4BBRI

Structure of rna polymerase ii-tfiib complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structure and Function of the Initially Transcribing RNA Polymerase II-TFIIB Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 14
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4bbrI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4bbrI02
2YU9I 1NUIA 2E2II 3GTJI 3HOWI 3D6WA 3GTKI 5C4JI 4QTUA 1TFIA 4BBSI 3RZOI 1RLYA 3LUSA 1WW9A 1USPA 3GTMS 3HOYI 1TWGI 3VMIA 3S1QI 2R7ZI 2JNYA 3GTMI 2AKLA 3S14I 3GCFA 4A3DI 3S1NI 3S1RI 1ZB9A 1PFTA 1ZB8A 2E2JI 4A3II 4NBBA 2JS4A 3I4MI 4NB8A 4NBDA 3GTGI 2JA6I 2KPIA 3VMHA 5C44I 4NBGA 4NOZA 2NVXI 4BY1I 3HOZI 2R93I 3HOUI 3ESWA 1K83I 2BJOA 2J6AA 4BY7I 3K7AI 3HOXI 4A3CI 4A3GI 1TWHI 4BXXI 1X3WA 3S15I 3I07A 4X6AI 4A3JI 3RZDI 2NVQI 5C4XI 4MH4A 1USPB 3PO3I 1RO4A 2DE6A 4A3MI 3CQZI 2R92I 4Y7NI 2F4OA 2JA7I 4A3LI 2P3YA 4A93I 3M4OI 3EERA 2JR6A 5CM2M 4Y52I 1DL6A 3VMGA 4NBCA 3H3VJ 3S16I 3GKQA 3Q87A 1R9TI 5IP9I 1TWFI 2E2HI 3VB9A 1ML8A 1X3ZA 1LQLA 3PO2I 5IP7I 3S1MI 2PK7A 2K5RA 1I6HI 2JA8I 2RBLA 1I3QI 3I4NI 1VLAA 4NB9A 4A3KI 3S2HI 3FKII 1QYPA 3S17I 3GTQI 3H0GI 2VUMI 4NBFA 4NBHA 3M3YI 1L1OC 3GTPI 3GTLI 4A3FI 3U50C 4NBEA 1Y1VS 4QTTA 3HOVI 4XX2A 2HF1A 2JA5I 2B63I 1YUAA 5FLMI 2NVTI 1Y1VI 1I50I 3GTOI 1TWCI 3S2DI 2DE7A 3PO3S 2DE5A 1TWAI 2NVYI 1Y1WI 1N2FA 4NBAA 4BBRI 4A3EI 5C3EI 2F4MA 4A3BI 1SFOI 1WCMI
chains in the Genus database with same CATH superfamily
1YUKA 1AA6A 1NUIA 2VPYA 2E2II 4E2XA 3HOWI 2WAQA 5IT9b 1NP6A 4BBSI 3RZOI 1RLYA 2PM9A 3HOYI 2IV2X 1VQL1 3S14I 3GCFA 3FQQA 3S1NI 2V8KA 2E2JI 1VQKZ 1Z01A 4E32A 3I551 3P5JB 4MONA 1VQ9Z 4NBGA 1Q811 2NVXI 4BY1I 3G711 2V45A 3CCRZ 2VUGA 2BJOA 2LEXA 1K9M2 4BY7I 3HOXI 4BXXI 2I3CA 3I07A 4X6AI 4A3JI 4MH4A 4RVHA 3CCJZ 2R92I 1FDIA 2M48A 2P3YA 1QVGY 3EERA 1YIT1 3J81f 1DL6A 3S16I 1QF8A 3MZLB 3Q87A 4E31A 1KRLA 3I56Z 1VQP1 3KIHA 1K731 2W04A 4HGYA 4HGZA 4CL1A 3PO2I 3S1MI 3IF8A 2GU2A 1FDOA 3EEDA 2VPZA 3CD6Z 3J80f 1WCMI 5FLXb 3CCQZ 1JJ2Z 3GTQI 3G6EZ 3F3PC 3GTPI 3GTLI 3CC41 3U50C 1WZNA 3IX0A 2NVTI 1M902 2P28A 1VQ51 3S2DI 1P9NA 3MZKB 2NVYI 1N2FA 4RV9A 4NBAA 2F4MA 4E33A 2OZKA 2VPXA 2V8IA 1KQSY 4NFRA 3GTKI 5C4JI 3CCMZ 1TFIA 4NH1C 1Q822 3CCE1 3GTMS 1WW9A 1USPA 4S1TA 1VQ41 1S721 2W03A 1VQMZ 2R7ZI 2JNYA 1YHQZ 4A3DI 2OTL1 5D1PA 2QEXZ 2JS4A 4NBBA 1VQ71 3I4MI 4NB8A 5D1OB 2E9HA 2GTHA 3CXCY 1M1K1 3KIFA 4NOZA 2R93I 3HOUI 3CC21 1S7MA 3IFUA 3CME1 3CMAZ 3S15I 3CCUZ 3PO3I 2YADA 4A3MI 1YJNZ 1VQN1 2JA7I 4A3LI 2JIRA 2Q51A 3M4OI 2JR6A 3VMGA 3GKQA 2JIQA 2OOYB 2RHBA 1KC81 2OOXB 2E7ZA 4DK1A 3CCS1 3BG1B 3JAMb 1YIJ1 1ML8A 4DQYB 1VQ81 4EWCA 2V3VA 5IP7I 1VQOZ 2PK7A 2JA8I 3CCL1 2K3RA 2O53A 1YI2Z 3OW2Z 1N8R1 3CCVZ 3I4NI 1QVFY 1Q812 1VLAA 3J7A4 5IT9f 1Q16A 3S2HI 2VUMI 2QREB 3M3YI 4TNUA 1YJW1 1N8R2 1VQ6Z 1W2BY 4NBEA 1Y1VS 2QA41 1YJ9Z 2DE7A 4RVFA 3TDHB 3PO3S 2DE5A 2JIMA 3G4S1 1K732 4E30A 1SIWA 1RO0A 2WB1A 2IZ3A 5T64A 1ZH1A 3GTJI 2G2KA 2VF1A 2JMOA 1JWHC 2OTJZ 5A2Qb 1K8A1 1WJ2A 3LUSA 1TWGI 3IR7A 3CPWY 3S1QI 3D2LA 3NH8A 1VQLZ 2AKLA 3S1RI 1VQK1 2JUBA 1NJI1 2QKDA 3D9XA 4A3II 3I55Z 3GTGI 3F3FC 2KPIA 3VMHA 5C44I 1VQ91 4MD9A 3CCR1 1KQSZ 3G71Z 1K83I 5T6BA 2QLVB 4A3GI 5FLXf 1Q861 2AYDA 3CCJ1 1USPB 2DE6A 1Q7Y1 4Y7NI 2V8JA 5AN9F 4A93I 2R6MA 4RS4A 5CM2M 4Y52I 2RT9A 1Q862 1YITZ 3I561 2QRCB 1R9TI 3TE5B 1VQPZ 3CC7Z 3VB9A 4AYBA 3CD61 4HH4A 2RBLA 5D1OA 1M1K2 3CCQ1 3G6E1 3FKII 3S17I 3H0GI 4MD8A 3HKZA 2OTJ1 2NAPA 2JIPA 4NBFA 2Y0SA 1X0TA 4QTTA 3CC4Z 4RVDA 3HOVI 4XX2A 3NH4A 3J81b 1QXFA 1YUAA 5FLMI 1VQ5Z 2HU9A 3NH5A 4RVGA 1KC82 1Y1WI 2ZAEB 4A3BI 1SFOI 3FQMA 3BG0B 1K9M1 2M6NA 2YU9I 1KD11 3J80b 1QVFZ 1Y8CA 3D6WA 3CCM1 1Z02A 4QTUA 4E2ZA 4E2YA 1QVGZ 1RNIA 2QRDB 3OW2Y 3CCEZ 3NFZA 1KD12 1Z03A 1W2BZ 1VQM1 4MD7A 3VMIA 1YHQ1 2H85A 1VQ4Z 1S72Z 3GTMI 1ZB9A 2QEX1 1PFTA 5T67A 1ZB8A 2O4HA 2OTLZ 1WIIA 4NBDA 1VQ7Z 5LL6f 2RPRA 3JAMf 2JA6I 4MXUA 3CC71 3HOZI 3ESWA 2J6AA 3CC2Z 3K7AI 4A3CI 2VPWA 1TWHI 3CMEZ 1X3WA 3CMA1 1JJ2Y 3CCU1 2LFUA 2RIQA 2NVQI 3RZDI 4E2WA 5C4XI 2LIYA 1YJN1 1RO4A 1K8A2 3CPWZ 3CQZI 2IZ4A 2F4OA 2KI7B 1VQNZ 1M901 2QR1B 4NBCA 3NDJA 3H3VJ 2GTIA 1NJI2 5IP9I 1TWFI 3CCSZ 2E2HI 1X3ZA 3NDIA 1VQO1 1YIJZ 1LQLA 1VQ8Z 2PMZA 2EGTA 2K5RA 1YI21 1I6HI 3CCV1 1RQFA 2Q4ZA 3CCLZ 1I3QI 4A3KI 4NB9A 1Q821 3QWUA 5A2Qf 1QYPA 1RO2A 3MONA 4MRIA 4NBHA 1VQ61 1L1OC 4A3FI 1YJWZ 3VTNA 1Q7Y2 2HF1A 2JA5I 2B63I 1YJ91 1Y1VI 3CXCZ 1I50I 3GTOI 1TWCI 2QA4Z 2JIOA 1TWAI 3T4NB 4BBRI 4A3EI 5C3EI 3G4SZ 4DGLA
chains in the Genus database with same CATH topology
1YUKA 1NUIA 2E2II 4E2XA 3HOWI 2WAQA 5IT9b 1NP6A 4BBSI 3RZOI 1RLYA 2PM9A 3HOYI 1VQL1 3S14I 3GCFA 3FQQA 3S1NI 2V8KA 2E2JI 1VQKZ 1Z01A 4E32A 3I551 3P5JB 4MONA 1VQ9Z 4NBGA 1Q811 2NVXI 4BY1I 3G711 3CCRZ 2VUGA 2BJOA 1K9M2 4BY7I 3HOXI 4BXXI 2I3CA 3I07A 4X6AI 4A3JI 4MH4A 4RVHA 3CCJZ 2R92I 2M48A 2P3YA 1QVGY 3EERA 1YIT1 3J81f 1DL6A 3S16I 1QF8A 3MZLB 3Q87A 4E31A 1KRLA 3I56Z 1VQP1 3KIHA 1K731 2W04A 4HGYA 4HGZA 4CL1A 3PO2I 3S1MI 3IF8A 2GU2A 3EEDA 3CD6Z 3J80f 1WCMI 5FLXb 3CCQZ 1JJ2Z 3GTQI 3G6EZ 3F3PC 3GTPI 3GTLI 3CC41 3U50C 3IX0A 2NVTI 1M902 2P28A 1VQ51 3S2DI 1P9NA 3MZKB 2NVYI 1N2FA 4RV9A 4NBAA 2F4MA 4E33A 2OZKA 2V8IA 1KQSY 4NFRA 3GTKI 5C4JI 3CCMZ 1TFIA 4NH1C 1Q822 3CCE1 3GTMS 1WW9A 1USPA 4S1TA 1VQ41 1S721 2W03A 1VQMZ 2R7ZI 2JNYA 1YHQZ 4A3DI 2OTL1 5D1PA 2QEXZ 2JS4A 4NBBA 1VQ71 3I4MI 4NB8A 5D1OB 2E9HA 2GTHA 3CXCY 1M1K1 3KIFA 4NOZA 2R93I 3HOUI 3CC21 1S7MA 3IFUA 3CME1 3CMAZ 3S15I 3CCUZ 3PO3I 2YADA 4A3MI 1YJNZ 1VQN1 2JA7I 4A3LI 2Q51A 3M4OI 2JR6A 3VMGA 3GKQA 2OOYB 2RHBA 1KC81 2OOXB 4DK1A 3CCS1 3BG1B 3JAMb 1YIJ1 1ML8A 4DQYB 1VQ81 4EWCA 5IP7I 1VQOZ 2PK7A 2JA8I 3CCL1 2K3RA 2O53A 1YI2Z 3OW2Z 1N8R1 3CCVZ 3I4NI 1QVFY 1Q812 1VLAA 3J7A4 5IT9f 3S2HI 2VUMI 2QREB 3M3YI 4TNUA 1YJW1 1N8R2 1VQ6Z 1W2BY 4NBEA 1Y1VS 2QA41 1YJ9Z 2DE7A 4RVFA 3TDHB 3PO3S 2DE5A 3G4S1 1K732 4E30A 1RO0A 2WB1A 2IZ3A 5T64A 1ZH1A 3GTJI 2G2KA 2VF1A 2JMOA 1JWHC 2OTJZ 5A2Qb 1K8A1 3LUSA 1TWGI 3CPWY 3S1QI 3NH8A 1VQLZ 2AKLA 3S1RI 1VQK1 2JUBA 1NJI1 2QKDA 3D9XA 4A3II 3I55Z 3GTGI 3F3FC 2KPIA 3VMHA 5C44I 1VQ91 4MD9A 3CCR1 1KQSZ 3G71Z 1K83I 5T6BA 2QLVB 4A3GI 5FLXf 1Q861 3CCJ1 1USPB 2DE6A 1Q7Y1 4Y7NI 2V8JA 5AN9F 4A93I 2R6MA 4RS4A 5CM2M 4Y52I 2RT9A 1Q862 1YITZ 3I561 2QRCB 1R9TI 3TE5B 1VQPZ 3CC7Z 3VB9A 4AYBA 3CD61 4HH4A 2RBLA 5D1OA 1M1K2 3CCQ1 3G6E1 3FKII 3S17I 3H0GI 4MD8A 3HKZA 2OTJ1 4NBFA 2Y0SA 1X0TA 4QTTA 3CC4Z 4RVDA 3HOVI 4XX2A 3NH4A 3J81b 1YUAA 5FLMI 1VQ5Z 2HU9A 3NH5A 4RVGA 1KC82 1Y1WI 2ZAEB 4A3BI 1SFOI 3FQMA 3BG0B 1K9M1 2M6NA 2YU9I 1KD11 3J80b 1QVFZ 3D6WA 3CCM1 1Z02A 4QTUA 4E2ZA 4E2YA 1QVGZ 1RNIA 2QRDB 3OW2Y 3CCEZ 3NFZA 1KD12 1Z03A 1W2BZ 1VQM1 4MD7A 3VMIA 1YHQ1 2H85A 1VQ4Z 1S72Z 3GTMI 1ZB9A 2QEX1 1PFTA 5T67A 1ZB8A 2O4HA 2OTLZ 1WIIA 4NBDA 1VQ7Z 5LL6f 2RPRA 3JAMf 2JA6I 4MXUA 3CC71 3HOZI 3ESWA 2J6AA 3CC2Z 3K7AI 4A3CI 1TWHI 3CMEZ 1X3WA 3CMA1 1JJ2Y 3CCU1 2LFUA 2RIQA 2NVQI 3RZDI 4E2WA 5C4XI 2LIYA 1YJN1 1RO4A 1K8A2 3CPWZ 3CQZI 2IZ4A 2F4OA 2KI7B 1VQNZ 1M901 2QR1B 4NBCA 3NDJA 3H3VJ 2GTIA 1NJI2 5IP9I 1TWFI 3CCSZ 2E2HI 1X3ZA 3NDIA 1VQO1 1YIJZ 1LQLA 1VQ8Z 2PMZA 2EGTA 2K5RA 1YI21 1I6HI 3CCV1 1RQFA 2Q4ZA 3CCLZ 1I3QI 4A3KI 4NB9A 1Q821 3QWUA 5A2Qf 1QYPA 1RO2A 3MONA 4MRIA 4NBHA 1VQ61 1L1OC 4A3FI 1YJWZ 3VTNA 1Q7Y2 2HF1A 2JA5I 2B63I 1YJ91 1Y1VI 3CXCZ 1I50I 3GTOI 1TWCI 2QA4Z 1TWAI 3T4NB 4BBRI 4A3EI 5C3EI 3G4SZ 4DGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YU9 I;  1NUI A;  2E2I I;  3GTJ I;  3HOW I;  3D6W A;  3GTK I;  5C4J I;  4QTU A;  1TFI A;  4BBS I;  3RZO I;  1RLY A;  3LUS A;  1WW9 A;  1USP A;  3GTM S;  3HOY I;  1TWG I;  3VMI A;  3S1Q I;  2R7Z I;  2JNY A;  3GTM I;  2AKL A;  3S14 I;  3GCF A;  4A3D I;  3S1N I;  3S1R I;  1ZB9 A;  1PFT A;  1ZB8 A;  2E2J I;  4A3I I;  4NBB A;  2JS4 A;  3I4M I;  4NB8 A;  4NBD A;  3GTG I;  2JA6 I;  2KPI A;  3VMH A;  5C44 I;  4NBG A;  4NOZ A;  2NVX I;  4BY1 I;  3HOZ I;  2R93 I;  3HOU I;  3ESW A;  1K83 I;  2BJO A;  2J6A A;  4BY7 I;  3K7A I;  3HOX I;  4A3C I;  4A3G I;  1TWH I;  4BXX I;  1X3W A;  3S15 I;  3I07 A;  4X6A I;  4A3J I;  3RZD I;  2NVQ I;  5C4X I;  4MH4 A;  1USP B;  3PO3 I;  1RO4 A;  2DE6 A;  4A3M I;  3CQZ I;  2R92 I;  4Y7N I;  2F4O A;  2JA7 I;  4A3L I;  2P3Y A;  4A93 I;  3M4O I;  3EER A;  2JR6 A;  5CM2 M;  4Y52 I;  1DL6 A;  3VMG A;  4NBC A;  3H3V J;  3S16 I;  3GKQ A;  3Q87 A;  1R9T I;  5IP9 I;  1TWF I;  2E2H I;  3VB9 A;  1ML8 A;  1X3Z A;  1LQL A;  3PO2 I;  5IP7 I;  3S1M I;  2PK7 A;  2K5R A;  1I6H I;  2JA8 I;  2RBL A;  1I3Q I;  3I4N I;  1VLA A;  4NB9 A;  4A3K I;  3S2H I;  3FKI I;  1QYP A;  3S17 I;  3GTQ I;  3H0G I;  2VUM I;  4NBF A;  4NBH A;  3M3Y I;  1L1O C;  3GTP I;  3GTL I;  4A3F I;  3U50 C;  4NBE A;  1Y1V S;  4QTT A;  3HOV I;  4XX2 A;  2HF1 A;  2JA5 I;  2B63 I;  1YUA A;  5FLM I;  2NVT I;  1Y1V I;  1I50 I;  3GTO I;  1TWC I;  3S2D I;  2DE7 A;  3PO3 S;  2DE5 A;  1TWA I;  2NVY I;  1Y1W I;  1N2F A;  4NBA A;  4BBR I;  4A3E I;  5C3E I;  2F4M A;  4A3B I;  1SFO I;  1WCM I; 
#chains in the Genus database with same CATH topology
 1YUK A;  1AA6 A;  1NUI A;  2VPY A;  2E2I I;  4E2X A;  3HOW I;  2WAQ A;  5IT9 b;  1NP6 A;  4BBS I;  3RZO I;  1RLY A;  2PM9 A;  3HOY I;  2IV2 X;  1VQL 1;  3S14 I;  3GCF A;  3FQQ A;  3S1N I;  2V8K A;  2E2J I;  1VQK Z;  1Z01 A;  4E32 A;  3I55 1;  3P5J B;  4MON A;  1VQ9 Z;  4NBG A;  1Q81 1;  2NVX I;  4BY1 I;  3G71 1;  2V45 A;  3CCR Z;  2VUG A;  2BJO A;  2LEX A;  1K9M 2;  4BY7 I;  3HOX I;  4BXX I;  2I3C A;  3I07 A;  4X6A I;  4A3J I;  4MH4 A;  4RVH A;  3CCJ Z;  2R92 I;  1FDI A;  2M48 A;  2P3Y A;  1QVG Y;  3EER A;  1YIT 1;  3J81 f;  1DL6 A;  3S16 I;  1QF8 A;  3MZL B;  3Q87 A;  4E31 A;  1KRL A;  3I56 Z;  1VQP 1;  3KIH A;  1K73 1;  2W04 A;  4HGY A;  4HGZ A;  4CL1 A;  3PO2 I;  3S1M I;  3IF8 A;  2GU2 A;  1FDO A;  3EED A;  2VPZ A;  3CD6 Z;  3J80 f;  1WCM I;  5FLX b;  3CCQ Z;  1JJ2 Z;  3GTQ I;  3G6E Z;  3F3P C;  3GTP I;  3GTL I;  3CC4 1;  3U50 C;  1WZN A;  3IX0 A;  2NVT I;  1M90 2;  2P28 A;  1VQ5 1;  3S2D I;  1P9N A;  3MZK B;  2NVY I;  1N2F A;  4RV9 A;  4NBA A;  2F4M A;  4E33 A;  2OZK A;  2VPX A;  2V8I A;  1KQS Y;  4NFR A;  3GTK I;  5C4J I;  3CCM Z;  1TFI A;  4NH1 C;  1Q82 2;  3CCE 1;  3GTM S;  1WW9 A;  1USP A;  4S1T A;  1VQ4 1;  1S72 1;  2W03 A;  1VQM Z;  2R7Z I;  2JNY A;  1YHQ Z;  4A3D I;  2OTL 1;  5D1P A;  2QEX Z;  2JS4 A;  4NBB A;  1VQ7 1;  3I4M I;  4NB8 A;  5D1O B;  2E9H A;  2GTH A;  3CXC Y;  1M1K 1;  3KIF A;  4NOZ A;  2R93 I;  3HOU I;  3CC2 1;  1S7M A;  3IFU A;  3CME 1;  3CMA Z;  3S15 I;  3CCU Z;  3PO3 I;  2YAD A;  4A3M I;  1YJN Z;  1VQN 1;  2JA7 I;  4A3L I;  2JIR A;  2Q51 A;  3M4O I;  2JR6 A;  3VMG A;  3GKQ A;  2JIQ A;  2OOY B;  2RHB A;  1KC8 1;  2OOX B;  2E7Z A;  4DK1 A;  3CCS 1;  3BG1 B;  3JAM b;  1YIJ 1;  1ML8 A;  4DQY B;  1VQ8 1;  4EWC A;  2V3V A;  5IP7 I;  1VQO Z;  2PK7 A;  2JA8 I;  3CCL 1;  2K3R A;  2O53 A;  1YI2 Z;  3OW2 Z;  1N8R 1;  3CCV Z;  3I4N I;  1QVF Y;  1Q81 2;  1VLA A;  3J7A 4;  5IT9 f;  1Q16 A;  3S2H I;  2VUM I;  2QRE B;  3M3Y I;  4TNU A;  1YJW 1;  1N8R 2;  1VQ6 Z;  1W2B Y;  4NBE A;  1Y1V S;  2QA4 1;  1YJ9 Z;  2DE7 A;  4RVF A;  3TDH B;  3PO3 S;  2DE5 A;  2JIM A;  3G4S 1;  1K73 2;  4E30 A;  1SIW A;  1RO0 A;  2WB1 A;  2IZ3 A;  5T64 A;  1ZH1 A;  3GTJ I;  2G2K A;  2VF1 A;  2JMO A;  1JWH C;  2OTJ Z;  5A2Q b;  1K8A 1;  1WJ2 A;  3LUS A;  1TWG I;  3IR7 A;  3CPW Y;  3S1Q I;  3D2L A;  3NH8 A;  1VQL Z;  2AKL A;  3S1R I;  1VQK 1;  2JUB A;  1NJI 1;  2QKD A;  3D9X A;  4A3I I;  3I55 Z;  3GTG I;  3F3F C;  2KPI A;  3VMH A;  5C44 I;  1VQ9 1;  4MD9 A;  3CCR 1;  1KQS Z;  3G71 Z;  1K83 I;  5T6B A;  2QLV B;  4A3G I;  5FLX f;  1Q86 1;  2AYD A;  3CCJ 1;  1USP B;  2DE6 A;  1Q7Y 1;  4Y7N I;  2V8J A;  5AN9 F;  4A93 I;  2R6M A;  4RS4 A;  5CM2 M;  4Y52 I;  2RT9 A;  1Q86 2;  1YIT Z;  3I56 1;  2QRC B;  1R9T I;  3TE5 B;  1VQP Z;  3CC7 Z;  3VB9 A;  4AYB A;  3CD6 1;  4HH4 A;  2RBL A;  5D1O A;  1M1K 2;  3CCQ 1;  3G6E 1;  3FKI I;  3S17 I;  3H0G I;  4MD8 A;  3HKZ A;  2OTJ 1;  2NAP A;  2JIP A;  4NBF A;  2Y0S A;  1X0T A;  4QTT A;  3CC4 Z;  4RVD A;  3HOV I;  4XX2 A;  3NH4 A;  3J81 b;  1QXF A;  1YUA A;  5FLM I;  1VQ5 Z;  2HU9 A;  3NH5 A;  4RVG A;  1KC8 2;  1Y1W I;  2ZAE B;  4A3B I;  1SFO I;  3FQM A;  3BG0 B;  1K9M 1;  2M6N A;  2YU9 I;  1KD1 1;  3J80 b;  1QVF Z;  1Y8C A;  3D6W A;  3CCM 1;  1Z02 A;  4QTU A;  4E2Z A;  4E2Y A;  1QVG Z;  1RNI A;  2QRD B;  3OW2 Y;  3CCE Z;  3NFZ A;  1KD1 2;  1Z03 A;  1W2B Z;  1VQM 1;  4MD7 A;  3VMI A;  1YHQ 1;  2H85 A;  1VQ4 Z;  1S72 Z;  3GTM I;  1ZB9 A;  2QEX 1;  1PFT A;  5T67 A;  1ZB8 A;  2O4H A;  2OTL Z;  1WII A;  4NBD A;  1VQ7 Z;  5LL6 f;  2RPR A;  3JAM f;  2JA6 I;  4MXU A;  3CC7 1;  3HOZ I;  3ESW A;  2J6A A;  3CC2 Z;  3K7A I;  4A3C I;  2VPW A;  1TWH I;  3CME Z;  1X3W A;  3CMA 1;  1JJ2 Y;  3CCU 1;  2LFU A;  2RIQ A;  2NVQ I;  3RZD I;  4E2W A;  5C4X I;  2LIY A;  1YJN 1;  1RO4 A;  1K8A 2;  3CPW Z;  3CQZ I;  2IZ4 A;  2F4O A;  2KI7 B;  1VQN Z;  1M90 1;  2QR1 B;  4NBC A;  3NDJ A;  3H3V J;  2GTI A;  1NJI 2;  5IP9 I;  1TWF I;  3CCS Z;  2E2H I;  1X3Z A;  3NDI A;  1VQO 1;  1YIJ Z;  1LQL A;  1VQ8 Z;  2PMZ A;  2EGT A;  2K5R A;  1YI2 1;  1I6H I;  3CCV 1;  1RQF A;  2Q4Z A;  3CCL Z;  1I3Q I;  4A3K I;  4NB9 A;  1Q82 1;  3QWU A;  5A2Q f;  1QYP A;  1RO2 A;  3MON A;  4MRI A;  4NBH A;  1VQ6 1;  1L1O C;  4A3F I;  1YJW Z;  3VTN A;  1Q7Y 2;  2HF1 A;  2JA5 I;  2B63 I;  1YJ9 1;  1Y1V I;  3CXC Z;  1I50 I;  3GTO I;  1TWC I;  2QA4 Z;  2JIO A;  1TWA I;  3T4N B;  4BBR I;  4A3E I;  5C3E I;  3G4S Z;  4DGL A; 
#chains in the Genus database with same CATH homology
 1YUK A;  1NUI A;  2E2I I;  4E2X A;  3HOW I;  2WAQ A;  5IT9 b;  1NP6 A;  4BBS I;  3RZO I;  1RLY A;  2PM9 A;  3HOY I;  1VQL 1;  3S14 I;  3GCF A;  3FQQ A;  3S1N I;  2V8K A;  2E2J I;  1VQK Z;  1Z01 A;  4E32 A;  3I55 1;  3P5J B;  4MON A;  1VQ9 Z;  4NBG A;  1Q81 1;  2NVX I;  4BY1 I;  3G71 1;  3CCR Z;  2VUG A;  2BJO A;  1K9M 2;  4BY7 I;  3HOX I;  4BXX I;  2I3C A;  3I07 A;  4X6A I;  4A3J I;  4MH4 A;  4RVH A;  3CCJ Z;  2R92 I;  2M48 A;  2P3Y A;  1QVG Y;  3EER A;  1YIT 1;  3J81 f;  1DL6 A;  3S16 I;  1QF8 A;  3MZL B;  3Q87 A;  4E31 A;  1KRL A;  3I56 Z;  1VQP 1;  3KIH A;  1K73 1;  2W04 A;  4HGY A;  4HGZ A;  4CL1 A;  3PO2 I;  3S1M I;  3IF8 A;  2GU2 A;  3EED A;  3CD6 Z;  3J80 f;  1WCM I;  5FLX b;  3CCQ Z;  1JJ2 Z;  3GTQ I;  3G6E Z;  3F3P C;  3GTP I;  3GTL I;  3CC4 1;  3U50 C;  3IX0 A;  2NVT I;  1M90 2;  2P28 A;  1VQ5 1;  3S2D I;  1P9N A;  3MZK B;  2NVY I;  1N2F A;  4RV9 A;  4NBA A;  2F4M A;  4E33 A;  2OZK A;  2V8I A;  1KQS Y;  4NFR A;  3GTK I;  5C4J I;  3CCM Z;  1TFI A;  4NH1 C;  1Q82 2;  3CCE 1;  3GTM S;  1WW9 A;  1USP A;  4S1T A;  1VQ4 1;  1S72 1;  2W03 A;  1VQM Z;  2R7Z I;  2JNY A;  1YHQ Z;  4A3D I;  2OTL 1;  5D1P A;  2QEX Z;  2JS4 A;  4NBB A;  1VQ7 1;  3I4M I;  4NB8 A;  5D1O B;  2E9H A;  2GTH A;  3CXC Y;  1M1K 1;  3KIF A;  4NOZ A;  2R93 I;  3HOU I;  3CC2 1;  1S7M A;  3IFU A;  3CME 1;  3CMA Z;  3S15 I;  3CCU Z;  3PO3 I;  2YAD A;  4A3M I;  1YJN Z;  1VQN 1;  2JA7 I;  4A3L I;  2Q51 A;  3M4O I;  2JR6 A;  3VMG A;  3GKQ A;  2OOY B;  2RHB A;  1KC8 1;  2OOX B;  4DK1 A;  3CCS 1;  3BG1 B;  3JAM b;  1YIJ 1;  1ML8 A;  4DQY B;  1VQ8 1;  4EWC A;  5IP7 I;  1VQO Z;  2PK7 A;  2JA8 I;  3CCL 1;  2K3R A;  2O53 A;  1YI2 Z;  3OW2 Z;  1N8R 1;  3CCV Z;  3I4N I;  1QVF Y;  1Q81 2;  1VLA A;  3J7A 4;  5IT9 f;  3S2H I;  2VUM I;  2QRE B;  3M3Y I;  4TNU A;  1YJW 1;  1N8R 2;  1VQ6 Z;  1W2B Y;  4NBE A;  1Y1V S;  2QA4 1;  1YJ9 Z;  2DE7 A;  4RVF A;  3TDH B;  3PO3 S;  2DE5 A;  3G4S 1;  1K73 2;  4E30 A;  1RO0 A;  2WB1 A;  2IZ3 A;  5T64 A;  1ZH1 A;  3GTJ I;  2G2K A;  2VF1 A;  2JMO A;  1JWH C;  2OTJ Z;  5A2Q b;  1K8A 1;  3LUS A;  1TWG I;  3CPW Y;  3S1Q I;  3NH8 A;  1VQL Z;  2AKL A;  3S1R I;  1VQK 1;  2JUB A;  1NJI 1;  2QKD A;  3D9X A;  4A3I I;  3I55 Z;  3GTG I;  3F3F C;  2KPI A;  3VMH A;  5C44 I;  1VQ9 1;  4MD9 A;  3CCR 1;  1KQS Z;  3G71 Z;  1K83 I;  5T6B A;  2QLV B;  4A3G I;  5FLX f;  1Q86 1;  3CCJ 1;  1USP B;  2DE6 A;  1Q7Y 1;  4Y7N I;  2V8J A;  5AN9 F;  4A93 I;  2R6M A;  4RS4 A;  5CM2 M;  4Y52 I;  2RT9 A;  1Q86 2;  1YIT Z;  3I56 1;  2QRC B;  1R9T I;  3TE5 B;  1VQP Z;  3CC7 Z;  3VB9 A;  4AYB A;  3CD6 1;  4HH4 A;  2RBL A;  5D1O A;  1M1K 2;  3CCQ 1;  3G6E 1;  3FKI I;  3S17 I;  3H0G I;  4MD8 A;  3HKZ A;  2OTJ 1;  4NBF A;  2Y0S A;  1X0T A;  4QTT A;  3CC4 Z;  4RVD A;  3HOV I;  4XX2 A;  3NH4 A;  3J81 b;  1YUA A;  5FLM I;  1VQ5 Z;  2HU9 A;  3NH5 A;  4RVG A;  1KC8 2;  1Y1W I;  2ZAE B;  4A3B I;  1SFO I;  3FQM A;  3BG0 B;  1K9M 1;  2M6N A;  2YU9 I;  1KD1 1;  3J80 b;  1QVF Z;  3D6W A;  3CCM 1;  1Z02 A;  4QTU A;  4E2Z A;  4E2Y A;  1QVG Z;  1RNI A;  2QRD B;  3OW2 Y;  3CCE Z;  3NFZ A;  1KD1 2;  1Z03 A;  1W2B Z;  1VQM 1;  4MD7 A;  3VMI A;  1YHQ 1;  2H85 A;  1VQ4 Z;  1S72 Z;  3GTM I;  1ZB9 A;  2QEX 1;  1PFT A;  5T67 A;  1ZB8 A;  2O4H A;  2OTL Z;  1WII A;  4NBD A;  1VQ7 Z;  5LL6 f;  2RPR A;  3JAM f;  2JA6 I;  4MXU A;  3CC7 1;  3HOZ I;  3ESW A;  2J6A A;  3CC2 Z;  3K7A I;  4A3C I;  1TWH I;  3CME Z;  1X3W A;  3CMA 1;  1JJ2 Y;  3CCU 1;  2LFU A;  2RIQ A;  2NVQ I;  3RZD I;  4E2W A;  5C4X I;  2LIY A;  1YJN 1;  1RO4 A;  1K8A 2;  3CPW Z;  3CQZ I;  2IZ4 A;  2F4O A;  2KI7 B;  1VQN Z;  1M90 1;  2QR1 B;  4NBC A;  3NDJ A;  3H3V J;  2GTI A;  1NJI 2;  5IP9 I;  1TWF I;  3CCS Z;  2E2H I;  1X3Z A;  3NDI A;  1VQO 1;  1YIJ Z;  1LQL A;  1VQ8 Z;  2PMZ A;  2EGT A;  2K5R A;  1YI2 1;  1I6H I;  3CCV 1;  1RQF A;  2Q4Z A;  3CCL Z;  1I3Q I;  4A3K I;  4NB9 A;  1Q82 1;  3QWU A;  5A2Q f;  1QYP A;  1RO2 A;  3MON A;  4MRI A;  4NBH A;  1VQ6 1;  1L1O C;  4A3F I;  1YJW Z;  3VTN A;  1Q7Y 2;  2HF1 A;  2JA5 I;  2B63 I;  1YJ9 1;  1Y1V I;  3CXC Z;  1I50 I;  3GTO I;  1TWC I;  2QA4 Z;  1TWA I;  3T4N B;  4BBR I;  4A3E I;  5C3E I;  3G4S Z;  4DGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...