1KQSY

The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
b'RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title A pre-translocational intermediate in protein synthesis observed in crystals of enzymatically active 50S subunits.
pubmed rcsb
molecule tags Ribosome
total genus 13
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2002-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1kqsY00
1K9M2 3G711 3CCJ1 3CC71 1VQK1 3CC41 1M902 1K9M1 1NJI1 1KC82 3CCLZ 3CPWY 1VQN1 1VQ41 1QVFY 3I56Z 3CC21 1QVFZ 3CMEZ 3CCVZ 3CCRZ 3CCL1 1VQOZ 1Q861 3I561 1VQ9Z 3CME1 1W2BZ 1VQPZ 2QEX1 3CCV1 1VQ7Z 3CC4Z 3CCM1 3G4SZ 1VQO1 1VQ4Z 3CCEZ 3CC2Z 3CMAZ 1VQ91 1VQP1 1NJI2 1VQ71 3G4S1 3CCE1 1KD12 1Q812 1KQSZ 3CMA1 2QEXZ 1Q811 1QVGY 1KD11 3CCMZ 1JJ2Y 1Q862 1QVGZ 1W2BY 1S721 1JJ2Z 3CCSZ 1K8A1 3I55Z 1VQLZ 3CCS1 2OTJ1 1KQSY 1VQMZ 3CCQZ 1VQ8Z 1YJWZ 1S72Z 3CCUZ 1K731 3I551 2QA41 1VQL1 1N8R2 1YJ9Z 1Q7Y2 1M1K1 1VQ61 3OW2Y 3CD6Z 1N8R1 1Q7Y1 1VQ5Z 1VQM1 3CCQ1 3OW2Z 1VQ81 3G6EZ 1YJW1 1K8A2 3CCU1 1YJ91 1Q821 3CD61 1YHQ1 1VQ51 2OTJZ 1YJNZ 3G6E1 1M901 2QA4Z 1KC81 1VQ6Z 3CPWZ 1YITZ 1YI2Z 1K732 1YJN1 3CXCY 1M1K2 3CXCZ 1YIJZ 1YIT1 2OTLZ 1YHQZ 3G71Z 3CCJZ 3CC7Z 1YI21 1VQKZ 3CCR1 1Q822 1VQNZ 1YIJ1 2OTL1
chains in the Genus database with same CATH superfamily
1K9M2 1VQK1 3CPWY 1VQN1 2V8JA 2WB1A 2E7ZA 3K7AI 1ZB8A 5CM2M 3CCL1 3VMHA 2BJOA 3HOYI 3IFUA 2JIMA 3NH5A 1Q861 3I561 1RO2A 3CME1 2QR1B 1VQ7Z 3MZKB 3CCEZ 3S1NI 2W04A 1TWAI 3HOWI 3H0GI 2R7ZI 5A2Qf 3M3YI 1Y1WI 1KQSZ 2DE7A 1KD11 1Q811 1WIIA 1X3WA 3I4NI 3GTKI 4E2XA 1QVGZ 1JJ2Z 2NVQI 4A3JI 2V3VA 1TWCI 2R6MA 2JR6A 1QYPA 2Q51A 4HGZA 3HKZA 2OTJ1 5D1OA 2K3RA 1S72Z 2RT9A 1VQL1 2VUMI 1VQ61 4NBBA 1RO4A 3CD6Z 2IV2X 1VQM1 3CCQ1 3OW2Z 1YJW1 2JA6I 2RHBA 4BY7I 5FLXf 2JA8I 3S14I 3VMGA 1Q821 3HOVI 3G6E1 1TWHI 2AYDA 3CPWZ 2V8IA 2EGTA 4BY1I 3J80b 3GCFA 1K732 1M1K2 3S1QI 4CL1A 3J80f 1YIJZ 2E2II 1FDIA 5T6BA 3GKQA 1VQKZ 4MD7A 3CCR1 4A3DI 1SIWA 1VQNZ 4NBCA 1K83I 2V8KA 3IF8A 2H85A 2OTL1 3S17I 2QRCB 3CCJ1 3FQQA 3CC41 1M902 2ZAEB 3S1RI 2VUGA 3CCLZ 2NVXI 1VQ41 2LIYA 4E32A 3I56Z 1QVFZ 3CMEZ 4A3GI 2NVTI 1Y1VI 1S7MA 2E9HA 1I50I 1Y1VS 4S1TA 2KPIA 2E2HI 3QWUA 2V45A 3S16I 4X6AI 3CCV1 5C3EI 3T4NB 4MRIA 3GTOI 4NH1C 3H3VJ 4E2YA 3CC2Z 1VQP1 1NJI2 1TWFI 4A3MI 3NDIA 3GTQI 3LUSA 1KD12 2NAPA 1Q812 3I07A 2QEXZ 3CCMZ 3NDJA 1W2BY 4RVDA 3GTMI 2OZKA 2M6NA 3F3FC 4A3LI 3GTMS 4A3BI 1K8A1 1X0TA 5A2Qb 2M48A 2VPYA 1VQLZ 1WJ2A 3CCS1 2PK7A 3VB9A 3TE5B 4MH4A 1VQMZ 2YADA 3CCQZ 1YJWZ 2K5RA 2QA41 3VMIA 5C4JI 1N8R1 4NB9A 1AA6A 1VQ81 2KI7B 5C44I 3G6EZ 3EERA 2B63I 3GTGI 1YJ91 5C4XI 2GTHA 2PM9A 4NBEA 3NH4A 4A3CI 3J81f 2JIOA 1USPA 1YJN1 3CXCY 2GTIA 1QXFA 4NBAA 3ESWA 1QF8A 3NH8A 5FLXb 1YIT1 2OTLZ 1TFIA 3CCJZ 1YHQZ 4HH4A 4E2WA 2AKLA 2LEXA 3S15I 3PO3I 3PO3S 3D2LA 3TDHB 3RZDI 1KC82 1RQFA 1P9NA 3JAMf 3CCVZ 1N2FA 4MD9A 4E33A 1W2BZ 1VQPZ 2JIRA 1Z02A 4A3KI 3F3PC 1VQO1 2RPRA 2VPXA 1PFTA 4QTUA 1VQ91 1ML8A 1LQLA 1YUKA 2Y0SA 3MONA 4MONA 2NVYI 3G4S1 2G2KA 1L1OC 2HF1A 3CMA1 4A3EI 2OOXB 2WAQA 1QVGY 1JJ2Y 4AYBA 1Q862 1I6HI 1S721 3D9XA 1RLYA 2QLVB 5LL6f 5T64A 3HOZI 3GTPI 4NB8A 3CCSZ 3IR7A 2JMOA 5T67A 1KRLA 4Y7NI 4BBRI 3GTJI 3S2HI 2HU9A 5D1PA 1Z01A 1VQ8Z 3VTNA 1K731 1NUIA 3I551 1N8R2 1YJ9Z 4E31A 1M1K1 4BBSI 3OW2Y 3GTLI 2RBLA 1Q7Y1 2IZ4A 3P5JB 2F4OA 5D1OB 1WCMI 3CCU1 4BXXI 2JUBA 3J7A4 2P3YA 2VF1A 2OTJZ 1VQ51 1YJNZ 3PO2I 5FLMI 4NOZA 3S2DI 1M901 2W03A 2QRDB 4EWCA 1VQ6Z 1I3QI 1YITZ 4MXUA 5IT9b 2O53A 4RVGA 5IT9f 1RO0A 1YI21 4E30A 4NBGA 3FKII 1JWHC 4DGLA 3S1MI 4Y52I 2JIQA 1Q822 2JS4A 2DE6A 4RV9A 3J81b 3G711 3CC71 2J6AA 3KIFA 1K9M1 1NJI1 1WW9A 1QVFY 2JA7I 1Y8CA 3I4MI 3CC21 1ZH1A 2DE5A 3CQZI 4MD8A 1TWGI 3CCRZ 1VQOZ 2JIPA 4DQYB 1VQ9Z 2YU9I 1YUAA 1WZNA 2QEX1 2I3CA 3CC4Z 3CCM1 3G4SZ 1VQ4Z 2RIQA 3BG1B 3CMAZ 2F4MA 2VPZA 1VQ71 3IX0A 3JAMb 2JNYA 1RNIA 1SFOI 2PMZA 3CCE1 3Q87A 4A3FI 4RVFA 1NP6A 4RS4A 2QKDA 4XX2A 2GU2A 4RVHA 1ZB9A 5IP7I 4NBFA 4HGYA 2IZ3A 3D6WA 4A3II 1Z03A 4NBHA 1R9TI 2O4HA 4QTTA 3RZOI 2Q4ZA 2OOYB 3I55Z 4E2ZA 3M4OI 1KQSY 2P28A 3CCUZ 1Q7Y2 3MZLB 4NBDA 1VQ5Z 2VPWA 3FQMA 2R93I 1K8A2 1X3ZA 2JA5I 3CD61 1FDOA 1YHQ1 1DL6A 3BG0B 4DK1A 5IP9I 3KIHA 4TNUA 2QA4Z 1KC81 3EEDA 1VLAA 1YI2Z 3U50C 4A93I 3NFZA 2R92I 1Q16A 2QREB 3CXCZ 3HOXI 5AN9F 2LFUA 3G71Z 3CC7Z 2E2JI 1USPB 4NFRA 3HOUI 1YIJ1
chains in the Genus database with same CATH topology
1K9M2 1VQK1 3CPWY 1VQN1 2V8JA 2WB1A 3K7AI 1ZB8A 5CM2M 3CCL1 3VMHA 2BJOA 3HOYI 3IFUA 3NH5A 1Q861 3I561 1RO2A 3CME1 2QR1B 1VQ7Z 3MZKB 3CCEZ 3S1NI 2W04A 1TWAI 3HOWI 3H0GI 2R7ZI 5A2Qf 3M3YI 1Y1WI 1KQSZ 2DE7A 1KD11 1Q811 1WIIA 1X3WA 3I4NI 3GTKI 4E2XA 1QVGZ 1JJ2Z 2NVQI 4A3JI 1TWCI 2R6MA 2JR6A 1QYPA 2Q51A 4HGZA 3HKZA 2OTJ1 5D1OA 2K3RA 1S72Z 2RT9A 1VQL1 2VUMI 1VQ61 4NBBA 1RO4A 3CD6Z 1VQM1 3CCQ1 3OW2Z 1YJW1 2JA6I 2RHBA 4BY7I 5FLXf 2JA8I 3S14I 3VMGA 1Q821 3HOVI 3G6E1 1TWHI 3CPWZ 2V8IA 2EGTA 4BY1I 3J80b 3GCFA 1K732 1M1K2 3S1QI 4CL1A 3J80f 1YIJZ 2E2II 5T6BA 3GKQA 1VQKZ 4MD7A 3CCR1 4A3DI 1VQNZ 4NBCA 1K83I 2V8KA 3IF8A 2H85A 2OTL1 3S17I 2QRCB 3CCJ1 3FQQA 3CC41 1M902 2ZAEB 3S1RI 2VUGA 3CCLZ 2NVXI 1VQ41 2LIYA 4E32A 3I56Z 1QVFZ 3CMEZ 4A3GI 2NVTI 1Y1VI 1S7MA 2E9HA 1I50I 1Y1VS 4S1TA 2KPIA 2E2HI 3QWUA 3S16I 4X6AI 3CCV1 5C3EI 3T4NB 4MRIA 3GTOI 4NH1C 3H3VJ 4E2YA 3CC2Z 1VQP1 1NJI2 1TWFI 4A3MI 3NDIA 3GTQI 3LUSA 1KD12 1Q812 3I07A 2QEXZ 3CCMZ 3NDJA 1W2BY 4RVDA 3GTMI 2OZKA 2M6NA 3F3FC 4A3LI 3GTMS 4A3BI 1K8A1 1X0TA 5A2Qb 2M48A 1VQLZ 3CCS1 2PK7A 3VB9A 3TE5B 4MH4A 1VQMZ 2YADA 3CCQZ 1YJWZ 2K5RA 2QA41 3VMIA 5C4JI 1N8R1 4NB9A 1VQ81 2KI7B 5C44I 3G6EZ 3EERA 2B63I 3GTGI 1YJ91 5C4XI 2GTHA 2PM9A 4NBEA 3NH4A 4A3CI 3J81f 1USPA 1YJN1 3CXCY 2GTIA 4NBAA 3ESWA 1QF8A 3NH8A 5FLXb 1YIT1 2OTLZ 1YHQZ 3CCJZ 1TFIA 4HH4A 4E2WA 2AKLA 3S15I 3PO3I 3PO3S 3TDHB 3RZDI 1KC82 1RQFA 1P9NA 3JAMf 3CCVZ 1N2FA 4MD9A 4E33A 1W2BZ 1VQPZ 1Z02A 4A3KI 3F3PC 1VQO1 2RPRA 1PFTA 4QTUA 1VQ91 1ML8A 1LQLA 1YUKA 2Y0SA 3MONA 4MONA 2NVYI 3G4S1 2G2KA 1L1OC 2HF1A 3CMA1 4A3EI 2OOXB 2WAQA 1QVGY 1JJ2Y 4AYBA 1Q862 1I6HI 1S721 3D9XA 1RLYA 2QLVB 5LL6f 5T64A 3HOZI 3GTPI 4NB8A 3CCSZ 2JMOA 5T67A 1KRLA 4Y7NI 4BBRI 3GTJI 3S2HI 2HU9A 5D1PA 1Z01A 1VQ8Z 3VTNA 1K731 1NUIA 3I551 1N8R2 1YJ9Z 4E31A 1M1K1 4BBSI 3OW2Y 3GTLI 2RBLA 1Q7Y1 2IZ4A 3P5JB 2F4OA 5D1OB 1WCMI 3CCU1 4BXXI 2JUBA 3J7A4 2P3YA 2VF1A 2OTJZ 1VQ51 1YJNZ 3PO2I 5FLMI 4NOZA 3S2DI 1M901 2W03A 2QRDB 4EWCA 1VQ6Z 1I3QI 1YITZ 4MXUA 5IT9b 2O53A 4RVGA 5IT9f 1RO0A 1YI21 4E30A 4NBGA 3FKII 1JWHC 4DGLA 3S1MI 4Y52I 1Q822 2JS4A 2DE6A 4RV9A 3J81b 3G711 3CC71 2J6AA 3KIFA 1K9M1 1NJI1 1WW9A 1QVFY 2JA7I 3I4MI 3CC21 1ZH1A 2DE5A 3CQZI 4MD8A 1TWGI 3CCRZ 1VQOZ 4DQYB 1VQ9Z 2YU9I 1YUAA 2QEX1 2I3CA 3CC4Z 3CCM1 3G4SZ 1VQ4Z 2RIQA 3BG1B 3CMAZ 2F4MA 1VQ71 3IX0A 3JAMb 2JNYA 1RNIA 1SFOI 2PMZA 3CCE1 3Q87A 4A3FI 4RVFA 1NP6A 4RS4A 2QKDA 4XX2A 2GU2A 4RVHA 1ZB9A 5IP7I 4NBFA 4HGYA 2IZ3A 3D6WA 4A3II 1Z03A 4NBHA 1R9TI 2O4HA 4QTTA 3RZOI 2Q4ZA 2OOYB 3I55Z 4E2ZA 3M4OI 1KQSY 2P28A 3CCUZ 1Q7Y2 3MZLB 4NBDA 1VQ5Z 3FQMA 2R93I 1K8A2 1X3ZA 2JA5I 3CD61 1YHQ1 1DL6A 3BG0B 4DK1A 5IP9I 3KIHA 4TNUA 2QA4Z 1KC81 3EEDA 1VLAA 1YI2Z 3U50C 4A93I 3NFZA 2R92I 2QREB 3CXCZ 3HOXI 5AN9F 2LFUA 3G71Z 3CC7Z 2E2JI 1USPB 4NFRA 3HOUI 1YIJ1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9M 2;  3G71 1;  3CCJ 1;  3CC7 1;  1VQK 1;  3CC4 1;  1M90 2;  1K9M 1;  1NJI 1;  1KC8 2;  3CCL Z;  3CPW Y;  1VQN 1;  1VQ4 1;  1QVF Y;  3I56 Z;  3CC2 1;  1QVF Z;  3CME Z;  3CCV Z;  3CCR Z;  3CCL 1;  1VQO Z;  1Q86 1;  3I56 1;  1VQ9 Z;  3CME 1;  1W2B Z;  1VQP Z;  2QEX 1;  3CCV 1;  1VQ7 Z;  3CC4 Z;  3CCM 1;  3G4S Z;  1VQO 1;  1VQ4 Z;  3CCE Z;  3CC2 Z;  3CMA Z;  1VQ9 1;  1VQP 1;  1NJI 2;  1VQ7 1;  3G4S 1;  3CCE 1;  1KD1 2;  1Q81 2;  1KQS Z;  3CMA 1;  2QEX Z;  1Q81 1;  1QVG Y;  1KD1 1;  3CCM Z;  1JJ2 Y;  1Q86 2;  1QVG Z;  1W2B Y;  1S72 1;  1JJ2 Z;  3CCS Z;  1K8A 1;  3I55 Z;  1VQL Z;  3CCS 1;  2OTJ 1;  1KQS Y;  1VQM Z;  3CCQ Z;  1VQ8 Z;  1YJW Z;  1S72 Z;  3CCU Z;  1K73 1;  3I55 1;  2QA4 1;  1VQL 1;  1N8R 2;  1YJ9 Z;  1Q7Y 2;  1M1K 1;  1VQ6 1;  3OW2 Y;  3CD6 Z;  1N8R 1;  1Q7Y 1;  1VQ5 Z;  1VQM 1;  3CCQ 1;  3OW2 Z;  1VQ8 1;  3G6E Z;  1YJW 1;  1K8A 2;  3CCU 1;  1YJ9 1;  1Q82 1;  3CD6 1;  1YHQ 1;  1VQ5 1;  2OTJ Z;  1YJN Z;  3G6E 1;  1M90 1;  2QA4 Z;  1KC8 1;  1VQ6 Z;  3CPW Z;  1YIT Z;  1YI2 Z;  1K73 2;  1YJN 1;  3CXC Y;  1M1K 2;  3CXC Z;  1YIJ Z;  1YIT 1;  2OTL Z;  1YHQ Z;  3G71 Z;  3CCJ Z;  3CC7 Z;  1YI2 1;  1VQK Z;  3CCR 1;  1Q82 2;  1VQN Z;  1YIJ 1;  2OTL 1; 
#chains in the Genus database with same CATH topology
 1K9M 2;  1VQK 1;  3CPW Y;  1VQN 1;  2V8J A;  2WB1 A;  2E7Z A;  3K7A I;  1ZB8 A;  5CM2 M;  3CCL 1;  3VMH A;  2BJO A;  3HOY I;  3IFU A;  2JIM A;  3NH5 A;  1Q86 1;  3I56 1;  1RO2 A;  3CME 1;  2QR1 B;  1VQ7 Z;  3MZK B;  3CCE Z;  3S1N I;  2W04 A;  1TWA I;  3HOW I;  3H0G I;  2R7Z I;  5A2Q f;  3M3Y I;  1Y1W I;  1KQS Z;  2DE7 A;  1KD1 1;  1Q81 1;  1WII A;  1X3W A;  3I4N I;  3GTK I;  4E2X A;  1QVG Z;  1JJ2 Z;  2NVQ I;  4A3J I;  2V3V A;  1TWC I;  2R6M A;  2JR6 A;  1QYP A;  2Q51 A;  4HGZ A;  3HKZ A;  2OTJ 1;  5D1O A;  2K3R A;  1S72 Z;  2RT9 A;  1VQL 1;  2VUM I;  1VQ6 1;  4NBB A;  1RO4 A;  3CD6 Z;  2IV2 X;  1VQM 1;  3CCQ 1;  3OW2 Z;  1YJW 1;  2JA6 I;  2RHB A;  4BY7 I;  5FLX f;  2JA8 I;  3S14 I;  3VMG A;  1Q82 1;  3HOV I;  3G6E 1;  1TWH I;  2AYD A;  3CPW Z;  2V8I A;  2EGT A;  4BY1 I;  3J80 b;  3GCF A;  1K73 2;  1M1K 2;  3S1Q I;  4CL1 A;  3J80 f;  1YIJ Z;  2E2I I;  1FDI A;  5T6B A;  3GKQ A;  1VQK Z;  4MD7 A;  3CCR 1;  4A3D I;  1SIW A;  1VQN Z;  4NBC A;  1K83 I;  2V8K A;  3IF8 A;  2H85 A;  2OTL 1;  3S17 I;  2QRC B;  3CCJ 1;  3FQQ A;  3CC4 1;  1M90 2;  2ZAE B;  3S1R I;  2VUG A;  3CCL Z;  2NVX I;  1VQ4 1;  2LIY A;  4E32 A;  3I56 Z;  1QVF Z;  3CME Z;  4A3G I;  2NVT I;  1Y1V I;  1S7M A;  2E9H A;  1I50 I;  1Y1V S;  4S1T A;  2KPI A;  2E2H I;  3QWU A;  2V45 A;  3S16 I;  4X6A I;  3CCV 1;  5C3E I;  3T4N B;  4MRI A;  3GTO I;  4NH1 C;  3H3V J;  4E2Y A;  3CC2 Z;  1VQP 1;  1NJI 2;  1TWF I;  4A3M I;  3NDI A;  3GTQ I;  3LUS A;  1KD1 2;  2NAP A;  1Q81 2;  3I07 A;  2QEX Z;  3CCM Z;  3NDJ A;  1W2B Y;  4RVD A;  3GTM I;  2OZK A;  2M6N A;  3F3F C;  4A3L I;  3GTM S;  4A3B I;  1K8A 1;  1X0T A;  5A2Q b;  2M48 A;  2VPY A;  1VQL Z;  1WJ2 A;  3CCS 1;  2PK7 A;  3VB9 A;  3TE5 B;  4MH4 A;  1VQM Z;  2YAD A;  3CCQ Z;  1YJW Z;  2K5R A;  2QA4 1;  3VMI A;  5C4J I;  1N8R 1;  4NB9 A;  1AA6 A;  1VQ8 1;  2KI7 B;  5C44 I;  3G6E Z;  3EER A;  2B63 I;  3GTG I;  1YJ9 1;  5C4X I;  2GTH A;  2PM9 A;  4NBE A;  3NH4 A;  4A3C I;  3J81 f;  2JIO A;  1USP A;  1YJN 1;  3CXC Y;  2GTI A;  1QXF A;  4NBA A;  3ESW A;  1QF8 A;  3NH8 A;  5FLX b;  1YIT 1;  2OTL Z;  1TFI A;  3CCJ Z;  1YHQ Z;  4HH4 A;  4E2W A;  2AKL A;  2LEX A;  3S15 I;  3PO3 I;  3PO3 S;  3D2L A;  3TDH B;  3RZD I;  1KC8 2;  1RQF A;  1P9N A;  3JAM f;  3CCV Z;  1N2F A;  4MD9 A;  4E33 A;  1W2B Z;  1VQP Z;  2JIR A;  1Z02 A;  4A3K I;  3F3P C;  1VQO 1;  2RPR A;  2VPX A;  1PFT A;  4QTU A;  1VQ9 1;  1ML8 A;  1LQL A;  1YUK A;  2Y0S A;  3MON A;  4MON A;  2NVY I;  3G4S 1;  2G2K A;  1L1O C;  2HF1 A;  3CMA 1;  4A3E I;  2OOX B;  2WAQ A;  1QVG Y;  1JJ2 Y;  4AYB A;  1Q86 2;  1I6H I;  1S72 1;  3D9X A;  1RLY A;  2QLV B;  5LL6 f;  5T64 A;  3HOZ I;  3GTP I;  4NB8 A;  3CCS Z;  3IR7 A;  2JMO A;  5T67 A;  1KRL A;  4Y7N I;  4BBR I;  3GTJ I;  3S2H I;  2HU9 A;  5D1P A;  1Z01 A;  1VQ8 Z;  3VTN A;  1K73 1;  1NUI A;  3I55 1;  1N8R 2;  1YJ9 Z;  4E31 A;  1M1K 1;  4BBS I;  3OW2 Y;  3GTL I;  2RBL A;  1Q7Y 1;  2IZ4 A;  3P5J B;  2F4O A;  5D1O B;  1WCM I;  3CCU 1;  4BXX I;  2JUB A;  3J7A 4;  2P3Y A;  2VF1 A;  2OTJ Z;  1VQ5 1;  1YJN Z;  3PO2 I;  5FLM I;  4NOZ A;  3S2D I;  1M90 1;  2W03 A;  2QRD B;  4EWC A;  1VQ6 Z;  1I3Q I;  1YIT Z;  4MXU A;  5IT9 b;  2O53 A;  4RVG A;  5IT9 f;  1RO0 A;  1YI2 1;  4E30 A;  4NBG A;  3FKI I;  1JWH C;  4DGL A;  3S1M I;  4Y52 I;  2JIQ A;  1Q82 2;  2JS4 A;  2DE6 A;  4RV9 A;  3J81 b;  3G71 1;  3CC7 1;  2J6A A;  3KIF A;  1K9M 1;  1NJI 1;  1WW9 A;  1QVF Y;  2JA7 I;  1Y8C A;  3I4M I;  3CC2 1;  1ZH1 A;  2DE5 A;  3CQZ I;  4MD8 A;  1TWG I;  3CCR Z;  1VQO Z;  2JIP A;  4DQY B;  1VQ9 Z;  2YU9 I;  1YUA A;  1WZN A;  2QEX 1;  2I3C A;  3CC4 Z;  3CCM 1;  3G4S Z;  1VQ4 Z;  2RIQ A;  3BG1 B;  3CMA Z;  2F4M A;  2VPZ A;  1VQ7 1;  3IX0 A;  3JAM b;  2JNY A;  1RNI A;  1SFO I;  2PMZ A;  3CCE 1;  3Q87 A;  4A3F I;  4RVF A;  1NP6 A;  4RS4 A;  2QKD A;  4XX2 A;  2GU2 A;  4RVH A;  1ZB9 A;  5IP7 I;  4NBF A;  4HGY A;  2IZ3 A;  3D6W A;  4A3I I;  1Z03 A;  4NBH A;  1R9T I;  2O4H A;  4QTT A;  3RZO I;  2Q4Z A;  2OOY B;  3I55 Z;  4E2Z A;  3M4O I;  1KQS Y;  2P28 A;  3CCU Z;  1Q7Y 2;  3MZL B;  4NBD A;  1VQ5 Z;  2VPW A;  3FQM A;  2R93 I;  1K8A 2;  1X3Z A;  2JA5 I;  3CD6 1;  1FDO A;  1YHQ 1;  1DL6 A;  3BG0 B;  4DK1 A;  5IP9 I;  3KIH A;  4TNU A;  2QA4 Z;  1KC8 1;  3EED A;  1VLA A;  1YI2 Z;  3U50 C;  4A93 I;  3NFZ A;  2R92 I;  1Q16 A;  2QRE B;  3CXC Z;  3HOX I;  5AN9 F;  2LFU A;  3G71 Z;  3CC7 Z;  2E2J I;  1USP B;  4NFR A;  3HOU I;  1YIJ 1; 
#chains in the Genus database with same CATH homology
 1K9M 2;  1VQK 1;  3CPW Y;  1VQN 1;  2V8J A;  2WB1 A;  3K7A I;  1ZB8 A;  5CM2 M;  3CCL 1;  3VMH A;  2BJO A;  3HOY I;  3IFU A;  3NH5 A;  1Q86 1;  3I56 1;  1RO2 A;  3CME 1;  2QR1 B;  1VQ7 Z;  3MZK B;  3CCE Z;  3S1N I;  2W04 A;  1TWA I;  3HOW I;  3H0G I;  2R7Z I;  5A2Q f;  3M3Y I;  1Y1W I;  1KQS Z;  2DE7 A;  1KD1 1;  1Q81 1;  1WII A;  1X3W A;  3I4N I;  3GTK I;  4E2X A;  1QVG Z;  1JJ2 Z;  2NVQ I;  4A3J I;  1TWC I;  2R6M A;  2JR6 A;  1QYP A;  2Q51 A;  4HGZ A;  3HKZ A;  2OTJ 1;  5D1O A;  2K3R A;  1S72 Z;  2RT9 A;  1VQL 1;  2VUM I;  1VQ6 1;  4NBB A;  1RO4 A;  3CD6 Z;  1VQM 1;  3CCQ 1;  3OW2 Z;  1YJW 1;  2JA6 I;  2RHB A;  4BY7 I;  5FLX f;  2JA8 I;  3S14 I;  3VMG A;  1Q82 1;  3HOV I;  3G6E 1;  1TWH I;  3CPW Z;  2V8I A;  2EGT A;  4BY1 I;  3J80 b;  3GCF A;  1K73 2;  1M1K 2;  3S1Q I;  4CL1 A;  3J80 f;  1YIJ Z;  2E2I I;  5T6B A;  3GKQ A;  1VQK Z;  4MD7 A;  3CCR 1;  4A3D I;  1VQN Z;  4NBC A;  1K83 I;  2V8K A;  3IF8 A;  2H85 A;  2OTL 1;  3S17 I;  2QRC B;  3CCJ 1;  3FQQ A;  3CC4 1;  1M90 2;  2ZAE B;  3S1R I;  2VUG A;  3CCL Z;  2NVX I;  1VQ4 1;  2LIY A;  4E32 A;  3I56 Z;  1QVF Z;  3CME Z;  4A3G I;  2NVT I;  1Y1V I;  1S7M A;  2E9H A;  1I50 I;  1Y1V S;  4S1T A;  2KPI A;  2E2H I;  3QWU A;  3S16 I;  4X6A I;  3CCV 1;  5C3E I;  3T4N B;  4MRI A;  3GTO I;  4NH1 C;  3H3V J;  4E2Y A;  3CC2 Z;  1VQP 1;  1NJI 2;  1TWF I;  4A3M I;  3NDI A;  3GTQ I;  3LUS A;  1KD1 2;  1Q81 2;  3I07 A;  2QEX Z;  3CCM Z;  3NDJ A;  1W2B Y;  4RVD A;  3GTM I;  2OZK A;  2M6N A;  3F3F C;  4A3L I;  3GTM S;  4A3B I;  1K8A 1;  1X0T A;  5A2Q b;  2M48 A;  1VQL Z;  3CCS 1;  2PK7 A;  3VB9 A;  3TE5 B;  4MH4 A;  1VQM Z;  2YAD A;  3CCQ Z;  1YJW Z;  2K5R A;  2QA4 1;  3VMI A;  5C4J I;  1N8R 1;  4NB9 A;  1VQ8 1;  2KI7 B;  5C44 I;  3G6E Z;  3EER A;  2B63 I;  3GTG I;  1YJ9 1;  5C4X I;  2GTH A;  2PM9 A;  4NBE A;  3NH4 A;  4A3C I;  3J81 f;  1USP A;  1YJN 1;  3CXC Y;  2GTI A;  4NBA A;  3ESW A;  1QF8 A;  3NH8 A;  5FLX b;  1YIT 1;  2OTL Z;  1YHQ Z;  3CCJ Z;  1TFI A;  4HH4 A;  4E2W A;  2AKL A;  3S15 I;  3PO3 I;  3PO3 S;  3TDH B;  3RZD I;  1KC8 2;  1RQF A;  1P9N A;  3JAM f;  3CCV Z;  1N2F A;  4MD9 A;  4E33 A;  1W2B Z;  1VQP Z;  1Z02 A;  4A3K I;  3F3P C;  1VQO 1;  2RPR A;  1PFT A;  4QTU A;  1VQ9 1;  1ML8 A;  1LQL A;  1YUK A;  2Y0S A;  3MON A;  4MON A;  2NVY I;  3G4S 1;  2G2K A;  1L1O C;  2HF1 A;  3CMA 1;  4A3E I;  2OOX B;  2WAQ A;  1QVG Y;  1JJ2 Y;  4AYB A;  1Q86 2;  1I6H I;  1S72 1;  3D9X A;  1RLY A;  2QLV B;  5LL6 f;  5T64 A;  3HOZ I;  3GTP I;  4NB8 A;  3CCS Z;  2JMO A;  5T67 A;  1KRL A;  4Y7N I;  4BBR I;  3GTJ I;  3S2H I;  2HU9 A;  5D1P A;  1Z01 A;  1VQ8 Z;  3VTN A;  1K73 1;  1NUI A;  3I55 1;  1N8R 2;  1YJ9 Z;  4E31 A;  1M1K 1;  4BBS I;  3OW2 Y;  3GTL I;  2RBL A;  1Q7Y 1;  2IZ4 A;  3P5J B;  2F4O A;  5D1O B;  1WCM I;  3CCU 1;  4BXX I;  2JUB A;  3J7A 4;  2P3Y A;  2VF1 A;  2OTJ Z;  1VQ5 1;  1YJN Z;  3PO2 I;  5FLM I;  4NOZ A;  3S2D I;  1M90 1;  2W03 A;  2QRD B;  4EWC A;  1VQ6 Z;  1I3Q I;  1YIT Z;  4MXU A;  5IT9 b;  2O53 A;  4RVG A;  5IT9 f;  1RO0 A;  1YI2 1;  4E30 A;  4NBG A;  3FKI I;  1JWH C;  4DGL A;  3S1M I;  4Y52 I;  1Q82 2;  2JS4 A;  2DE6 A;  4RV9 A;  3J81 b;  3G71 1;  3CC7 1;  2J6A A;  3KIF A;  1K9M 1;  1NJI 1;  1WW9 A;  1QVF Y;  2JA7 I;  3I4M I;  3CC2 1;  1ZH1 A;  2DE5 A;  3CQZ I;  4MD8 A;  1TWG I;  3CCR Z;  1VQO Z;  4DQY B;  1VQ9 Z;  2YU9 I;  1YUA A;  2QEX 1;  2I3C A;  3CC4 Z;  3CCM 1;  3G4S Z;  1VQ4 Z;  2RIQ A;  3BG1 B;  3CMA Z;  2F4M A;  1VQ7 1;  3IX0 A;  3JAM b;  2JNY A;  1RNI A;  1SFO I;  2PMZ A;  3CCE 1;  3Q87 A;  4A3F I;  4RVF A;  1NP6 A;  4RS4 A;  2QKD A;  4XX2 A;  2GU2 A;  4RVH A;  1ZB9 A;  5IP7 I;  4NBF A;  4HGY A;  2IZ3 A;  3D6W A;  4A3I I;  1Z03 A;  4NBH A;  1R9T I;  2O4H A;  4QTT A;  3RZO I;  2Q4Z A;  2OOY B;  3I55 Z;  4E2Z A;  3M4O I;  1KQS Y;  2P28 A;  3CCU Z;  1Q7Y 2;  3MZL B;  4NBD A;  1VQ5 Z;  3FQM A;  2R93 I;  1K8A 2;  1X3Z A;  2JA5 I;  3CD6 1;  1YHQ 1;  1DL6 A;  3BG0 B;  4DK1 A;  5IP9 I;  3KIH A;  4TNU A;  2QA4 Z;  1KC8 1;  3EED A;  1VLA A;  1YI2 Z;  3U50 C;  4A93 I;  3NFZ A;  2R92 I;  2QRE B;  3CXC Z;  3HOX I;  5AN9 F;  2LFU A;  3G71 Z;  3CC7 Z;  2E2J I;  1USP B;  4NFR A;  3HOU I;  1YIJ 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...