q7Y1 3VMHA 3S1MI 2V3VA 2VPYA 1YJW1 3RZOI 1Q861 3JAMb 5C4XI 4NFRA 5FLXf 1VQ6Z 3GTKI 2VUMI 3F3PC 4NBBA 2Q4ZA 2IZ4A 1KQSY 3S17I 3ESWA 1QF8A 1PFTA 1VQ71 1KQSZ 3GCFA 3H0GI 3KIHA 3MZLB 5IT9f 3S1RI 2R7ZI 3D6WA 4NBEA 2V8IA 2VF1A 3CCSZ 3S16I 2E7ZA 3I56Z 3CCRZ 2OTL1 4Y7NI 3CD6Z 3NH5A 5T67A 2M48A 2PK7A 3NH4A 4MD8A 2DE5A 1RQFA 1TWFI 3GKQA 4RVDA 3Q87A 1VQK1 1I6HI 2V8KA 3NDJA 1P9NA 1LQLA 5T64A 3I07A 4AYBA 1ML8A 2R92I 2LEXA 4A3MI 5A2Qb 1KD11 3G6EZ 1AA6A 3MONA 2VUGA 1VQ41 3GTOI 1VQ91 2IV2X 1X3ZA 1SIWA 2YADA 2F4MA 3EERA 2IZ3A 2VPZA 1YIJ1 4A3GI 3QWUA 2JIPA 4NBHA 3TE5B 2P3YA 4A3FI 3CCMZ 4QTUA 3S1QI 4DQYB 3J80b 3GTJI 3CMEZ 2JA8I 2VPWA 3CPWY 2LFUA 3HOXI 2QRCB 2QRDB 5D1OA 1K731 5D1PA 5C3EI 3EEDA 3CPWZ 4RV9A 4RS4A 3J81b 1VQP1 2QA4Z 2R93I 1TWAI 1VQ4Z 1WIIA 2GTIA 2GTHA 4BY1I 3PO2I 2E9HA 3CCL1 2J6AA 3CCE1 4A3EI 3GTLI 2F4OA 1ZB9A 4MONA 3F3FC 1NP6A 4A3CI 5CM2M 3I55Z 3G71Z 3VMGA 3CC4Z 3I4MI 4MXUA 3U50C 2JIQA 2JA5I 2H85A 3HOUI 3IFUA 3CCJ1 1K8A2 4E2XA 4E2YA 2RPRA 1X0TA 2PM9A 3CC21 4A3KI 3I4NI 3S15I 4MD9A 3G4S1 1FDIA 5LL6f 1YJNZ 1JJ2Y 4NBCA 5C4JI 1JJ2Z 2HF1A 1TWGI 1ZH1A 3BG1B 1K8A1 3M3YI 3CC71 2O53A 2ZAEB 1S721 4A3LI 4NBGA 3IX0A 4RVFA 4S1TA 4CL1A 1YHQZ 1QVFY 2QEXZ 2JS4A 2KPIA 1L1OC 2VPXA 1VQN1 1FDOA 4A93I 1YJWZ 1QVFZ 3IR7A 1TWHI 1SFOI 1JWHC 2W03A 1DL6A 3S2DI 2V45A 2PMZA 1K9M2 1YI21 1VQ7Z 2RBLA 1VQ51 4HH4A 4MH4A 1M902 1X3WA 2OZKA 2JIOA 3KIFA 3CC7Z 2OTLZ 3BG0B 1Z02A 1QVGZ 2QR1B 4RVGA 1Q16A 4BY7I 1Q822 4A3II 3CCQ1 4EWCA 2Y0SA 4DGLA 1S7MA 1K9M1 1VQO1 1VQKZ 2JA7I 3S1NI 4QTTA 2DE6A 1WJ2A 1M901 3P5JB 2NVQI 3CXCY 4BBRI 1USPB 2JUBA 2JNYA 2WB1A 1YIT1 3CXCZ 1VQ9Z 2OOXB 1Q821 2YU9I 2RHBA 3CQZI 5FLXb 3FKII 1YIJZ 4DK1A 3CCU1 4NB8A 3K7AI 3GTQI 1RLYA 3VTNA 1VQM1 5IT9b 1NUIA 2NVYI 2NAPA 3CCQZ 1W2BY 1YJ91 1Q812 1KRLA 2R6MA 1VQ61 1VQOZ 1W2BZ 1Z01A 2E2II 1N2FA 3FQMA 3HOYI 2E2JI 2O4HA 3D9XA 4Y52I 3J80f 1VQPZ 3CMA1 3CCR1 2JIRA 1RO4A 3CCLZ 1YUKA 1Q811 1Y8CA 2P28A 5IP9I 1RO2A 3CCUZ 2QKDA 3CCEZ 3HOZI 4A3JI 3PO3I 2AYDA 3HOVI 4NBAA 3J81f 1K83I 2GU2A 1WW9A 1YJ9Z 4MD7A 2W04A 1R9TI 2OTJ1 1TFIA 4E31A 5AN9F 4MRIA 3GTGI 1QXFA 3G6E1 5C44I 2QLVB 1NJI2 3MZKB 2JMOA 1KC82 1M1K2 3CCJZ 1TWCI 3CMAZ 4NBFA 3CC2Z 1I3QI 2E2HI 2Q51A 1KD12 2NVXI 3G4SZ
chains in the Genus database with same CATH topology
3VMIA 3CCM1 2DE7A 2RIQA 2JR6A 3NFZA 3HOWI 3CME1 4E33A 1NJI1 3PO3S 1KC81 1M1K1 1QVGY 2BJOA 3S2HI 3JAMf 3OW2Y 1RO0A 2OTJZ 3GTMI 3S14I 1VQL1 3GTPI 2G2KA 3OW2Z 1S72Z 1I50I 4HGYA 3T4NB 2V8JA 5T6BA 2QA41 4BXXI 1N8R2 1VLAA 3J7A4 1YUAA 3LUSA 3TDHB 2NVTI 1K732 1ZB8A 1VQNZ 3HKZA 2AKLA 3RZDI 2I3CA 2WAQA 5D1OB 4NB9A 1Y1VI 5FLMI 2KI7B 1QYPA 4E32A 3IF8A 3M4OI 2M6NA 1WCMI 2HU9A 3CCV1 1YI2Z 3I551 3G711 1VQ5Z 3CC41 1VQ81 5IP7I 3FQQA 1N8R1 2RT9A 4X6AI 4HGZA 4BBSI 4NH1C 4NBDA 5A2Qf 1VQLZ 1Z03A 1USPA 3GTMS 1Y1WI 2EGTA 2QREB 2K5RA 2LIYA 4E2WA 4RVHA 1YJN1 1Q7Y2 2K3RA 1Y1VS 1Q862 3CCVZ 3CCS1 3NH8A 1YITZ 3I561 3H3VJ 3VB9A 3CD61 1VQ8Z 4XX2A 4TNUA 4NOZA 4A3DI 4A3BI 2B63I 2OOYB 1RNIA 1YHQ1 2JA6I 2QEX1 3NDIA 1VQMZ 4E2ZA 4E30A 1Q7Y1 3VMHA 3S1MI 1YJW1 3RZOI 1Q861 3JAMb 5C4XI 4NFRA 5FLXf 1VQ6Z 3GTKI 2VUMI 3F3PC 4NBBA 2Q4ZA 2IZ4A 1KQSY 3S17I 3ESWA 1QF8A 1PFTA 1VQ71 1KQSZ 3GCFA 3H0GI 3KIHA 3MZLB 5IT9f 3S1RI 2R7ZI 3D6WA 4NBEA 2V8IA 2VF1A 3CCSZ 3S16I 3I56Z 3CCRZ 2OTL1 4Y7NI 3CD6Z 3NH5A 5T67A 2M48A 2PK7A 3NH4A 4MD8A 2DE5A 1RQFA 1TWFI 3GKQA 4RVDA 3Q87A 1VQK1 1I6HI 2V8KA 3NDJA 1P9NA 1LQLA 5T64A 3I07A 4AYBA 1ML8A 2R92I 4A3MI 5A2Qb 1KD11 3G6EZ 3MONA 2VUGA 1VQ41 3GTOI 1VQ91 1X3ZA 2YADA 2F4MA 3EERA 2IZ3A 1YIJ1 4A3GI 3QWUA 4NBHA 3TE5B 2P3YA 4A3FI 3CCMZ 4QTUA 3S1QI 4DQYB 3J80b 3GTJI 3CMEZ 2JA8I 3CPWY 2LFUA 3HOXI 2QRCB 2QRDB 5D1OA 1K731 5D1PA 5C3EI 3EEDA 3CPWZ 4RV9A 4RS4A 3J81b 1VQP1 2QA4Z 2R93I 1TWAI 1VQ4Z 1WIIA 2GTIA 2GTHA 4BY1I 3PO2I 2E9HA 3CCL1 2J6AA 3CCE1 4A3EI 3GTLI 2F4OA 1ZB9A 4MONA 3F3FC 1NP6A 4A3CI 5CM2M 3I55Z 3G71Z 3VMGA 3CC4Z 3I4MI 4MXUA 3U50C 2JA5I 2H85A 3HOUI 3IFUA 3CCJ1 1K8A2 4E2XA 4E2YA 2RPRA 1X0TA 2PM9A 3CC21 4A3KI 3I4NI 3S15I 4MD9A 3G4S1 5LL6f 1YJNZ 1JJ2Y 4NBCA 5C4JI 1JJ2Z 2HF1A 1TWGI 1ZH1A 3BG1B 1K8A1 3M3YI 3CC71 2O53A 2ZAEB 1S721 4A3LI 4NBGA 3IX0A 4RVFA 4S1TA 4CL1A 1YHQZ 1QVFY 2QEXZ 2JS4A 2KPIA 1L1OC 1VQN1 4A93I 1YJWZ 1QVFZ 1TWHI 1SFOI 1JWHC 2W03A 1DL6A 3S2DI 2PMZA 1K9M2 1YI21 1VQ7Z 2RBLA 1VQ51 4HH4A 4MH4A 1M902 1X3WA 2OZKA 3KIFA 3CC7Z 2OTLZ 3BG0B 1Z02A 1QVGZ 2QR1B 4RVGA 4BY7I 1Q822 4A3II 3CCQ1 4EWCA 2Y0SA 4DGLA 1S7MA 1K9M1 1VQO1 1VQKZ 2JA7I 3S1NI 4QTTA 2DE6A 1M901 3P5JB 2NVQI 3CXCY 4BBRI 1USPB 2JUBA 2JNYA 2WB1A 1YIT1 3CXCZ 1VQ9Z 2OOXB 1Q821 2YU9I 2RHBA 3CQZI 5FLXb 3FKII 1YIJZ 4DK1A 3CCU1 4NB8A 3K7AI 3GTQI 1RLYA 3VTNA 1VQM1 5IT9b 1NUIA 2NVYI 3CCQZ 1W2BY 1YJ91 1Q812 1KRLA 2R6MA 1VQ61 1VQOZ 1W2BZ 1Z01A 2E2II 1N2FA 3FQMA 3HOYI 2E2JI 2O4HA 3D9XA 4Y52I 3J80f 1VQPZ 3CMA1 3CCR1 3CCLZ 1RO4A 1YUKA 1Q811 2P28A 5IP9I 1RO2A 3CCUZ 2QKDA 3CCEZ 3HOZI 4A3JI 3PO3I 3HOVI 4NBAA 3J81f 1K83I 2GU2A 1WW9A 1YJ9Z 4MD7A 2W04A 1R9TI 2OTJ1 1TFIA 4E31A 5AN9F 4MRIA 3GTGI 3G6E1 5C44I 2QLVB 1NJI2 3MZKB 2JMOA 1KC82 1M1K2 3CCJZ 1TWCI 3CMAZ 4NBFA 3CC2Z 1I3QI 2E2HI 2Q51A 1KD12 2NVXI 3G4SZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCE 1;  3CCM 1;  1K9M 1;  1VQO 1;  1YJW 1;  1VQK Z;  1Q86 1;  1VQ6 Z;  1M90 1;  3CME 1;  1NJI 1;  1KQS Y;  1KC8 1;  1M1K 1;  3I55 Z;  1QVG Y;  3G71 Z;  3CC4 Z;  3CXC Y;  3OW2 Y;  1VQ7 1;  1KQS Z;  2OTJ Z;  1YIT 1;  3CXC Z;  1VQ9 Z;  1VQL 1;  1Q82 1;  3OW2 Z;  1S72 Z;  3CCS Z;  1YIJ Z;  3I56 Z;  3CCR Z;  2OTL 1;  2QA4 1;  3CD6 Z;  3CCJ 1;  1K8A 2;  1N8R 2;  3CCU 1;  1K73 2;  3CC2 1;  1VQN Z;  3G4S 1;  1VQM 1;  1YJN Z;  3CCQ Z;  1W2B Y;  1YJ9 1;  1JJ2 Y;  1Q81 2;  1VQK 1;  1VQ6 1;  1VQO Z;  1W2B Z;  1JJ2 Z;  3CCV 1;  1YI2 Z;  3I55 1;  3G71 1;  1VQ5 Z;  3CC4 1;  1KD1 1;  3G6E Z;  1VQ8 1;  1K8A 1;  3CC7 1;  1N8R 1;  1VQ4 1;  1VQP Z;  1VQ9 1;  3CMA 1;  1S72 1;  1YIJ 1;  1VQL Z;  3CCR 1;  3CCL Z;  1Q81 1;  1YHQ Z;  1QVF Y;  2QEX Z;  3CCU Z;  3CCE Z;  3CCM Z;  1VQN 1;  1YJW Z;  1QVF Z;  1YJN 1;  3CME Z;  1Q7Y 2;  1YJ9 Z;  3CPW Y;  1K9M 2;  2OTJ 1;  1K73 1;  1YI2 1;  1Q86 2;  1VQ7 Z;  1VQ5 1;  3G6E 1;  3CPW Z;  1M90 2;  3CCV Z;  3CCS 1;  1YIT Z;  3I56 1;  1NJI 2;  3CD6 1;  1VQ8 Z;  1KC8 2;  1M1K 2;  3CC7 Z;  1VQP 1;  2OTL Z;  2QA4 Z;  3CCJ Z;  1VQ4 Z;  1QVG Z;  3CMA Z;  3CCL 1;  3CC2 Z;  1YHQ 1;  1Q82 2;  1KD1 2;  2QEX 1;  3G4S Z;  3CCQ 1;  1VQM Z;  1Q7Y 1; 
#chains in the Genus database with same CATH topology
 3VMI A;  3CCM 1;  2DE7 A;  2RIQ A;  2JR6 A;  3NFZ A;  3HOW I;  3CME 1;  4E33 A;  1NJI 1;  3PO3 S;  1KC8 1;  1M1K 1;  1QVG Y;  2BJO A;  3S2H I;  3JAM f;  3OW2 Y;  1RO0 A;  2OTJ Z;  3GTM I;  3S14 I;  1VQL 1;  2JIM A;  3GTP I;  2G2K A;  3OW2 Z;  1S72 Z;  1I50 I;  4HGY A;  3T4N B;  2V8J A;  5T6B A;  2QA4 1;  4BXX I;  1N8R 2;  1VLA A;  3J7A 4;  1YUA A;  3LUS A;  3TDH B;  2NVT I;  1K73 2;  1ZB8 A;  1VQN Z;  3HKZ A;  2AKL A;  3RZD I;  2I3C A;  2WAQ A;  5D1O B;  4NB9 A;  1Y1V I;  5FLM I;  2KI7 B;  1QYP A;  4E32 A;  3IF8 A;  3M4O I;  2M6N A;  1WCM I;  2HU9 A;  3CCV 1;  1YI2 Z;  3I55 1;  3G71 1;  1VQ5 Z;  3CC4 1;  1VQ8 1;  5IP7 I;  3FQQ A;  1WZN A;  1N8R 1;  2RT9 A;  4X6A I;  4HGZ A;  4BBS I;  4NH1 C;  4NBD A;  5A2Q f;  1VQL Z;  1Z03 A;  1USP A;  3GTM S;  1Y1W I;  2EGT A;  2QRE B;  2K5R A;  2LIY A;  4E2W A;  4RVH A;  1YJN 1;  1Q7Y 2;  2K3R A;  1Y1V S;  1Q86 2;  3CCV Z;  3CCS 1;  3NH8 A;  1YIT Z;  3I56 1;  3H3V J;  3VB9 A;  3CD6 1;  1VQ8 Z;  4XX2 A;  3D2L A;  4TNU A;  4NOZ A;  4A3D I;  4A3B I;  2B63 I;  2OOY B;  1RNI A;  1YHQ 1;  2JA6 I;  2QEX 1;  3NDI A;  1VQM Z;  4E2Z A;  4E30 A;  1Q7Y 1;  3VMH A;  3S1M I;  2V3V A;  2VPY A;  1YJW 1;  3RZO I;  1Q86 1;  3JAM b;  5C4X I;  4NFR A;  5FLX f;  1VQ6 Z;  3GTK I;  2VUM I;  3F3P C;  4NBB A;  2Q4Z A;  2IZ4 A;  1KQS Y;  3S17 I;  3ESW A;  1QF8 A;  1PFT A;  1VQ7 1;  1KQS Z;  3GCF A;  3H0G I;  3KIH A;  3MZL B;  5IT9 f;  3S1R I;  2R7Z I;  3D6W A;  4NBE A;  2V8I A;  2VF1 A;  3CCS Z;  3S16 I;  2E7Z A;  3I56 Z;  3CCR Z;  2OTL 1;  4Y7N I;  3CD6 Z;  3NH5 A;  5T67 A;  2M48 A;  2PK7 A;  3NH4 A;  4MD8 A;  2DE5 A;  1RQF A;  1TWF I;  3GKQ A;  4RVD A;  3Q87 A;  1VQK 1;  1I6H I;  2V8K A;  3NDJ A;  1P9N A;  1LQL A;  5T64 A;  3I07 A;  4AYB A;  1ML8 A;  2R92 I;  2LEX A;  4A3M I;  5A2Q b;  1KD1 1;  3G6E Z;  1AA6 A;  3MON A;  2VUG A;  1VQ4 1;  3GTO I;  1VQ9 1;  2IV2 X;  1X3Z A;  1SIW A;  2YAD A;  2F4M A;  3EER A;  2IZ3 A;  2VPZ A;  1YIJ 1;  4A3G I;  3QWU A;  2JIP A;  4NBH A;  3TE5 B;  2P3Y A;  4A3F I;  3CCM Z;  4QTU A;  3S1Q I;  4DQY B;  3J80 b;  3GTJ I;  3CME Z;  2JA8 I;  2VPW A;  3CPW Y;  2LFU A;  3HOX I;  2QRC B;  2QRD B;  5D1O A;  1K73 1;  5D1P A;  5C3E I;  3EED A;  3CPW Z;  4RV9 A;  4RS4 A;  3J81 b;  1VQP 1;  2QA4 Z;  2R93 I;  1TWA I;  1VQ4 Z;  1WII A;  2GTI A;  2GTH A;  4BY1 I;  3PO2 I;  2E9H A;  3CCL 1;  2J6A A;  3CCE 1;  4A3E I;  3GTL I;  2F4O A;  1ZB9 A;  4MON A;  3F3F C;  1NP6 A;  4A3C I;  5CM2 M;  3I55 Z;  3G71 Z;  3VMG A;  3CC4 Z;  3I4M I;  4MXU A;  3U50 C;  2JIQ A;  2JA5 I;  2H85 A;  3HOU I;  3IFU A;  3CCJ 1;  1K8A 2;  4E2X A;  4E2Y A;  2RPR A;  1X0T A;  2PM9 A;  3CC2 1;  4A3K I;  3I4N I;  3S15 I;  4MD9 A;  3G4S 1;  1FDI A;  5LL6 f;  1YJN Z;  1JJ2 Y;  4NBC A;  5C4J I;  1JJ2 Z;  2HF1 A;  1TWG I;  1ZH1 A;  3BG1 B;  1K8A 1;  3M3Y I;  3CC7 1;  2O53 A;  2ZAE B;  1S72 1;  4A3L I;  4NBG A;  3IX0 A;  4RVF A;  4S1T A;  4CL1 A;  1YHQ Z;  1QVF Y;  2QEX Z;  2JS4 A;  2KPI A;  1L1O C;  2VPX A;  1VQN 1;  1FDO A;  4A93 I;  1YJW Z;  1QVF Z;  3IR7 A;  1TWH I;  1SFO I;  1JWH C;  2W03 A;  1DL6 A;  3S2D I;  2V45 A;  2PMZ A;  1K9M 2;  1YI2 1;  1VQ7 Z;  2RBL A;  1VQ5 1;  4HH4 A;  4MH4 A;  1M90 2;  1X3W A;  2OZK A;  2JIO A;  3KIF A;  3CC7 Z;  2OTL Z;  3BG0 B;  1Z02 A;  1QVG Z;  2QR1 B;  4RVG A;  1Q16 A;  4BY7 I;  1Q82 2;  4A3I I;  3CCQ 1;  4EWC A;  2Y0S A;  4DGL A;  1S7M A;  1K9M 1;  1VQO 1;  1VQK Z;  2JA7 I;  3S1N I;  4QTT A;  2DE6 A;  1WJ2 A;  1M90 1;  3P5J B;  2NVQ I;  3CXC Y;  4BBR I;  1USP B;  2JUB A;  2JNY A;  2WB1 A;  1YIT 1;  3CXC Z;  1VQ9 Z;  2OOX B;  1Q82 1;  2YU9 I;  2RHB A;  3CQZ I;  5FLX b;  3FKI I;  1YIJ Z;  4DK1 A;  3CCU 1;  4NB8 A;  3K7A I;  3GTQ I;  1RLY A;  3VTN A;  1VQM 1;  5IT9 b;  1NUI A;  2NVY I;  2NAP A;  3CCQ Z;  1W2B Y;  1YJ9 1;  1Q81 2;  1KRL A;  2R6M A;  1VQ6 1;  1VQO Z;  1W2B Z;  1Z01 A;  2E2I I;  1N2F A;  3FQM A;  3HOY I;  2E2J I;  2O4H A;  3D9X A;  4Y52 I;  3J80 f;  1VQP Z;  3CMA 1;  3CCR 1;  2JIR A;  1RO4 A;  3CCL Z;  1YUK A;  1Q81 1;  1Y8C A;  2P28 A;  5IP9 I;  1RO2 A;  3CCU Z;  2QKD A;  3CCE Z;  3HOZ I;  4A3J I;  3PO3 I;  2AYD A;  3HOV I;  4NBA A;  3J81 f;  1K83 I;  2GU2 A;  1WW9 A;  1YJ9 Z;  4MD7 A;  2W04 A;  1R9T I;  2OTJ 1;  1TFI A;  4E31 A;  5AN9 F;  4MRI A;  3GTG I;  1QXF A;  3G6E 1;  5C44 I;  2QLV B;  1NJI 2;  3MZK B;  2JMO A;  1KC8 2;  1M1K 2;  3CCJ Z;  1TWC I;  3CMA Z;  4NBF A;  3CC2 Z;  1I3Q I;  2E2H I;  2Q51 A;  1KD1 2;  2NVX I;  3G4S Z; 
#chains in the Genus database with same CATH homology
 3VMI A;  3CCM 1;  2DE7 A;  2RIQ A;  2JR6 A;  3NFZ A;  3HOW I;  3CME 1;  4E33 A;  1NJI 1;  3PO3 S;  1KC8 1;  1M1K 1;  1QVG Y;  2BJO A;  3S2H I;  3JAM f;  3OW2 Y;  1RO0 A;  2OTJ Z;  3GTM I;  3S14 I;  1VQL 1;  3GTP I;  2G2K A;  3OW2 Z;  1S72 Z;  1I50 I;  4HGY A;  3T4N B;  2V8J A;  5T6B A;  2QA4 1;  4BXX I;  1N8R 2;  1VLA A;  3J7A 4;  1YUA A;  3LUS A;  3TDH B;  2NVT I;  1K73 2;  1ZB8 A;  1VQN Z;  3HKZ A;  2AKL A;  3RZD I;  2I3C A;  2WAQ A;  5D1O B;  4NB9 A;  1Y1V I;  5FLM I;  2KI7 B;  1QYP A;  4E32 A;  3IF8 A;  3M4O I;  2M6N A;  1WCM I;  2HU9 A;  3CCV 1;  1YI2 Z;  3I55 1;  3G71 1;  1VQ5 Z;  3CC4 1;  1VQ8 1;  5IP7 I;  3FQQ A;  1N8R 1;  2RT9 A;  4X6A I;  4HGZ A;  4BBS I;  4NH1 C;  4NBD A;  5A2Q f;  1VQL Z;  1Z03 A;  1USP A;  3GTM S;  1Y1W I;  2EGT A;  2QRE B;  2K5R A;  2LIY A;  4E2W A;  4RVH A;  1YJN 1;  1Q7Y 2;  2K3R A;  1Y1V S;  1Q86 2;  3CCV Z;  3CCS 1;  3NH8 A;  1YIT Z;  3I56 1;  3H3V J;  3VB9 A;  3CD6 1;  1VQ8 Z;  4XX2 A;  4TNU A;  4NOZ A;  4A3D I;  4A3B I;  2B63 I;  2OOY B;  1RNI A;  1YHQ 1;  2JA6 I;  2QEX 1;  3NDI A;  1VQM Z;  4E2Z A;  4E30 A;  1Q7Y 1;  3VMH A;  3S1M I;  1YJW 1;  3RZO I;  1Q86 1;  3JAM b;  5C4X I;  4NFR A;  5FLX f;  1VQ6 Z;  3GTK I;  2VUM I;  3F3P C;  4NBB A;  2Q4Z A;  2IZ4 A;  1KQS Y;  3S17 I;  3ESW A;  1QF8 A;  1PFT A;  1VQ7 1;  1KQS Z;  3GCF A;  3H0G I;  3KIH A;  3MZL B;  5IT9 f;  3S1R I;  2R7Z I;  3D6W A;  4NBE A;  2V8I A;  2VF1 A;  3CCS Z;  3S16 I;  3I56 Z;  3CCR Z;  2OTL 1;  4Y7N I;  3CD6 Z;  3NH5 A;  5T67 A;  2M48 A;  2PK7 A;  3NH4 A;  4MD8 A;  2DE5 A;  1RQF A;  1TWF I;  3GKQ A;  4RVD A;  3Q87 A;  1VQK 1;  1I6H I;  2V8K A;  3NDJ A;  1P9N A;  1LQL A;  5T64 A;  3I07 A;  4AYB A;  1ML8 A;  2R92 I;  4A3M I;  5A2Q b;  1KD1 1;  3G6E Z;  3MON A;  2VUG A;  1VQ4 1;  3GTO I;  1VQ9 1;  1X3Z A;  2YAD A;  2F4M A;  3EER A;  2IZ3 A;  1YIJ 1;  4A3G I;  3QWU A;  4NBH A;  3TE5 B;  2P3Y A;  4A3F I;  3CCM Z;  4QTU A;  3S1Q I;  4DQY B;  3J80 b;  3GTJ I;  3CME Z;  2JA8 I;  3CPW Y;  2LFU A;  3HOX I;  2QRC B;  2QRD B;  5D1O A;  1K73 1;  5D1P A;  5C3E I;  3EED A;  3CPW Z;  4RV9 A;  4RS4 A;  3J81 b;  1VQP 1;  2QA4 Z;  2R93 I;  1TWA I;  1VQ4 Z;  1WII A;  2GTI A;  2GTH A;  4BY1 I;  3PO2 I;  2E9H A;  3CCL 1;  2J6A A;  3CCE 1;  4A3E I;  3GTL I;  2F4O A;  1ZB9 A;  4MON A;  3F3F C;  1NP6 A;  4A3C I;  5CM2 M;  3I55 Z;  3G71 Z;  3VMG A;  3CC4 Z;  3I4M I;  4MXU A;  3U50 C;  2JA5 I;  2H85 A;  3HOU I;  3IFU A;  3CCJ 1;  1K8A 2;  4E2X A;  4E2Y A;  2RPR A;  1X0T A;  2PM9 A;  3CC2 1;  4A3K I;  3I4N I;  3S15 I;  4MD9 A;  3G4S 1;  5LL6 f;  1YJN Z;  1JJ2 Y;  4NBC A;  5C4J I;  1JJ2 Z;  2HF1 A;  1TWG I;  1ZH1 A;  3BG1 B;  1K8A 1;  3M3Y I;  3CC7 1;  2O53 A;  2ZAE B;  1S72 1;  4A3L I;  4NBG A;  3IX0 A;  4RVF A;  4S1T A;  4CL1 A;  1YHQ Z;  1QVF Y;  2QEX Z;  2JS4 A;  2KPI A;  1L1O C;  1VQN 1;  4A93 I;  1YJW Z;  1QVF Z;  1TWH I;  1SFO I;  1JWH C;  2W03 A;  1DL6 A;  3S2D I;  2PMZ A;  1K9M 2;  1YI2 1;  1VQ7 Z;  2RBL A;  1VQ5 1;  4HH4 A;  4MH4 A;  1M90 2;  1X3W A;  2OZK A;  3KIF A;  3CC7 Z;  2OTL Z;  3BG0 B;  1Z02 A;  1QVG Z;  2QR1 B;  4RVG A;  4BY7 I;  1Q82 2;  4A3I I;  3CCQ 1;  4EWC A;  2Y0S A;  4DGL A;  1S7M A;  1K9M 1;  1VQO 1;  1VQK Z;  2JA7 I;  3S1N I;  4QTT A;  2DE6 A;  1M90 1;  3P5J B;  2NVQ I;  3CXC Y;  4BBR I;  1USP B;  2JUB A;  2JNY A;  2WB1 A;  1YIT 1;  3CXC Z;  1VQ9 Z;  2OOX B;  1Q82 1;  2YU9 I;  2RHB A;  3CQZ I;  5FLX b;  3FKI I;  1YIJ Z;  4DK1 A;  3CCU 1;  4NB8 A;  3K7A I;  3GTQ I;  1RLY A;  3VTN A;  1VQM 1;  5IT9 b;  1NUI A;  2NVY I;  3CCQ Z;  1W2B Y;  1YJ9 1;  1Q81 2;  1KRL A;  2R6M A;  1VQ6 1;  1VQO Z;  1W2B Z;  1Z01 A;  2E2I I;  1N2F A;  3FQM A;  3HOY I;  2E2J I;  2O4H A;  3D9X A;  4Y52 I;  3J80 f;  1VQP Z;  3CMA 1;  3CCR 1;  3CCL Z;  1RO4 A;  1YUK A;  1Q81 1;  2P28 A;  5IP9 I;  1RO2 A;  3CCU Z;  2QKD A;  3CCE Z;  3HOZ I;  4A3J I;  3PO3 I;  3HOV I;  4NBA A;  3J81 f;  1K83 I;  2GU2 A;  1WW9 A;  1YJ9 Z;  4MD7 A;  2W04 A;  1R9T I;  2OTJ 1;  1TFI A;  4E31 A;  5AN9 F;  4MRI A;  3GTG I;  3G6E 1;  5C44 I;  2QLV B;  1NJI 2;  3MZK B;  2JMO A;  1KC8 2;  1M1K 2;  3CCJ Z;  1TWC I;  3CMA Z;  4NBF A;  3CC2 Z;  1I3Q I;  2E2H I;  2Q51 A;  1KD1 2;  2NVX I;  3G4S Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...