1KQSY

The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title A pre-translocational intermediate in protein synthesis observed in crystals of enzymatically active 50S subunits.
pubmed rcsb
molecule tags Ribosome
total genus 13
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2002-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1kqsY00
1VQ51 1M902 1VQ5Z 1S721 1K9M2 1KQSZ 3CCJ1 1S72Z 1K8A1 3CCJZ 1Q811 1VQK1 3CCR1 3OW2Z 2QA41 2QA4Z 1Q822 1YIT1 3CC21 1YITZ 3CC2Z 1M1K1 1YJ91 1YJ9Z 1QVFY 1NJI1 1YJNZ 1VQL1 3G6E1 3G6EZ 1VQ81 1VQ8Z 2OTJ1 1VQN1 2OTJZ 1VQNZ 2QEX1 3CMA1 2QEXZ 3CC41 1Q861 1VQ4Z 3CXCZ 3CD61 3CD6Z 1M901 1YIJ1 1YIJZ 1K9M1 2OTLZ 3CPWY 1VQO1 1N8R2 1VQOZ 1KD12 3CCQ1 3CCQZ 3I561 3I56Z 1YHQZ 1Q821 1JJ2Y 1QVFZ 1YJN1 1K732 3I551 3I55Z 1W2BY 3CCU1 3CCUZ 1VQ71 1VQ7Z 1VQ6Z 1Q7Y2 1VQ41 3CME1 3CMEZ 3CPWZ 2OTL1 3OW2Y 1N8R1 1VQP1 3CC71 1VQPZ 3CC7Z 1KD11 3CCLZ 1YHQ1 1JJ2Z 3CCVZ 1QVGY 1K731 1W2BZ 1VQM1 1VQMZ 1YJW1 1YJWZ 1VQ61 1KC82 1Q7Y1 3G711 3G71Z 1K8A2 1KQSY 3CCE1 1Q812 1VQKZ 3CCEZ 3CCRZ 1YI21 1YI2Z 3G4S1 3G4SZ 1M1K2 3CCL1 3CCM1 3CCMZ 1VQ91 1NJI2 1VQ9Z 3CCS1 1VQLZ 3CCSZ 3CCV1 1QVGZ 3CMAZ 1Q862 3CC4Z 1KC81 3CXCY
chains in the Genus database with same CATH superfamily
1TWHI 1QF8A 1M902 3M3YI 1K9M2 3CCJ1 3CCJZ 3GTGI 3NFZA 2JA6I 1VLAA 3CCR1 2QA41 2QA4Z 1KRLA 4MD9A 4RVDA 1M1K1 2LEXA 3HOYI 4NBCA 5IP7I 2O53A 1NJI1 2HU9A 2WB1A 1VQ81 1VQ8Z 2VF1A 5FLXb 2QEX1 3CMA1 3MZLB 2QEXZ 1Q861 3HOWI 3VMIA 3NDJA 1M901 4X6AI 1K9M1 1FDIA 2WAQA 3CPWY 1QYPA 4E2YA 4BXXI 3I561 3GCFA 3I56Z 1K83I 3GTOI 1I50I 5C4XI 2E2HI 4AYBA 1K732 3I551 3J80b 3I55Z 4A3KI 4MXUA 1TWFI 1VQ6Z 2NVYI 3GTLI 2R7ZI 4E2XA 2VUGA 3EERA 1VQ41 3PO3I 3NH4A 3J7A4 4QTUA 2OTL1 2W03A 4BY7I 2VPYA 1ZB8A 5LL6f 5AN9F 3CCLZ 1YHQ1 2VPZA 3TDHB 2NVXI 4TNUA 1Z01A 2VPXA 1PFTA 1QVGY 1K731 1W2BZ 3BG0B 1YJW1 1YJWZ 2I3CA 2GU2A 3MZKB 2QRCB 3J81b 1K8A2 1TWGI 4EWCA 3S1NI 1Q812 1VQKZ 3JAMb 2R92I 4A3DI 1Y1WI 3TE5B 3G4S1 4A3MI 3G4SZ 2R93I 2QR1B 2JNYA 3I07A 1VQLZ 3CCV1 5IT9b 2NAPA 4E30A 2E7ZA 1K8A1 1TWCI 2JS4A 1Q811 3OW2Z 1WCMI 1RLYA 3GTMI 1YJ91 1L1OC 1YJ9Z 3GTJI 1X3WA 1YJNZ 2E2II 3GKQA 4RVHA 1JWHC 2P28A 1Q16A 3CXCZ 4NBDA 3CD61 3CD6Z 2QREB 1YIJ1 3P5JB 1YIJZ 1USPB 3S14I 3NH5A 1VQO1 1N8R2 1VQOZ 4NBGA 1TFIA 1LQLA 3KIHA 5T67A 3NH8A 2RPRA 3FKII 5D1PA 3CQZI 2P3YA 1JJ2Y 2PM9A 1USPA 4DGLA 4A3II 1QXFA 4A3FI 3CCU1 3HOZI 3CCUZ 3S2DI 1ZH1A 1FDOA 4E2WA 4MD8A 2F4OA 5C44I 5T64A 4QTTA 1NUIA 2E2JI 3CPWZ 2OZKA 1N8R1 4MRIA 3VMHA 1R9TI 2V8KA 3F3PC 2LFUA 2RT9A 2JA7I 3GTPI 1VQ61 5A2Qf 5A2Qb 1WIIA 4RV9A 4S1TA 2YADA 2GTHA 1KQSY 1TWAI 5T6BA 1DL6A 3CCL1 1I6HI 4MH4A 3F3FC 2M6NA 2EGTA 3U50C 1SFOI 1ZB9A 3FQMA 1QVGZ 2KI7B 3CC4Z 2R6MA 4E33A 3QWUA 2IZ4A 2Q4ZA 1S721 1S72Z 1VQK1 2PMZA 2V45A 2RBLA 1YIT1 3CC21 1YITZ 3CC2Z 2QKDA 2LIYA 4E2ZA 3PO3S 1WW9A 1QVFY 2V8IA 2H85A 1Y1VI 2K3RA 3NDIA 3RZOI 2JIQA 1VQL1 3G6E1 3G6EZ 4A93I 4MD7A 3I4NI 3MONA 3D6WA 3VB9A 1N2FA 2JUBA 2QRDB 3VTNA 3CCQ1 1RNIA 3CCQZ 5C3EI 2BJOA 2DE5A 2O4HA 4A3CI 4RVGA 1Y8CA 1WZNA 3D2LA 1YJN1 1VQ71 1VQ7Z 5C4JI 3M4OI 1ML8A 4MONA 3S17I 4A3EI 3EEDA 3CME1 3CMEZ 2E9HA 3T4NB 3OW2Y 1AA6A 1VQP1 4BY1I 3CC71 1VQPZ 3CC7Z 4NB9A 4E31A 4A3JI 1JJ2Z 2B63I 4NBEA 4NFRA 1VQM1 1VQMZ 3GTMS 2W04A 4RS4A 2JMOA 1KC82 2IV2X 2NVTI 4XX2A 4HGZA 4A3BI 4NBHA 2AKLA 3IF8A 3CCRZ 2V3VA 1YI21 1YI2Z 3HOUI 4E32A 2VUMI 1RO4A 3H0GI 2GTIA 4NB8A 3CCM1 3CCMZ 1VQ91 1VQ9Z 1YUKA 5FLXf 1RO0A 1NP6A 2ZAEB 2M48A 3PO2I 2NVQI 1S7MA 2Y0SA 3CMAZ 2G2KA 1KC81 1VQ51 1VQ5Z 3LUSA 1KQSZ 2J6AA 2YU9I 3S1MI 2HF1A 1Q822 4NBFA 2Q51A 5D1OB 1I3QI 4HGYA 3J80f 3FQQA 1Z02A 2K5RA 2OTJ1 1VQN1 2OTJZ 1VQNZ 2JA5I 5D1OA 3CC41 1VQ4Z 2JIPA 3HKZA 2JIMA 2DE7A 1WJ2A 4NBAA 2OTLZ 1X3ZA 2JIRA 2VPWA 4RVFA 2JIOA 2AYDA 3S16I 4HH4A 1KD12 1YUAA 2F4MA 3RZDI 3D9XA 1YHQZ 1Q821 3H3VJ 1QVFZ 2IZ3A 2RHBA 4BBSI 3S1RI 3GTQI 1W2BY 3IR7A 3KIFA 2RIQA 1RO2A 3HOXI 1Q7Y2 4Y52I 3J81f 4DQYB 4A3LI 3JAMf 1Z03A 3K7AI 2JR6A 1P9NA 4NOZA 3I4MI 1KD11 4Y7NI 2PK7A 3Q87A 5IP9I 2DE6A 2QLVB 5IT9f 3CCVZ 4CL1A 3S2HI 1RQFA 3ESWA 5CM2M 3BG1B 2KPIA 1Q7Y1 4A3GI 3G711 2OOYB 3G71Z 1Y1VS 1SIWA 3CCE1 5FLMI 3CCEZ 4NH1C 4NBBA 1X0TA 3VMGA 1M1K2 1NJI2 2JA8I 3CCS1 3CCSZ 3GTKI 2OOXB 2V8JA 4BBRI 4DK1A 3S15I 3S1QI 3IFUA 3IX0A 1Q862 3HOVI 3CXCY
chains in the Genus database with same CATH topology
1TWHI 1QF8A 1M902 3M3YI 1K9M2 3CCJ1 3CCJZ 3GTGI 3NFZA 2JA6I 1VLAA 3CCR1 2QA41 2QA4Z 1KRLA 4MD9A 4RVDA 1M1K1 3HOYI 4NBCA 5IP7I 2O53A 1NJI1 2HU9A 2WB1A 1VQ81 1VQ8Z 2VF1A 5FLXb 2QEX1 3CMA1 3MZLB 2QEXZ 1Q861 3HOWI 3VMIA 3NDJA 1M901 4X6AI 1K9M1 2WAQA 3CPWY 1QYPA 4E2YA 4BXXI 3I561 3GCFA 3I56Z 1K83I 3GTOI 1I50I 5C4XI 2E2HI 4AYBA 1K732 3I551 3J80b 3I55Z 4A3KI 4MXUA 1TWFI 1VQ6Z 2NVYI 3GTLI 2R7ZI 4E2XA 2VUGA 3EERA 1VQ41 3PO3I 3NH4A 3J7A4 4QTUA 2OTL1 2W03A 4BY7I 1ZB8A 5LL6f 5AN9F 3CCLZ 1YHQ1 3TDHB 2NVXI 4TNUA 1Z01A 1PFTA 1QVGY 1K731 1W2BZ 3BG0B 1YJW1 1YJWZ 2I3CA 2GU2A 3MZKB 2QRCB 3J81b 1K8A2 1TWGI 4EWCA 3S1NI 1Q812 1VQKZ 3JAMb 2R92I 4A3DI 1Y1WI 3TE5B 3G4S1 4A3MI 3G4SZ 2R93I 2QR1B 2JNYA 3I07A 1VQLZ 3CCV1 5IT9b 4E30A 1K8A1 1TWCI 2JS4A 1Q811 3OW2Z 1WCMI 1RLYA 3GTMI 1YJ91 1L1OC 1YJ9Z 3GTJI 1X3WA 1YJNZ 2E2II 3GKQA 4RVHA 1JWHC 2P28A 3CXCZ 4NBDA 3CD61 3CD6Z 2QREB 1YIJ1 3P5JB 1YIJZ 1USPB 3S14I 3NH5A 1VQO1 1N8R2 1VQOZ 4NBGA 1TFIA 1LQLA 3KIHA 5T67A 3NH8A 2RPRA 3FKII 5D1PA 3CQZI 2P3YA 1JJ2Y 2PM9A 1USPA 4DGLA 4A3II 4A3FI 3CCU1 3HOZI 3CCUZ 3S2DI 1ZH1A 4E2WA 4MD8A 2F4OA 5C44I 5T64A 4QTTA 1NUIA 2E2JI 3CPWZ 2OZKA 1N8R1 4MRIA 3VMHA 1R9TI 2V8KA 3F3PC 2LFUA 2RT9A 2JA7I 3GTPI 1VQ61 5A2Qf 5A2Qb 1WIIA 4RV9A 4S1TA 2YADA 2GTHA 1KQSY 1TWAI 5T6BA 1DL6A 3CCL1 1I6HI 4MH4A 3F3FC 2M6NA 2EGTA 3U50C 1SFOI 1ZB9A 3FQMA 1QVGZ 2KI7B 3CC4Z 2R6MA 4E33A 3QWUA 2IZ4A 2Q4ZA 1S721 1S72Z 1VQK1 2PMZA 2RBLA 1YIT1 3CC21 1YITZ 3CC2Z 2QKDA 2LIYA 4E2ZA 3PO3S 1WW9A 1QVFY 2V8IA 2H85A 1Y1VI 2K3RA 3NDIA 3RZOI 1VQL1 3G6E1 3G6EZ 4A93I 4MD7A 3I4NI 3MONA 3D6WA 3VB9A 1N2FA 2JUBA 2QRDB 3VTNA 3CCQ1 1RNIA 3CCQZ 5C3EI 2BJOA 2DE5A 2O4HA 4A3CI 4RVGA 1YJN1 1VQ71 1VQ7Z 5C4JI 3M4OI 1ML8A 4MONA 3S17I 4A3EI 3EEDA 3CME1 3CMEZ 2E9HA 3T4NB 3OW2Y 1VQP1 4BY1I 3CC71 1VQPZ 3CC7Z 4NB9A 4E31A 4A3JI 1JJ2Z 2B63I 4NBEA 4NFRA 1VQM1 1VQMZ 3GTMS 2W04A 4RS4A 2JMOA 1KC82 2NVTI 4XX2A 4HGZA 4A3BI 4NBHA 2AKLA 3IF8A 3CCRZ 1YI21 1YI2Z 3HOUI 4E32A 2VUMI 1RO4A 3H0GI 2GTIA 4NB8A 3CCM1 3CCMZ 1VQ91 1VQ9Z 1YUKA 5FLXf 1RO0A 1NP6A 2ZAEB 2M48A 3PO2I 2NVQI 1S7MA 2Y0SA 3CMAZ 2G2KA 1KC81 1VQ51 1VQ5Z 3LUSA 1KQSZ 2J6AA 2YU9I 3S1MI 2HF1A 1Q822 4NBFA 2Q51A 5D1OB 1I3QI 4HGYA 3J80f 3FQQA 1Z02A 2K5RA 2OTJ1 1VQN1 2OTJZ 1VQNZ 2JA5I 5D1OA 3CC41 1VQ4Z 3HKZA 2DE7A 4NBAA 2OTLZ 1X3ZA 4RVFA 3S16I 4HH4A 1KD12 1YUAA 2F4MA 3RZDI 3D9XA 1YHQZ 1Q821 3H3VJ 1QVFZ 2IZ3A 2RHBA 4BBSI 3S1RI 3GTQI 1W2BY 3KIFA 2RIQA 1RO2A 3HOXI 1Q7Y2 4Y52I 3J81f 4DQYB 4A3LI 3JAMf 1Z03A 3K7AI 2JR6A 1P9NA 4NOZA 3I4MI 1KD11 4Y7NI 2PK7A 3Q87A 5IP9I 2DE6A 2QLVB 5IT9f 3CCVZ 4CL1A 3S2HI 1RQFA 3ESWA 5CM2M 3BG1B 2KPIA 1Q7Y1 4A3GI 3G711 2OOYB 3G71Z 1Y1VS 3CCE1 5FLMI 3CCEZ 4NH1C 4NBBA 1X0TA 3VMGA 1M1K2 1NJI2 2JA8I 3CCS1 3CCSZ 3GTKI 2OOXB 2V8JA 4BBRI 4DK1A 3S15I 3S1QI 3IFUA 3IX0A 1Q862 3HOVI 3CXCY
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ5 1;  1M90 2;  1VQ5 Z;  1S72 1;  1K9M 2;  1KQS Z;  3CCJ 1;  1S72 Z;  1K8A 1;  3CCJ Z;  1Q81 1;  1VQK 1;  3CCR 1;  3OW2 Z;  2QA4 1;  2QA4 Z;  1Q82 2;  1YIT 1;  3CC2 1;  1YIT Z;  3CC2 Z;  1M1K 1;  1YJ9 1;  1YJ9 Z;  1QVF Y;  1NJI 1;  1YJN Z;  1VQL 1;  3G6E 1;  3G6E Z;  1VQ8 1;  1VQ8 Z;  2OTJ 1;  1VQN 1;  2OTJ Z;  1VQN Z;  2QEX 1;  3CMA 1;  2QEX Z;  3CC4 1;  1Q86 1;  1VQ4 Z;  3CXC Z;  3CD6 1;  3CD6 Z;  1M90 1;  1YIJ 1;  1YIJ Z;  1K9M 1;  2OTL Z;  3CPW Y;  1VQO 1;  1N8R 2;  1VQO Z;  1KD1 2;  3CCQ 1;  3CCQ Z;  3I56 1;  3I56 Z;  1YHQ Z;  1Q82 1;  1JJ2 Y;  1QVF Z;  1YJN 1;  1K73 2;  3I55 1;  3I55 Z;  1W2B Y;  3CCU 1;  3CCU Z;  1VQ7 1;  1VQ7 Z;  1VQ6 Z;  1Q7Y 2;  1VQ4 1;  3CME 1;  3CME Z;  3CPW Z;  2OTL 1;  3OW2 Y;  1N8R 1;  1VQP 1;  3CC7 1;  1VQP Z;  3CC7 Z;  1KD1 1;  3CCL Z;  1YHQ 1;  1JJ2 Z;  3CCV Z;  1QVG Y;  1K73 1;  1W2B Z;  1VQM 1;  1VQM Z;  1YJW 1;  1YJW Z;  1VQ6 1;  1KC8 2;  1Q7Y 1;  3G71 1;  3G71 Z;  1K8A 2;  1KQS Y;  3CCE 1;  1Q81 2;  1VQK Z;  3CCE Z;  3CCR Z;  1YI2 1;  1YI2 Z;  3G4S 1;  3G4S Z;  1M1K 2;  3CCL 1;  3CCM 1;  3CCM Z;  1VQ9 1;  1NJI 2;  1VQ9 Z;  3CCS 1;  1VQL Z;  3CCS Z;  3CCV 1;  1QVG Z;  3CMA Z;  1Q86 2;  3CC4 Z;  1KC8 1;  3CXC Y; 
#chains in the Genus database with same CATH topology
 1TWH I;  1QF8 A;  1M90 2;  3M3Y I;  1K9M 2;  3CCJ 1;  3CCJ Z;  3GTG I;  3NFZ A;  2JA6 I;  1VLA A;  3CCR 1;  2QA4 1;  2QA4 Z;  1KRL A;  4MD9 A;  4RVD A;  1M1K 1;  2LEX A;  3HOY I;  4NBC A;  5IP7 I;  2O53 A;  1NJI 1;  2HU9 A;  2WB1 A;  1VQ8 1;  1VQ8 Z;  2VF1 A;  5FLX b;  2QEX 1;  3CMA 1;  3MZL B;  2QEX Z;  1Q86 1;  3HOW I;  3VMI A;  3NDJ A;  1M90 1;  4X6A I;  1K9M 1;  1FDI A;  2WAQ A;  3CPW Y;  1QYP A;  4E2Y A;  4BXX I;  3I56 1;  3GCF A;  3I56 Z;  1K83 I;  3GTO I;  1I50 I;  5C4X I;  2E2H I;  4AYB A;  1K73 2;  3I55 1;  3J80 b;  3I55 Z;  4A3K I;  4MXU A;  1TWF I;  1VQ6 Z;  2NVY I;  3GTL I;  2R7Z I;  4E2X A;  2VUG A;  3EER A;  1VQ4 1;  3PO3 I;  3NH4 A;  3J7A 4;  4QTU A;  2OTL 1;  2W03 A;  4BY7 I;  2VPY A;  1ZB8 A;  5LL6 f;  5AN9 F;  3CCL Z;  1YHQ 1;  2VPZ A;  3TDH B;  2NVX I;  4TNU A;  1Z01 A;  2VPX A;  1PFT A;  1QVG Y;  1K73 1;  1W2B Z;  3BG0 B;  1YJW 1;  1YJW Z;  2I3C A;  2GU2 A;  3MZK B;  2QRC B;  3J81 b;  1K8A 2;  1TWG I;  4EWC A;  3S1N I;  1Q81 2;  1VQK Z;  3JAM b;  2R92 I;  4A3D I;  1Y1W I;  3TE5 B;  3G4S 1;  4A3M I;  3G4S Z;  2R93 I;  2QR1 B;  2JNY A;  3I07 A;  1VQL Z;  3CCV 1;  5IT9 b;  2NAP A;  4E30 A;  2E7Z A;  1K8A 1;  1TWC I;  2JS4 A;  1Q81 1;  3OW2 Z;  1WCM I;  1RLY A;  3GTM I;  1YJ9 1;  1L1O C;  1YJ9 Z;  3GTJ I;  1X3W A;  1YJN Z;  2E2I I;  3GKQ A;  4RVH A;  1JWH C;  2P28 A;  1Q16 A;  3CXC Z;  4NBD A;  3CD6 1;  3CD6 Z;  2QRE B;  1YIJ 1;  3P5J B;  1YIJ Z;  1USP B;  3S14 I;  3NH5 A;  1VQO 1;  1N8R 2;  1VQO Z;  4NBG A;  1TFI A;  1LQL A;  3KIH A;  5T67 A;  3NH8 A;  2RPR A;  3FKI I;  5D1P A;  3CQZ I;  2P3Y A;  1JJ2 Y;  2PM9 A;  1USP A;  4DGL A;  4A3I I;  1QXF A;  4A3F I;  3CCU 1;  3HOZ I;  3CCU Z;  3S2D I;  1ZH1 A;  1FDO A;  4E2W A;  4MD8 A;  2F4O A;  5C44 I;  5T64 A;  4QTT A;  1NUI A;  2E2J I;  3CPW Z;  2OZK A;  1N8R 1;  4MRI A;  3VMH A;  1R9T I;  2V8K A;  3F3P C;  2LFU A;  2RT9 A;  2JA7 I;  3GTP I;  1VQ6 1;  5A2Q f;  5A2Q b;  1WII A;  4RV9 A;  4S1T A;  2YAD A;  2GTH A;  1KQS Y;  1TWA I;  5T6B A;  1DL6 A;  3CCL 1;  1I6H I;  4MH4 A;  3F3F C;  2M6N A;  2EGT A;  3U50 C;  1SFO I;  1ZB9 A;  3FQM A;  1QVG Z;  2KI7 B;  3CC4 Z;  2R6M A;  4E33 A;  3QWU A;  2IZ4 A;  2Q4Z A;  1S72 1;  1S72 Z;  1VQK 1;  2PMZ A;  2V45 A;  2RBL A;  1YIT 1;  3CC2 1;  1YIT Z;  3CC2 Z;  2QKD A;  2LIY A;  4E2Z A;  3PO3 S;  1WW9 A;  1QVF Y;  2V8I A;  2H85 A;  1Y1V I;  2K3R A;  3NDI A;  3RZO I;  2JIQ A;  1VQL 1;  3G6E 1;  3G6E Z;  4A93 I;  4MD7 A;  3I4N I;  3MON A;  3D6W A;  3VB9 A;  1N2F A;  2JUB A;  2QRD B;  3VTN A;  3CCQ 1;  1RNI A;  3CCQ Z;  5C3E I;  2BJO A;  2DE5 A;  2O4H A;  4A3C I;  4RVG A;  1Y8C A;  1WZN A;  3D2L A;  1YJN 1;  1VQ7 1;  1VQ7 Z;  5C4J I;  3M4O I;  1ML8 A;  4MON A;  3S17 I;  4A3E I;  3EED A;  3CME 1;  3CME Z;  2E9H A;  3T4N B;  3OW2 Y;  1AA6 A;  1VQP 1;  4BY1 I;  3CC7 1;  1VQP Z;  3CC7 Z;  4NB9 A;  4E31 A;  4A3J I;  1JJ2 Z;  2B63 I;  4NBE A;  4NFR A;  1VQM 1;  1VQM Z;  3GTM S;  2W04 A;  4RS4 A;  2JMO A;  1KC8 2;  2IV2 X;  2NVT I;  4XX2 A;  4HGZ A;  4A3B I;  4NBH A;  2AKL A;  3IF8 A;  3CCR Z;  2V3V A;  1YI2 1;  1YI2 Z;  3HOU I;  4E32 A;  2VUM I;  1RO4 A;  3H0G I;  2GTI A;  4NB8 A;  3CCM 1;  3CCM Z;  1VQ9 1;  1VQ9 Z;  1YUK A;  5FLX f;  1RO0 A;  1NP6 A;  2ZAE B;  2M48 A;  3PO2 I;  2NVQ I;  1S7M A;  2Y0S A;  3CMA Z;  2G2K A;  1KC8 1;  1VQ5 1;  1VQ5 Z;  3LUS A;  1KQS Z;  2J6A A;  2YU9 I;  3S1M I;  2HF1 A;  1Q82 2;  4NBF A;  2Q51 A;  5D1O B;  1I3Q I;  4HGY A;  3J80 f;  3FQQ A;  1Z02 A;  2K5R A;  2OTJ 1;  1VQN 1;  2OTJ Z;  1VQN Z;  2JA5 I;  5D1O A;  3CC4 1;  1VQ4 Z;  2JIP A;  3HKZ A;  2JIM A;  2DE7 A;  1WJ2 A;  4NBA A;  2OTL Z;  1X3Z A;  2JIR A;  2VPW A;  4RVF A;  2JIO A;  2AYD A;  3S16 I;  4HH4 A;  1KD1 2;  1YUA A;  2F4M A;  3RZD I;  3D9X A;  1YHQ Z;  1Q82 1;  3H3V J;  1QVF Z;  2IZ3 A;  2RHB A;  4BBS I;  3S1R I;  3GTQ I;  1W2B Y;  3IR7 A;  3KIF A;  2RIQ A;  1RO2 A;  3HOX I;  1Q7Y 2;  4Y52 I;  3J81 f;  4DQY B;  4A3L I;  3JAM f;  1Z03 A;  3K7A I;  2JR6 A;  1P9N A;  4NOZ A;  3I4M I;  1KD1 1;  4Y7N I;  2PK7 A;  3Q87 A;  5IP9 I;  2DE6 A;  2QLV B;  5IT9 f;  3CCV Z;  4CL1 A;  3S2H I;  1RQF A;  3ESW A;  5CM2 M;  3BG1 B;  2KPI A;  1Q7Y 1;  4A3G I;  3G71 1;  2OOY B;  3G71 Z;  1Y1V S;  1SIW A;  3CCE 1;  5FLM I;  3CCE Z;  4NH1 C;  4NBB A;  1X0T A;  3VMG A;  1M1K 2;  1NJI 2;  2JA8 I;  3CCS 1;  3CCS Z;  3GTK I;  2OOX B;  2V8J A;  4BBR I;  4DK1 A;  3S15 I;  3S1Q I;  3IFU A;  3IX0 A;  1Q86 2;  3HOV I;  3CXC Y; 
#chains in the Genus database with same CATH homology
 1TWH I;  1QF8 A;  1M90 2;  3M3Y I;  1K9M 2;  3CCJ 1;  3CCJ Z;  3GTG I;  3NFZ A;  2JA6 I;  1VLA A;  3CCR 1;  2QA4 1;  2QA4 Z;  1KRL A;  4MD9 A;  4RVD A;  1M1K 1;  3HOY I;  4NBC A;  5IP7 I;  2O53 A;  1NJI 1;  2HU9 A;  2WB1 A;  1VQ8 1;  1VQ8 Z;  2VF1 A;  5FLX b;  2QEX 1;  3CMA 1;  3MZL B;  2QEX Z;  1Q86 1;  3HOW I;  3VMI A;  3NDJ A;  1M90 1;  4X6A I;  1K9M 1;  2WAQ A;  3CPW Y;  1QYP A;  4E2Y A;  4BXX I;  3I56 1;  3GCF A;  3I56 Z;  1K83 I;  3GTO I;  1I50 I;  5C4X I;  2E2H I;  4AYB A;  1K73 2;  3I55 1;  3J80 b;  3I55 Z;  4A3K I;  4MXU A;  1TWF I;  1VQ6 Z;  2NVY I;  3GTL I;  2R7Z I;  4E2X A;  2VUG A;  3EER A;  1VQ4 1;  3PO3 I;  3NH4 A;  3J7A 4;  4QTU A;  2OTL 1;  2W03 A;  4BY7 I;  1ZB8 A;  5LL6 f;  5AN9 F;  3CCL Z;  1YHQ 1;  3TDH B;  2NVX I;  4TNU A;  1Z01 A;  1PFT A;  1QVG Y;  1K73 1;  1W2B Z;  3BG0 B;  1YJW 1;  1YJW Z;  2I3C A;  2GU2 A;  3MZK B;  2QRC B;  3J81 b;  1K8A 2;  1TWG I;  4EWC A;  3S1N I;  1Q81 2;  1VQK Z;  3JAM b;  2R92 I;  4A3D I;  1Y1W I;  3TE5 B;  3G4S 1;  4A3M I;  3G4S Z;  2R93 I;  2QR1 B;  2JNY A;  3I07 A;  1VQL Z;  3CCV 1;  5IT9 b;  4E30 A;  1K8A 1;  1TWC I;  2JS4 A;  1Q81 1;  3OW2 Z;  1WCM I;  1RLY A;  3GTM I;  1YJ9 1;  1L1O C;  1YJ9 Z;  3GTJ I;  1X3W A;  1YJN Z;  2E2I I;  3GKQ A;  4RVH A;  1JWH C;  2P28 A;  3CXC Z;  4NBD A;  3CD6 1;  3CD6 Z;  2QRE B;  1YIJ 1;  3P5J B;  1YIJ Z;  1USP B;  3S14 I;  3NH5 A;  1VQO 1;  1N8R 2;  1VQO Z;  4NBG A;  1TFI A;  1LQL A;  3KIH A;  5T67 A;  3NH8 A;  2RPR A;  3FKI I;  5D1P A;  3CQZ I;  2P3Y A;  1JJ2 Y;  2PM9 A;  1USP A;  4DGL A;  4A3I I;  4A3F I;  3CCU 1;  3HOZ I;  3CCU Z;  3S2D I;  1ZH1 A;  4E2W A;  4MD8 A;  2F4O A;  5C44 I;  5T64 A;  4QTT A;  1NUI A;  2E2J I;  3CPW Z;  2OZK A;  1N8R 1;  4MRI A;  3VMH A;  1R9T I;  2V8K A;  3F3P C;  2LFU A;  2RT9 A;  2JA7 I;  3GTP I;  1VQ6 1;  5A2Q f;  5A2Q b;  1WII A;  4RV9 A;  4S1T A;  2YAD A;  2GTH A;  1KQS Y;  1TWA I;  5T6B A;  1DL6 A;  3CCL 1;  1I6H I;  4MH4 A;  3F3F C;  2M6N A;  2EGT A;  3U50 C;  1SFO I;  1ZB9 A;  3FQM A;  1QVG Z;  2KI7 B;  3CC4 Z;  2R6M A;  4E33 A;  3QWU A;  2IZ4 A;  2Q4Z A;  1S72 1;  1S72 Z;  1VQK 1;  2PMZ A;  2RBL A;  1YIT 1;  3CC2 1;  1YIT Z;  3CC2 Z;  2QKD A;  2LIY A;  4E2Z A;  3PO3 S;  1WW9 A;  1QVF Y;  2V8I A;  2H85 A;  1Y1V I;  2K3R A;  3NDI A;  3RZO I;  1VQL 1;  3G6E 1;  3G6E Z;  4A93 I;  4MD7 A;  3I4N I;  3MON A;  3D6W A;  3VB9 A;  1N2F A;  2JUB A;  2QRD B;  3VTN A;  3CCQ 1;  1RNI A;  3CCQ Z;  5C3E I;  2BJO A;  2DE5 A;  2O4H A;  4A3C I;  4RVG A;  1YJN 1;  1VQ7 1;  1VQ7 Z;  5C4J I;  3M4O I;  1ML8 A;  4MON A;  3S17 I;  4A3E I;  3EED A;  3CME 1;  3CME Z;  2E9H A;  3T4N B;  3OW2 Y;  1VQP 1;  4BY1 I;  3CC7 1;  1VQP Z;  3CC7 Z;  4NB9 A;  4E31 A;  4A3J I;  1JJ2 Z;  2B63 I;  4NBE A;  4NFR A;  1VQM 1;  1VQM Z;  3GTM S;  2W04 A;  4RS4 A;  2JMO A;  1KC8 2;  2NVT I;  4XX2 A;  4HGZ A;  4A3B I;  4NBH A;  2AKL A;  3IF8 A;  3CCR Z;  1YI2 1;  1YI2 Z;  3HOU I;  4E32 A;  2VUM I;  1RO4 A;  3H0G I;  2GTI A;  4NB8 A;  3CCM 1;  3CCM Z;  1VQ9 1;  1VQ9 Z;  1YUK A;  5FLX f;  1RO0 A;  1NP6 A;  2ZAE B;  2M48 A;  3PO2 I;  2NVQ I;  1S7M A;  2Y0S A;  3CMA Z;  2G2K A;  1KC8 1;  1VQ5 1;  1VQ5 Z;  3LUS A;  1KQS Z;  2J6A A;  2YU9 I;  3S1M I;  2HF1 A;  1Q82 2;  4NBF A;  2Q51 A;  5D1O B;  1I3Q I;  4HGY A;  3J80 f;  3FQQ A;  1Z02 A;  2K5R A;  2OTJ 1;  1VQN 1;  2OTJ Z;  1VQN Z;  2JA5 I;  5D1O A;  3CC4 1;  1VQ4 Z;  3HKZ A;  2DE7 A;  4NBA A;  2OTL Z;  1X3Z A;  4RVF A;  3S16 I;  4HH4 A;  1KD1 2;  1YUA A;  2F4M A;  3RZD I;  3D9X A;  1YHQ Z;  1Q82 1;  3H3V J;  1QVF Z;  2IZ3 A;  2RHB A;  4BBS I;  3S1R I;  3GTQ I;  1W2B Y;  3KIF A;  2RIQ A;  1RO2 A;  3HOX I;  1Q7Y 2;  4Y52 I;  3J81 f;  4DQY B;  4A3L I;  3JAM f;  1Z03 A;  3K7A I;  2JR6 A;  1P9N A;  4NOZ A;  3I4M I;  1KD1 1;  4Y7N I;  2PK7 A;  3Q87 A;  5IP9 I;  2DE6 A;  2QLV B;  5IT9 f;  3CCV Z;  4CL1 A;  3S2H I;  1RQF A;  3ESW A;  5CM2 M;  3BG1 B;  2KPI A;  1Q7Y 1;  4A3G I;  3G71 1;  2OOY B;  3G71 Z;  1Y1V S;  3CCE 1;  5FLM I;  3CCE Z;  4NH1 C;  4NBB A;  1X0T A;  3VMG A;  1M1K 2;  1NJI 2;  2JA8 I;  3CCS 1;  3CCS Z;  3GTK I;  2OOX B;  2V8J A;  4BBR I;  4DK1 A;  3S15 I;  3S1Q I;  3IFU A;  3IX0 A;  1Q86 2;  3HOV I;  3CXC Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...