4BBRI

Structure of rna polymerase ii-tfiib complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structure and Function of the Initially Transcribing RNA Polymerase II-TFIIB Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 14
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4bbrI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4bbrI02
3S1NI 1ZB9A 4A3FI 1WCMI 4BBRI 5FLMI 2KPIA 2RBLA 2R93I 3GTMI 1DL6A 2E2II 3RZDI 3HOVI 4NBAA 4A3JI 2DE5A 5C44I 3PO3S 4A93I 4NBEA 3GKQA 3I4NI 3HOWI 2J6AA 1Y1VI 3RZOI 1RLYA 1I3QI 3GTOI 4A3CI 1QYPA 3GTJI 3S1RI 3Q87A 1PFTA 4NB9A 2F4OA 2E2JI 1YUAA 4NBBA 1I50I 4NBCA 5C3EI 2F4MA 3VB9A 1LQLA 5CM2M 3I4MI 4A3MI 2JNYA 4A3DI 3GTQI 4NOZA 3GTLI 3HOZI 3EERA 3ESWA 1ML8A 3D6WA 1TFIA 4BY1I 1ZB8A 2JR6A 3HOYI 3VMHA 3GCFA 4A3LI 1SFOI 4NB8A 1X3WA 3U50C 3VMGA 1I6HI 3GTMS 2AKLA 1R9TI 1RO4A 2R7ZI 2HF1A 4A3II 4A3KI 3GTPI 4XX2A 1TWAI 2NVYI 3LUSA 4Y52I 1Y1VS 1USPB 2B63I 2NVTI 3PO2I 4X6AI 2R92I 4QTUA 1USPA 3S15I 2NVQI 3H3VJ 3K7AI 1VLAA 3I07A 3VMIA 2VUMI 3FKII 4NBGA 4A3EI 5C4XI 3S2DI 2JS4A 2K5RA 1K83I 2P3YA 4A3BI 3S2HI 3PO3I 4QTTA 5IP9I 3S1MI 4BY7I 2PK7A 3M3YI 4MH4A 3M4OI 4A3GI 1Y1WI 1TWGI 2NVXI 3GTGI 2JA6I 3GTKI 1TWCI 3S16I 5C4JI 4NBHA 4NBDA 1L1OC 2YU9I 1TWHI 4Y7NI 3HOXI 3S1QI 2BJOA 3CQZI 4NBFA 2JA8I 2JA5I 1NUIA 3S14I 3S17I 4BBSI 1TWFI 2DE7A 3H0GI 4BXXI 1N2FA 1WW9A 2E2HI 1X3ZA 5IP7I 3HOUI 2JA7I 2DE6A
chains in the Genus database with same CATH superfamily
3CCJ1 4MD8A 1WCMI 5FLMI 5A2Qf 1QVFZ 1YHQZ 3GTMI 2E7ZA 3HOVI 4E2XA 1VQN1 1SIWA 4NBEA 3GKQA 3I55Z 3HOWI 1YUKA 1Y1VI 1RLYA 1I3QI 3NH8A 3GTJI 1Z03A 2VPXA 2PMZA 1PFTA 2F4OA 3J81b 2OZKA 1AA6A 1I50I 4S1TA 3CCRZ 1VQ51 2OTLZ 3TE5B 2JNYA 3I56Z 4A3DI 3GTQI 1VQL1 3GTLI 3HOZI 1W2BZ 3D6WA 1TFIA 1K8A2 4BY1I 3HOYI 3GCFA 2G2KA 1SFOI 2RPRA 3NDIA 1K8A1 1RO4A 2R7ZI 3LUSA 2B63I 2NVTI 1YJNZ 2O4HA 2NVQI 2QA41 1VLAA 3MONA 2V8JA 3CC4Z 2W03A 3CD61 4A3EI 3S2DI 2W04A 1VQ4Z 1K9M2 3FQQA 2K5RA 1FDIA 1YIJ1 3J81f 2PM9A 4QTTA 1JJ2Y 2V45A 2VPWA 2PK7A 1X0TA 4E33A 2QLVB 3CC21 2OTJ1 2Q4ZA 1JJ2Z 5A2Qb 2RHBA 3TDHB 5T64A 1KRLA 2V8IA 3IR7A 1NP6A 3OW2Y 2JMOA 2BJOA 4NBFA 2H85A 3NFZA 1M1K2 3CMAZ 3H0GI 4RV9A 1N2FA 1X3ZA 5IP7I 1YI2Z 1Z02A 3FQMA 3HOUI 4DQYB 3CCLZ 2JA7I 4MONA 2DE6A 1M1K1 3CCJZ 2R93I 2E2II 3NDJA 1M901 1VQNZ 5IT9f 1KQSZ 3I4NI 2JIQA 2J6AA 4DGLA 3CME1 3D2LA 1QYPA 2VF1A 3Q87A 4MD7A 4E2WA 2E9HA 2E2JI 1YUAA 2ZAEB 2IZ4A 5CM2M 3HKZA 1K731 5D1OA 1VQ81 1VQLZ 3EERA 3EEDA 4E2YA 4NB8A 3U50C 1RO0A 3VMGA 4EWCA 3CXCY 1R9TI 1YJ91 2HF1A 3GTPI 4E32A 1Q822 2LIYA 3IFUA 1TWAI 2NVYI 4Y52I 3G6E1 3G711 3CCS1 3MZLB 1RO2A 1USPA 2QA4Z 3K7AI 3VMIA 1Q821 3CPWY 2V3VA 1QXFA 1YIT1 2JIRA 4RVFA 3CPWZ 3CD6Z 3P5JB 5FLXf 2I3CA 4A3BI 3QWUA 1YIJZ 3T4NB 4MH4A 3VTNA 3CC71 3CC2Z 2QKDA 2Y0SA 3M4OI 4TNUA 2O53A 2OTJZ 1Y1WI 2VUGA 3F3PC 2JA6I 1TWCI 4NBHA 2YU9I 1TWHI 3HOXI 3CQZI 5IT9b 1VQK1 2LFUA 3S14I 3S17I 2QEX1 5LL6f 4BXXI 2JUBA 1WW9A 3KIFA 3BG1B 1VQM1 2AYDA 1ZB9A 2KI7B 2RT9A 4CL1A 2RBLA 2K3RA 2IV2X 1DL6A 3RZDI 4NBAA 2DE5A 2QR1B 2GTHA 3PO3S 4A93I 2R6MA 5AN9F 4RVHA 3RZOI 1RNIA 2YADA 3GTOI 4A3CI 2JIMA 3CMEZ 3OW2Z 1S721 2M6NA 1YJW1 4NBBA 4NBCA 1M902 1VQ6Z 2VPYA 2WB1A 3MZKB 4A3MI 2VPZA 4E31A 4MRIA 1VQ8Z 4NOZA 3JAMf 1ML8A 1ZH1A 1KC81 1ZB8A 2JR6A 3VMHA 1QVGY 1KD11 3CCU1 2LEXA 2AKLA 2IZ3A 5FLXb 2NAPA 4RVDA 1K732 4A3II 2OOYB 3J80f 4A3KI 1YJ9Z 3G4S1 4XX2A 1WJ2A 1VQ5Z 3G6EZ 3G71Z 3PO2I 4X6AI 4QTUA 1Q7Y1 3S15I 3H3VJ 3I07A 1VQP1 2GU2A 3FKII 1Y8CA 1YITZ 2V8KA 4NBGA 1WIIA 5C4XI 1Q16A 2P3YA 1QVFY 1S7MA 3PO3I 3D9XA 5IP9I 1VQO1 3CCE1 4E30A 3CXCZ 3CC7Z 2NVXI 1VQ71 1L1OC 1Q811 1NJI1 4Y7NI 5D1PA 4RVGA 4NFRA 2JA8I 2JA5I 1VQ91 2RIQA 1VQKZ 1Z01A 1RQFA 2QEXZ 1TWFI 2DE7A 3CCQ1 4DK1A 3CCM1 2E2HI 3CCV1 4AYBA 3IF8A 4E2ZA 1VQMZ 3S1NI 4A3FI 3NH4A 5T6BA 4BBRI 1W2BY 2KPIA 1YHQ1 1P9NA 4A3JI 5C44I 5T67A 3JAMb 3I551 2QRDB 1N8R2 3S1RI 1S72Z 4NB9A 4HH4A 1YJWZ 3CCR1 2OTL1 5C3EI 3J80b 2F4MA 3VB9A 1LQLA 1N8R1 1FDOA 3I4MI 3F3FC 5D1OB 2QRCB 3NH5A 1QF8A 2QREB 3I561 2JIPA 4HGYA 3ESWA 4A3LI 4HGZA 1X3WA 2JIOA 3CCUZ 1I6HI 3GTMS 3J7A4 3G4SZ 1K9M1 1Y1VS 3KIHA 1KC82 1USPB 2EGTA 2R92I 1YJN1 1KD12 2VUMI 1VQPZ 3BG0B 3CC41 1VQ41 2M48A 2JS4A 4MD9A 1K83I 3S2HI 3S1MI 1Q7Y2 4BY7I 2OOXB 1QVGZ 2WAQA 3M3YI 1VQOZ 3CCEZ 2Q51A 1WZNA 4A3GI 1KQSY 2HU9A 4MXUA 1TWGI 3GTGI 3GTKI 3CCSZ 3S16I 5C4JI 4NBDA 1VQ7Z 1Q862 3S1QI 1JWHC 1NUIA 2GTIA 1VQ9Z 4BBSI 4RS4A 3CMA1 3CCQZ 2P28A 1Q861 3CCMZ 3CCVZ 1YI21 4NH1C 3CCL1 3IX0A 1VQ61 1Q812 1NJI2
chains in the Genus database with same CATH topology
3CCJ1 4MD8A 1WCMI 5FLMI 5A2Qf 1QVFZ 1YHQZ 3GTMI 3HOVI 4E2XA 1VQN1 4NBEA 3GKQA 3I55Z 3HOWI 1YUKA 1Y1VI 1RLYA 1I3QI 3NH8A 3GTJI 1Z03A 2PMZA 1PFTA 2F4OA 3J81b 2OZKA 1I50I 4S1TA 3CCRZ 1VQ51 2OTLZ 3TE5B 2JNYA 3I56Z 4A3DI 3GTQI 1VQL1 3GTLI 3HOZI 1W2BZ 3D6WA 1TFIA 1K8A2 4BY1I 3HOYI 3GCFA 2G2KA 1SFOI 2RPRA 3NDIA 1K8A1 1RO4A 2R7ZI 3LUSA 2B63I 2NVTI 1YJNZ 2O4HA 2NVQI 2QA41 1VLAA 3MONA 2V8JA 3CC4Z 2W03A 3CD61 4A3EI 3S2DI 2W04A 1VQ4Z 1K9M2 3FQQA 2K5RA 1YIJ1 3J81f 2PM9A 4QTTA 1JJ2Y 2PK7A 1X0TA 4E33A 2QLVB 3CC21 2OTJ1 2Q4ZA 1JJ2Z 5A2Qb 2RHBA 3TDHB 5T64A 1KRLA 2V8IA 1NP6A 3OW2Y 2JMOA 2BJOA 4NBFA 2H85A 3NFZA 1M1K2 3CMAZ 3H0GI 4RV9A 1N2FA 1X3ZA 5IP7I 1YI2Z 1Z02A 3FQMA 3HOUI 4DQYB 3CCLZ 2JA7I 4MONA 2DE6A 1M1K1 3CCJZ 2R93I 2E2II 3NDJA 1M901 1VQNZ 5IT9f 1KQSZ 3I4NI 2J6AA 4DGLA 3CME1 1QYPA 2VF1A 3Q87A 4MD7A 4E2WA 2E9HA 2E2JI 1YUAA 2ZAEB 2IZ4A 5CM2M 3HKZA 1K731 5D1OA 1VQ81 1VQLZ 3EERA 3EEDA 4E2YA 4NB8A 3U50C 1RO0A 3VMGA 4EWCA 3CXCY 1R9TI 1YJ91 2HF1A 3GTPI 4E32A 1Q822 2LIYA 3IFUA 1TWAI 2NVYI 4Y52I 3G6E1 3G711 3CCS1 3MZLB 1RO2A 1USPA 2QA4Z 3K7AI 3VMIA 1Q821 3CPWY 1YIT1 4RVFA 3CPWZ 3CD6Z 3P5JB 5FLXf 2I3CA 4A3BI 3QWUA 1YIJZ 3T4NB 4MH4A 3VTNA 3CC71 3CC2Z 2QKDA 2Y0SA 3M4OI 4TNUA 2O53A 2OTJZ 1Y1WI 2VUGA 3F3PC 2JA6I 1TWCI 4NBHA 2YU9I 1TWHI 3HOXI 3CQZI 5IT9b 1VQK1 2LFUA 3S14I 3S17I 2QEX1 5LL6f 4BXXI 2JUBA 1WW9A 3KIFA 3BG1B 1VQM1 1ZB9A 2KI7B 2RT9A 4CL1A 2RBLA 2K3RA 1DL6A 3RZDI 4NBAA 2DE5A 2QR1B 2GTHA 3PO3S 4A93I 2R6MA 5AN9F 4RVHA 3RZOI 1RNIA 2YADA 3GTOI 4A3CI 3CMEZ 3OW2Z 1S721 2M6NA 1YJW1 4NBBA 4NBCA 1M902 1VQ6Z 2WB1A 3MZKB 4A3MI 4E31A 4MRIA 1VQ8Z 4NOZA 3JAMf 1ML8A 1ZH1A 1KC81 1ZB8A 2JR6A 3VMHA 1QVGY 1KD11 3CCU1 2AKLA 2IZ3A 5FLXb 4RVDA 1K732 4A3II 2OOYB 3J80f 4A3KI 1YJ9Z 3G4S1 4XX2A 1VQ5Z 3G6EZ 3G71Z 3PO2I 4X6AI 4QTUA 1Q7Y1 3S15I 3H3VJ 3I07A 1VQP1 2GU2A 3FKII 1YITZ 2V8KA 4NBGA 1WIIA 5C4XI 2P3YA 1QVFY 1S7MA 3PO3I 3D9XA 5IP9I 1VQO1 3CCE1 4E30A 3CXCZ 3CC7Z 2NVXI 1VQ71 1L1OC 1Q811 1NJI1 4Y7NI 5D1PA 4RVGA 4NFRA 2JA8I 2JA5I 1VQ91 2RIQA 1VQKZ 1Z01A 1RQFA 2QEXZ 1TWFI 2DE7A 3CCQ1 4DK1A 3CCM1 2E2HI 3CCV1 4AYBA 3IF8A 4E2ZA 1VQMZ 3S1NI 4A3FI 3NH4A 5T6BA 4BBRI 1W2BY 2KPIA 1YHQ1 1P9NA 4A3JI 5C44I 5T67A 3JAMb 3I551 2QRDB 1N8R2 3S1RI 1S72Z 4NB9A 4HH4A 1YJWZ 3CCR1 2OTL1 5C3EI 3J80b 2F4MA 3VB9A 1LQLA 1N8R1 3I4MI 3F3FC 5D1OB 2QRCB 3NH5A 1QF8A 2QREB 3I561 4HGYA 3ESWA 4A3LI 4HGZA 1X3WA 3CCUZ 1I6HI 3GTMS 3J7A4 3G4SZ 1K9M1 1Y1VS 3KIHA 1KC82 1USPB 2EGTA 2R92I 1YJN1 1KD12 2VUMI 1VQPZ 3BG0B 3CC41 1VQ41 2M48A 2JS4A 4MD9A 1K83I 3S2HI 3S1MI 1Q7Y2 4BY7I 2OOXB 1QVGZ 2WAQA 3M3YI 1VQOZ 3CCEZ 2Q51A 4A3GI 1KQSY 2HU9A 4MXUA 1TWGI 3GTGI 3GTKI 3CCSZ 3S16I 5C4JI 4NBDA 1VQ7Z 1Q862 3S1QI 1JWHC 1NUIA 2GTIA 1VQ9Z 4BBSI 4RS4A 3CMA1 3CCQZ 2P28A 1Q861 3CCMZ 3CCVZ 1YI21 4NH1C 3CCL1 3IX0A 1VQ61 1Q812 1NJI2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1N I;  1ZB9 A;  4A3F I;  1WCM I;  4BBR I;  5FLM I;  2KPI A;  2RBL A;  2R93 I;  3GTM I;  1DL6 A;  2E2I I;  3RZD I;  3HOV I;  4NBA A;  4A3J I;  2DE5 A;  5C44 I;  3PO3 S;  4A93 I;  4NBE A;  3GKQ A;  3I4N I;  3HOW I;  2J6A A;  1Y1V I;  3RZO I;  1RLY A;  1I3Q I;  3GTO I;  4A3C I;  1QYP A;  3GTJ I;  3S1R I;  3Q87 A;  1PFT A;  4NB9 A;  2F4O A;  2E2J I;  1YUA A;  4NBB A;  1I50 I;  4NBC A;  5C3E I;  2F4M A;  3VB9 A;  1LQL A;  5CM2 M;  3I4M I;  4A3M I;  2JNY A;  4A3D I;  3GTQ I;  4NOZ A;  3GTL I;  3HOZ I;  3EER A;  3ESW A;  1ML8 A;  3D6W A;  1TFI A;  4BY1 I;  1ZB8 A;  2JR6 A;  3HOY I;  3VMH A;  3GCF A;  4A3L I;  1SFO I;  4NB8 A;  1X3W A;  3U50 C;  3VMG A;  1I6H I;  3GTM S;  2AKL A;  1R9T I;  1RO4 A;  2R7Z I;  2HF1 A;  4A3I I;  4A3K I;  3GTP I;  4XX2 A;  1TWA I;  2NVY I;  3LUS A;  4Y52 I;  1Y1V S;  1USP B;  2B63 I;  2NVT I;  3PO2 I;  4X6A I;  2R92 I;  4QTU A;  1USP A;  3S15 I;  2NVQ I;  3H3V J;  3K7A I;  1VLA A;  3I07 A;  3VMI A;  2VUM I;  3FKI I;  4NBG A;  4A3E I;  5C4X I;  3S2D I;  2JS4 A;  2K5R A;  1K83 I;  2P3Y A;  4A3B I;  3S2H I;  3PO3 I;  4QTT A;  5IP9 I;  3S1M I;  4BY7 I;  2PK7 A;  3M3Y I;  4MH4 A;  3M4O I;  4A3G I;  1Y1W I;  1TWG I;  2NVX I;  3GTG I;  2JA6 I;  3GTK I;  1TWC I;  3S16 I;  5C4J I;  4NBH A;  4NBD A;  1L1O C;  2YU9 I;  1TWH I;  4Y7N I;  3HOX I;  3S1Q I;  2BJO A;  3CQZ I;  4NBF A;  2JA8 I;  2JA5 I;  1NUI A;  3S14 I;  3S17 I;  4BBS I;  1TWF I;  2DE7 A;  3H0G I;  4BXX I;  1N2F A;  1WW9 A;  2E2H I;  1X3Z A;  5IP7 I;  3HOU I;  2JA7 I;  2DE6 A; 
#chains in the Genus database with same CATH topology
 3CCJ 1;  4MD8 A;  1WCM I;  5FLM I;  5A2Q f;  1QVF Z;  1YHQ Z;  3GTM I;  2E7Z A;  3HOV I;  4E2X A;  1VQN 1;  1SIW A;  4NBE A;  3GKQ A;  3I55 Z;  3HOW I;  1YUK A;  1Y1V I;  1RLY A;  1I3Q I;  3NH8 A;  3GTJ I;  1Z03 A;  2VPX A;  2PMZ A;  1PFT A;  2F4O A;  3J81 b;  2OZK A;  1AA6 A;  1I50 I;  4S1T A;  3CCR Z;  1VQ5 1;  2OTL Z;  3TE5 B;  2JNY A;  3I56 Z;  4A3D I;  3GTQ I;  1VQL 1;  3GTL I;  3HOZ I;  1W2B Z;  3D6W A;  1TFI A;  1K8A 2;  4BY1 I;  3HOY I;  3GCF A;  2G2K A;  1SFO I;  2RPR A;  3NDI A;  1K8A 1;  1RO4 A;  2R7Z I;  3LUS A;  2B63 I;  2NVT I;  1YJN Z;  2O4H A;  2NVQ I;  2QA4 1;  1VLA A;  3MON A;  2V8J A;  3CC4 Z;  2W03 A;  3CD6 1;  4A3E I;  3S2D I;  2W04 A;  1VQ4 Z;  1K9M 2;  3FQQ A;  2K5R A;  1FDI A;  1YIJ 1;  3J81 f;  2PM9 A;  4QTT A;  1JJ2 Y;  2V45 A;  2VPW A;  2PK7 A;  1X0T A;  4E33 A;  2QLV B;  3CC2 1;  2OTJ 1;  2Q4Z A;  1JJ2 Z;  5A2Q b;  2RHB A;  3TDH B;  5T64 A;  1KRL A;  2V8I A;  3IR7 A;  1NP6 A;  3OW2 Y;  2JMO A;  2BJO A;  4NBF A;  2H85 A;  3NFZ A;  1M1K 2;  3CMA Z;  3H0G I;  4RV9 A;  1N2F A;  1X3Z A;  5IP7 I;  1YI2 Z;  1Z02 A;  3FQM A;  3HOU I;  4DQY B;  3CCL Z;  2JA7 I;  4MON A;  2DE6 A;  1M1K 1;  3CCJ Z;  2R93 I;  2E2I I;  3NDJ A;  1M90 1;  1VQN Z;  5IT9 f;  1KQS Z;  3I4N I;  2JIQ A;  2J6A A;  4DGL A;  3CME 1;  3D2L A;  1QYP A;  2VF1 A;  3Q87 A;  4MD7 A;  4E2W A;  2E9H A;  2E2J I;  1YUA A;  2ZAE B;  2IZ4 A;  5CM2 M;  3HKZ A;  1K73 1;  5D1O A;  1VQ8 1;  1VQL Z;  3EER A;  3EED A;  4E2Y A;  4NB8 A;  3U50 C;  1RO0 A;  3VMG A;  4EWC A;  3CXC Y;  1R9T I;  1YJ9 1;  2HF1 A;  3GTP I;  4E32 A;  1Q82 2;  2LIY A;  3IFU A;  1TWA I;  2NVY I;  4Y52 I;  3G6E 1;  3G71 1;  3CCS 1;  3MZL B;  1RO2 A;  1USP A;  2QA4 Z;  3K7A I;  3VMI A;  1Q82 1;  3CPW Y;  2V3V A;  1QXF A;  1YIT 1;  2JIR A;  4RVF A;  3CPW Z;  3CD6 Z;  3P5J B;  5FLX f;  2I3C A;  4A3B I;  3QWU A;  1YIJ Z;  3T4N B;  4MH4 A;  3VTN A;  3CC7 1;  3CC2 Z;  2QKD A;  2Y0S A;  3M4O I;  4TNU A;  2O53 A;  2OTJ Z;  1Y1W I;  2VUG A;  3F3P C;  2JA6 I;  1TWC I;  4NBH A;  2YU9 I;  1TWH I;  3HOX I;  3CQZ I;  5IT9 b;  1VQK 1;  2LFU A;  3S14 I;  3S17 I;  2QEX 1;  5LL6 f;  4BXX I;  2JUB A;  1WW9 A;  3KIF A;  3BG1 B;  1VQM 1;  2AYD A;  1ZB9 A;  2KI7 B;  2RT9 A;  4CL1 A;  2RBL A;  2K3R A;  2IV2 X;  1DL6 A;  3RZD I;  4NBA A;  2DE5 A;  2QR1 B;  2GTH A;  3PO3 S;  4A93 I;  2R6M A;  5AN9 F;  4RVH A;  3RZO I;  1RNI A;  2YAD A;  3GTO I;  4A3C I;  2JIM A;  3CME Z;  3OW2 Z;  1S72 1;  2M6N A;  1YJW 1;  4NBB A;  4NBC A;  1M90 2;  1VQ6 Z;  2VPY A;  2WB1 A;  3MZK B;  4A3M I;  2VPZ A;  4E31 A;  4MRI A;  1VQ8 Z;  4NOZ A;  3JAM f;  1ML8 A;  1ZH1 A;  1KC8 1;  1ZB8 A;  2JR6 A;  3VMH A;  1QVG Y;  1KD1 1;  3CCU 1;  2LEX A;  2AKL A;  2IZ3 A;  5FLX b;  2NAP A;  4RVD A;  1K73 2;  4A3I I;  2OOY B;  3J80 f;  4A3K I;  1YJ9 Z;  3G4S 1;  4XX2 A;  1WJ2 A;  1VQ5 Z;  3G6E Z;  3G71 Z;  3PO2 I;  4X6A I;  4QTU A;  1Q7Y 1;  3S15 I;  3H3V J;  3I07 A;  1VQP 1;  2GU2 A;  3FKI I;  1Y8C A;  1YIT Z;  2V8K A;  4NBG A;  1WII A;  5C4X I;  1Q16 A;  2P3Y A;  1QVF Y;  1S7M A;  3PO3 I;  3D9X A;  5IP9 I;  1VQO 1;  3CCE 1;  4E30 A;  3CXC Z;  3CC7 Z;  2NVX I;  1VQ7 1;  1L1O C;  1Q81 1;  1NJI 1;  4Y7N I;  5D1P A;  4RVG A;  4NFR A;  2JA8 I;  2JA5 I;  1VQ9 1;  2RIQ A;  1VQK Z;  1Z01 A;  1RQF A;  2QEX Z;  1TWF I;  2DE7 A;  3CCQ 1;  4DK1 A;  3CCM 1;  2E2H I;  3CCV 1;  4AYB A;  3IF8 A;  4E2Z A;  1VQM Z;  3S1N I;  4A3F I;  3NH4 A;  5T6B A;  4BBR I;  1W2B Y;  2KPI A;  1YHQ 1;  1P9N A;  4A3J I;  5C44 I;  5T67 A;  3JAM b;  3I55 1;  2QRD B;  1N8R 2;  3S1R I;  1S72 Z;  4NB9 A;  4HH4 A;  1YJW Z;  3CCR 1;  2OTL 1;  5C3E I;  3J80 b;  2F4M A;  3VB9 A;  1LQL A;  1N8R 1;  1FDO A;  3I4M I;  3F3F C;  5D1O B;  2QRC B;  3NH5 A;  1QF8 A;  2QRE B;  3I56 1;  2JIP A;  4HGY A;  3ESW A;  4A3L I;  4HGZ A;  1X3W A;  2JIO A;  3CCU Z;  1I6H I;  3GTM S;  3J7A 4;  3G4S Z;  1K9M 1;  1Y1V S;  3KIH A;  1KC8 2;  1USP B;  2EGT A;  2R92 I;  1YJN 1;  1KD1 2;  2VUM I;  1VQP Z;  3BG0 B;  3CC4 1;  1VQ4 1;  2M48 A;  2JS4 A;  4MD9 A;  1K83 I;  3S2H I;  3S1M I;  1Q7Y 2;  4BY7 I;  2OOX B;  1QVG Z;  2WAQ A;  3M3Y I;  1VQO Z;  3CCE Z;  2Q51 A;  1WZN A;  4A3G I;  1KQS Y;  2HU9 A;  4MXU A;  1TWG I;  3GTG I;  3GTK I;  3CCS Z;  3S16 I;  5C4J I;  4NBD A;  1VQ7 Z;  1Q86 2;  3S1Q I;  1JWH C;  1NUI A;  2GTI A;  1VQ9 Z;  4BBS I;  4RS4 A;  3CMA 1;  3CCQ Z;  2P28 A;  1Q86 1;  3CCM Z;  3CCV Z;  1YI2 1;  4NH1 C;  3CCL 1;  3IX0 A;  1VQ6 1;  1Q81 2;  1NJI 2; 
#chains in the Genus database with same CATH homology
 3CCJ 1;  4MD8 A;  1WCM I;  5FLM I;  5A2Q f;  1QVF Z;  1YHQ Z;  3GTM I;  3HOV I;  4E2X A;  1VQN 1;  4NBE A;  3GKQ A;  3I55 Z;  3HOW I;  1YUK A;  1Y1V I;  1RLY A;  1I3Q I;  3NH8 A;  3GTJ I;  1Z03 A;  2PMZ A;  1PFT A;  2F4O A;  3J81 b;  2OZK A;  1I50 I;  4S1T A;  3CCR Z;  1VQ5 1;  2OTL Z;  3TE5 B;  2JNY A;  3I56 Z;  4A3D I;  3GTQ I;  1VQL 1;  3GTL I;  3HOZ I;  1W2B Z;  3D6W A;  1TFI A;  1K8A 2;  4BY1 I;  3HOY I;  3GCF A;  2G2K A;  1SFO I;  2RPR A;  3NDI A;  1K8A 1;  1RO4 A;  2R7Z I;  3LUS A;  2B63 I;  2NVT I;  1YJN Z;  2O4H A;  2NVQ I;  2QA4 1;  1VLA A;  3MON A;  2V8J A;  3CC4 Z;  2W03 A;  3CD6 1;  4A3E I;  3S2D I;  2W04 A;  1VQ4 Z;  1K9M 2;  3FQQ A;  2K5R A;  1YIJ 1;  3J81 f;  2PM9 A;  4QTT A;  1JJ2 Y;  2PK7 A;  1X0T A;  4E33 A;  2QLV B;  3CC2 1;  2OTJ 1;  2Q4Z A;  1JJ2 Z;  5A2Q b;  2RHB A;  3TDH B;  5T64 A;  1KRL A;  2V8I A;  1NP6 A;  3OW2 Y;  2JMO A;  2BJO A;  4NBF A;  2H85 A;  3NFZ A;  1M1K 2;  3CMA Z;  3H0G I;  4RV9 A;  1N2F A;  1X3Z A;  5IP7 I;  1YI2 Z;  1Z02 A;  3FQM A;  3HOU I;  4DQY B;  3CCL Z;  2JA7 I;  4MON A;  2DE6 A;  1M1K 1;  3CCJ Z;  2R93 I;  2E2I I;  3NDJ A;  1M90 1;  1VQN Z;  5IT9 f;  1KQS Z;  3I4N I;  2J6A A;  4DGL A;  3CME 1;  1QYP A;  2VF1 A;  3Q87 A;  4MD7 A;  4E2W A;  2E9H A;  2E2J I;  1YUA A;  2ZAE B;  2IZ4 A;  5CM2 M;  3HKZ A;  1K73 1;  5D1O A;  1VQ8 1;  1VQL Z;  3EER A;  3EED A;  4E2Y A;  4NB8 A;  3U50 C;  1RO0 A;  3VMG A;  4EWC A;  3CXC Y;  1R9T I;  1YJ9 1;  2HF1 A;  3GTP I;  4E32 A;  1Q82 2;  2LIY A;  3IFU A;  1TWA I;  2NVY I;  4Y52 I;  3G6E 1;  3G71 1;  3CCS 1;  3MZL B;  1RO2 A;  1USP A;  2QA4 Z;  3K7A I;  3VMI A;  1Q82 1;  3CPW Y;  1YIT 1;  4RVF A;  3CPW Z;  3CD6 Z;  3P5J B;  5FLX f;  2I3C A;  4A3B I;  3QWU A;  1YIJ Z;  3T4N B;  4MH4 A;  3VTN A;  3CC7 1;  3CC2 Z;  2QKD A;  2Y0S A;  3M4O I;  4TNU A;  2O53 A;  2OTJ Z;  1Y1W I;  2VUG A;  3F3P C;  2JA6 I;  1TWC I;  4NBH A;  2YU9 I;  1TWH I;  3HOX I;  3CQZ I;  5IT9 b;  1VQK 1;  2LFU A;  3S14 I;  3S17 I;  2QEX 1;  5LL6 f;  4BXX I;  2JUB A;  1WW9 A;  3KIF A;  3BG1 B;  1VQM 1;  1ZB9 A;  2KI7 B;  2RT9 A;  4CL1 A;  2RBL A;  2K3R A;  1DL6 A;  3RZD I;  4NBA A;  2DE5 A;  2QR1 B;  2GTH A;  3PO3 S;  4A93 I;  2R6M A;  5AN9 F;  4RVH A;  3RZO I;  1RNI A;  2YAD A;  3GTO I;  4A3C I;  3CME Z;  3OW2 Z;  1S72 1;  2M6N A;  1YJW 1;  4NBB A;  4NBC A;  1M90 2;  1VQ6 Z;  2WB1 A;  3MZK B;  4A3M I;  4E31 A;  4MRI A;  1VQ8 Z;  4NOZ A;  3JAM f;  1ML8 A;  1ZH1 A;  1KC8 1;  1ZB8 A;  2JR6 A;  3VMH A;  1QVG Y;  1KD1 1;  3CCU 1;  2AKL A;  2IZ3 A;  5FLX b;  4RVD A;  1K73 2;  4A3I I;  2OOY B;  3J80 f;  4A3K I;  1YJ9 Z;  3G4S 1;  4XX2 A;  1VQ5 Z;  3G6E Z;  3G71 Z;  3PO2 I;  4X6A I;  4QTU A;  1Q7Y 1;  3S15 I;  3H3V J;  3I07 A;  1VQP 1;  2GU2 A;  3FKI I;  1YIT Z;  2V8K A;  4NBG A;  1WII A;  5C4X I;  2P3Y A;  1QVF Y;  1S7M A;  3PO3 I;  3D9X A;  5IP9 I;  1VQO 1;  3CCE 1;  4E30 A;  3CXC Z;  3CC7 Z;  2NVX I;  1VQ7 1;  1L1O C;  1Q81 1;  1NJI 1;  4Y7N I;  5D1P A;  4RVG A;  4NFR A;  2JA8 I;  2JA5 I;  1VQ9 1;  2RIQ A;  1VQK Z;  1Z01 A;  1RQF A;  2QEX Z;  1TWF I;  2DE7 A;  3CCQ 1;  4DK1 A;  3CCM 1;  2E2H I;  3CCV 1;  4AYB A;  3IF8 A;  4E2Z A;  1VQM Z;  3S1N I;  4A3F I;  3NH4 A;  5T6B A;  4BBR I;  1W2B Y;  2KPI A;  1YHQ 1;  1P9N A;  4A3J I;  5C44 I;  5T67 A;  3JAM b;  3I55 1;  2QRD B;  1N8R 2;  3S1R I;  1S72 Z;  4NB9 A;  4HH4 A;  1YJW Z;  3CCR 1;  2OTL 1;  5C3E I;  3J80 b;  2F4M A;  3VB9 A;  1LQL A;  1N8R 1;  3I4M I;  3F3F C;  5D1O B;  2QRC B;  3NH5 A;  1QF8 A;  2QRE B;  3I56 1;  4HGY A;  3ESW A;  4A3L I;  4HGZ A;  1X3W A;  3CCU Z;  1I6H I;  3GTM S;  3J7A 4;  3G4S Z;  1K9M 1;  1Y1V S;  3KIH A;  1KC8 2;  1USP B;  2EGT A;  2R92 I;  1YJN 1;  1KD1 2;  2VUM I;  1VQP Z;  3BG0 B;  3CC4 1;  1VQ4 1;  2M48 A;  2JS4 A;  4MD9 A;  1K83 I;  3S2H I;  3S1M I;  1Q7Y 2;  4BY7 I;  2OOX B;  1QVG Z;  2WAQ A;  3M3Y I;  1VQO Z;  3CCE Z;  2Q51 A;  4A3G I;  1KQS Y;  2HU9 A;  4MXU A;  1TWG I;  3GTG I;  3GTK I;  3CCS Z;  3S16 I;  5C4J I;  4NBD A;  1VQ7 Z;  1Q86 2;  3S1Q I;  1JWH C;  1NUI A;  2GTI A;  1VQ9 Z;  4BBS I;  4RS4 A;  3CMA 1;  3CCQ Z;  2P28 A;  1Q86 1;  3CCM Z;  3CCV Z;  1YI2 1;  4NH1 C;  3CCL 1;  3IX0 A;  1VQ6 1;  1Q81 2;  1NJI 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...