4BBRI

Structure of rna polymerase ii-tfiib complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structure and Function of the Initially Transcribing RNA Polymerase II-TFIIB Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 14
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4bbrI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4bbrI02
3VMIA 1ML8A 1R9TI 2J6AA 2E2JI 3RZOI 2VUMI 2BJOA 2RBLA 4A93I 2JA5I 4NBFA 1WCMI 1Y1VI 4A3JI 1LQLA 3S1NI 3I07A 2AKLA 2NVQI 4NBGA 3HOVI 1VLAA 4A3GI 1PFTA 3GTKI 3S2HI 3VMGA 2DE5A 2HF1A 4NBHA 4A3DI 2JNYA 3D6WA 4A3LI 2JR6A 4NB9A 2NVXI 1X3ZA 3ESWA 3S1RI 3S14I 1I3QI 4NBBA 3HOWI 5IP9I 3LUSA 1RO4A 3GKQA 3HOXI 3GTPI 1YUAA 2K5RA 4BBRI 1TFIA 2E2II 1K83I 3S17I 4NOZA 3H3VJ 3M4OI 4A3KI 1DL6A 4MH4A 2F4OA 2JA7I 1WW9A 3I4NI 1TWHI 4QTUA 1N2FA 2R93I 1I6HI 1Y1WI 4Y52I 3GTLI 2E2HI 2F4MA 4BBSI 2PK7A 3PO2I 4NBEA 5C44I 2KPIA 1SFOI 2JA8I 4X6AI 3U50C 4NB8A 3PO3S 2NVTI 3GTGI 3S15I 1QYPA 3PO3I 1TWGI 2P3YA 5C4XI 3GTQI 2YU9I 3HOUI 1ZB8A 2JS4A 4BY1I 3S1MI 4BY7I 3HOZI 3VMHA 3Q87A 3GTOI 3M3YI 1RLYA 1ZB9A 5CM2M 1NUIA 4Y7NI 3VB9A 2B63I 2R7ZI 4BXXI 2DE6A 1X3WA 5C3EI 4QTTA 1USPB 3EERA 1I50I 5C4JI 3K7AI 3S2DI 3S16I 1Y1VS 3FKII 4NBCA 1L1OC 2JA6I 1TWCI 4NBDA 3RZDI 4A3MI 4A3BI 2DE7A 3H0GI 5FLMI 3GTJI 4A3EI 2R92I 3S1QI 2NVYI 4A3II 4XX2A 3GCFA 5IP7I 1TWFI 3GTMS 3CQZI 4A3FI 1USPA 3GTMI 4A3CI 3I4MI 1TWAI 3HOYI 4NBAA
chains in the Genus database with same CATH superfamily
5T6BA 3VTNA 2V3VA 4AYBA 2E9HA 2K3RA 3NH5A 3CCJZ 2LEXA 2JA5I 5IT9b 2OTL1 1LQLA 3OW2Y 2G2KA 1VQ81 1QVFZ 1JJ2Y 1Z01A 2QREB 2PM9A 3S2HI 3VMGA 3I56Z 1VQ51 3CXCZ 4NBHA 3G71Z 3D6WA 4E2ZA 1Q16A 3CCSZ 3CCVZ 3S1RI 3J81b 3LUSA 3IX0A 4E31A 3CC21 3GTPI 5IT9f 2JIMA 1TFIA 2VPZA 1KD11 2WAQA 4MH4A 2JA7I 5A2Qb 1WW9A 5AN9F 2QLVB 2R93I 4Y52I 1Q812 2E2HI 2O53A 4BBSI 3IFUA 1NP6A 2AYDA 3GTGI 1VQPZ 3G4S1 2H85A 3BG0B 4DQYB 3HOUI 1X0TA 4BY7I 3I551 1KC81 5D1OB 3M3YI 3JAMb 1Q7Y1 5CM2M 2DE6A 4DGLA 1I50I 2ZAEB 2M48A 4MONA 1WZNA 3S16I 1Y1VS 5D1OA 4NBDA 3H0GI 3GTJI 4A3EI 4E2WA 4CL1A 3GCFA 1TWFI 2R6MA 3GTMS 2OTLZ 2QRDB 2VF1A 3JAMf 1VQ8Z 2QRCB 3CCL1 5FLXb 3HOYI 1VQ5Z 3VMIA 1ML8A 1R9TI 1VQ9Z 1RO0A 2Q4ZA 2IZ4A 3S1NI 3I07A 2NVQI 3KIHA 3HOVI 3GTKI 3CC2Z 1Q811 2HF1A 4NFRA 4E32A 3G6E1 4A3LI 3MZKB 3FQQA 3HOWI 1RO4A 2OOYB 3J80f 3GKQA 2K5RA 3G4SZ 2IZ3A 3NH4A 3FQMA 3H3VJ 3M4OI 3I55Z 4EWCA 3I4NI 1S7MA 2JIOA 2VUGA 4QTUA 2W04A 3GTLI 2F4MA 3PO2I 1YJWZ 2V8KA 4NBEA 4E30A 2KPIA 4X6AI 4NB8A 2NVTI 2YADA 3CC7Z 1TWGI 1JWHC 5C4XI 2YU9I 1QF8A 3S1MI 3CPWZ 2QA41 2W03A 1Z03A 2HU9A 3Q87A 1VQK1 5D1PA 2V8JA 3CME1 2VPWA 1X3WA 3D2LA 3F3PC 1N8R2 4RVDA 3D9XA 3S2DI 2V8IA 3CCLZ 3CCU1 2JUBA 4NBCA 1P9NA 1Q862 2VPYA 3OW2Z 4RVHA 5FLMI 2LFUA 4XX2A 5IP7I 2P28A 3P5JB 3GTMI 2LIYA 2OTJ1 3HKZA 1Y8CA 3F3FC 4NBAA 4E2XA 1YJN1 2E2JI 3G6EZ 3RZOI 2VUMI 1Z02A 2RBLA 2RHBA 4NBFA 1K9M2 2GU2A 3MONA 2AKLA 4A3GI 3NFZA 3TE5B 2DE5A 3TDHB 1ZH1A 1YIJ1 4A3DI 1VQ61 4E33A 3CC41 2Q51A 2JR6A 2NVXI 4HGYA 3ESWA 3S14I 1I3QI 4NBBA 1KQSZ 3J7A4 2OOXB 2QKDA 3J80b 3HOXI 1YUAA 2JIRA 1K83I 3MZLB 1YI21 3NDJA 2QR1B 2O4HA 1DL6A 3EEDA 2QA4Z 1QVFY 3CMA1 2F4OA 1VQKZ 4MD9A 1N2FA 1Y1WI 1N8R1 3CXCY 3CMEZ 1VQL1 1VQN1 2RT9A 1SFOI 2WB1A 3U50C 3PO3S 1Q861 2I3CA 1RQFA 1QYPA 3CCR1 5T67A 2P3YA 1S721 3GTQI 3IR7A 1YJ91 1RO2A 1ZB8A 2JS4A 1YIT1 3CCUZ 4BY1I 2RPRA 2M6NA 4MD7A 3GTOI 3CCE1 4RVGA 1ZB9A 4Y7NI 1NUIA 1VQM1 2B63I 3IF8A 1VQ41 4DK1A 4QTTA 2OTJZ 3K7AI 1VQO1 2KI7B 1K9M1 4RS4A 4HH4A 1YJNZ 2JA6I 1TWCI 1M1K2 1KRLA 2DE7A 3CD61 3S1QI 4A3II 2Y0SA 1M902 4TNUA 3BG1B 1QVGZ 4A3FI 1SIWA 1FDIA 1QXFA 1VQ91 1W2BZ 2OZKA 2J6AA 1YIJZ 1VQ6Z 1VQ71 2QEX1 3CCM1 3CC4Z 4RV9A 1YUKA 4HGZA 2BJOA 1RNIA 4A93I 1WCMI 4S1TA 1Y1VI 1WIIA 4A3JI 1K8A2 3KIFA 1K732 1JJ2Z 1YHQ1 4NBGA 1VLAA 3CCQ1 1PFTA 2GTHA 2JIPA 1YI2Z 2EGTA 2JNYA 3CCJ1 1Q822 3CMAZ 5LL6f 4NB9A 3NH8A 1X3ZA 1NJI2 1VQLZ 1VQNZ 3J81f 5IP9I 2JMOA 1KQSY 1FDOA 3CCRZ 4BBRI 2JIQA 1S72Z 2E2II 2RIQA 4E2YA 3I561 3S17I 1YJ9Z 4NOZA 3G711 4NH1C 4MXUA 4A3KI 1YITZ 1YJW1 5A2Qf 1TWHI 3CCS1 3CCV1 1I6HI 3CCEZ 3CC71 2PK7A 1VQMZ 5C44I 1VQ4Z 2JA8I 3S15I 1M1K1 3PO3I 1VQOZ 2GTIA 1M901 4RVFA 3HOZI 3VMHA 1WJ2A 1RLYA 3CD6Z 3VB9A 2V45A 1KD12 2R7ZI 4BXXI 5C3EI 1VQP1 1USPB 3EERA 4MRIA 1AA6A 5C4JI 3QWUA 1K8A1 3FKII 1K731 1L1OC 1VQ7Z 4MD8A 2QEXZ 5T64A 3RZDI 3CCMZ 4A3MI 4A3BI 3NDIA 2R92I 2NVYI 3T4NB 3CPWY 2E7ZA 2PMZA 3CQZI 1Q821 1KC82 2VPXA 1USPA 1YHQZ 2IV2X 1QVGY 3CCQZ 4A3CI 1Q7Y2 1NJI1 1W2BY 3I4MI 5FLXf 1TWAI 2NAPA
chains in the Genus database with same CATH topology
5T6BA 3VTNA 4AYBA 2E9HA 2K3RA 3NH5A 3CCJZ 2JA5I 5IT9b 2OTL1 1LQLA 3OW2Y 2G2KA 1VQ81 1QVFZ 1JJ2Y 1Z01A 2QREB 2PM9A 3S2HI 3VMGA 3I56Z 1VQ51 3CXCZ 4NBHA 3G71Z 3D6WA 4E2ZA 3CCSZ 3CCVZ 3S1RI 3J81b 3LUSA 3IX0A 4E31A 3CC21 3GTPI 5IT9f 1TFIA 1KD11 2WAQA 4MH4A 2JA7I 5A2Qb 1WW9A 5AN9F 2QLVB 2R93I 4Y52I 1Q812 2E2HI 2O53A 4BBSI 3IFUA 1NP6A 3GTGI 1VQPZ 3G4S1 2H85A 3BG0B 4DQYB 3HOUI 1X0TA 4BY7I 3I551 1KC81 5D1OB 3M3YI 3JAMb 1Q7Y1 5CM2M 2DE6A 4DGLA 1I50I 2ZAEB 2M48A 4MONA 3S16I 1Y1VS 5D1OA 4NBDA 3H0GI 3GTJI 4A3EI 4E2WA 4CL1A 3GCFA 1TWFI 2R6MA 3GTMS 2OTLZ 2QRDB 2VF1A 3JAMf 1VQ8Z 2QRCB 3CCL1 5FLXb 3HOYI 1VQ5Z 3VMIA 1ML8A 1R9TI 1VQ9Z 1RO0A 2Q4ZA 2IZ4A 3S1NI 3I07A 2NVQI 3KIHA 3HOVI 3GTKI 3CC2Z 1Q811 2HF1A 4NFRA 4E32A 3G6E1 4A3LI 3MZKB 3FQQA 3HOWI 1RO4A 2OOYB 3J80f 3GKQA 2K5RA 3G4SZ 2IZ3A 3NH4A 3FQMA 3H3VJ 3M4OI 3I55Z 4EWCA 3I4NI 1S7MA 2VUGA 4QTUA 2W04A 3GTLI 2F4MA 3PO2I 1YJWZ 2V8KA 4NBEA 4E30A 2KPIA 4X6AI 4NB8A 2NVTI 2YADA 3CC7Z 1TWGI 1JWHC 5C4XI 2YU9I 1QF8A 3S1MI 3CPWZ 2QA41 2W03A 1Z03A 2HU9A 3Q87A 1VQK1 5D1PA 2V8JA 3CME1 1X3WA 3F3PC 1N8R2 4RVDA 3D9XA 3S2DI 2V8IA 3CCLZ 3CCU1 2JUBA 4NBCA 1P9NA 1Q862 3OW2Z 4RVHA 5FLMI 2LFUA 4XX2A 5IP7I 2P28A 3P5JB 3GTMI 2LIYA 2OTJ1 3HKZA 3F3FC 4NBAA 4E2XA 1YJN1 2E2JI 3G6EZ 3RZOI 2VUMI 1Z02A 2RBLA 2RHBA 4NBFA 1K9M2 2GU2A 3MONA 2AKLA 4A3GI 3NFZA 3TE5B 2DE5A 3TDHB 1ZH1A 1YIJ1 4A3DI 1VQ61 4E33A 3CC41 2Q51A 2JR6A 2NVXI 4HGYA 3ESWA 3S14I 1I3QI 4NBBA 1KQSZ 3J7A4 2OOXB 2QKDA 3J80b 3HOXI 1YUAA 1K83I 3MZLB 1YI21 3NDJA 2QR1B 2O4HA 1DL6A 3EEDA 2QA4Z 1QVFY 3CMA1 2F4OA 1VQKZ 4MD9A 1N2FA 1Y1WI 1N8R1 3CXCY 3CMEZ 1VQL1 1VQN1 2RT9A 1SFOI 2WB1A 3U50C 3PO3S 1Q861 2I3CA 1RQFA 1QYPA 3CCR1 5T67A 2P3YA 1S721 3GTQI 1YJ91 1RO2A 1ZB8A 2JS4A 1YIT1 3CCUZ 4BY1I 2RPRA 2M6NA 4MD7A 3GTOI 3CCE1 4RVGA 1ZB9A 4Y7NI 1NUIA 1VQM1 2B63I 3IF8A 1VQ41 4DK1A 4QTTA 2OTJZ 3K7AI 1VQO1 2KI7B 1K9M1 4RS4A 4HH4A 1YJNZ 2JA6I 1TWCI 1M1K2 1KRLA 2DE7A 3CD61 3S1QI 4A3II 2Y0SA 1M902 4TNUA 3BG1B 1QVGZ 4A3FI 1VQ91 1W2BZ 2OZKA 2J6AA 1YIJZ 1VQ6Z 1VQ71 2QEX1 3CCM1 3CC4Z 4RV9A 1YUKA 4HGZA 2BJOA 1RNIA 4A93I 1WCMI 4S1TA 1Y1VI 1WIIA 4A3JI 1K8A2 3KIFA 1K732 1JJ2Z 1YHQ1 4NBGA 1VLAA 3CCQ1 1PFTA 2GTHA 1YI2Z 2EGTA 2JNYA 3CCJ1 1Q822 3CMAZ 5LL6f 4NB9A 3NH8A 1X3ZA 1NJI2 1VQLZ 1VQNZ 3J81f 5IP9I 2JMOA 1KQSY 3CCRZ 4BBRI 1S72Z 2E2II 2RIQA 4E2YA 3I561 3S17I 1YJ9Z 4NOZA 3G711 4NH1C 4MXUA 4A3KI 1YITZ 1YJW1 5A2Qf 1TWHI 3CCS1 3CCV1 1I6HI 3CCEZ 3CC71 2PK7A 1VQMZ 5C44I 1VQ4Z 2JA8I 3S15I 1M1K1 3PO3I 1VQOZ 2GTIA 1M901 4RVFA 3HOZI 3VMHA 1RLYA 3CD6Z 3VB9A 1KD12 2R7ZI 4BXXI 5C3EI 1VQP1 1USPB 3EERA 4MRIA 5C4JI 3QWUA 1K8A1 3FKII 1K731 1L1OC 1VQ7Z 4MD8A 2QEXZ 5T64A 3RZDI 3CCMZ 4A3MI 4A3BI 3NDIA 2R92I 2NVYI 3T4NB 3CPWY 2PMZA 3CQZI 1Q821 1KC82 1USPA 1YHQZ 1QVGY 3CCQZ 4A3CI 1Q7Y2 1NJI1 1W2BY 3I4MI 5FLXf 1TWAI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VMI A;  1ML8 A;  1R9T I;  2J6A A;  2E2J I;  3RZO I;  2VUM I;  2BJO A;  2RBL A;  4A93 I;  2JA5 I;  4NBF A;  1WCM I;  1Y1V I;  4A3J I;  1LQL A;  3S1N I;  3I07 A;  2AKL A;  2NVQ I;  4NBG A;  3HOV I;  1VLA A;  4A3G I;  1PFT A;  3GTK I;  3S2H I;  3VMG A;  2DE5 A;  2HF1 A;  4NBH A;  4A3D I;  2JNY A;  3D6W A;  4A3L I;  2JR6 A;  4NB9 A;  2NVX I;  1X3Z A;  3ESW A;  3S1R I;  3S14 I;  1I3Q I;  4NBB A;  3HOW I;  5IP9 I;  3LUS A;  1RO4 A;  3GKQ A;  3HOX I;  3GTP I;  1YUA A;  2K5R A;  4BBR I;  1TFI A;  2E2I I;  1K83 I;  3S17 I;  4NOZ A;  3H3V J;  3M4O I;  4A3K I;  1DL6 A;  4MH4 A;  2F4O A;  2JA7 I;  1WW9 A;  3I4N I;  1TWH I;  4QTU A;  1N2F A;  2R93 I;  1I6H I;  1Y1W I;  4Y52 I;  3GTL I;  2E2H I;  2F4M A;  4BBS I;  2PK7 A;  3PO2 I;  4NBE A;  5C44 I;  2KPI A;  1SFO I;  2JA8 I;  4X6A I;  3U50 C;  4NB8 A;  3PO3 S;  2NVT I;  3GTG I;  3S15 I;  1QYP A;  3PO3 I;  1TWG I;  2P3Y A;  5C4X I;  3GTQ I;  2YU9 I;  3HOU I;  1ZB8 A;  2JS4 A;  4BY1 I;  3S1M I;  4BY7 I;  3HOZ I;  3VMH A;  3Q87 A;  3GTO I;  3M3Y I;  1RLY A;  1ZB9 A;  5CM2 M;  1NUI A;  4Y7N I;  3VB9 A;  2B63 I;  2R7Z I;  4BXX I;  2DE6 A;  1X3W A;  5C3E I;  4QTT A;  1USP B;  3EER A;  1I50 I;  5C4J I;  3K7A I;  3S2D I;  3S16 I;  1Y1V S;  3FKI I;  4NBC A;  1L1O C;  2JA6 I;  1TWC I;  4NBD A;  3RZD I;  4A3M I;  4A3B I;  2DE7 A;  3H0G I;  5FLM I;  3GTJ I;  4A3E I;  2R92 I;  3S1Q I;  2NVY I;  4A3I I;  4XX2 A;  3GCF A;  5IP7 I;  1TWF I;  3GTM S;  3CQZ I;  4A3F I;  1USP A;  3GTM I;  4A3C I;  3I4M I;  1TWA I;  3HOY I;  4NBA A; 
#chains in the Genus database with same CATH topology
 5T6B A;  3VTN A;  2V3V A;  4AYB A;  2E9H A;  2K3R A;  3NH5 A;  3CCJ Z;  2LEX A;  2JA5 I;  5IT9 b;  2OTL 1;  1LQL A;  3OW2 Y;  2G2K A;  1VQ8 1;  1QVF Z;  1JJ2 Y;  1Z01 A;  2QRE B;  2PM9 A;  3S2H I;  3VMG A;  3I56 Z;  1VQ5 1;  3CXC Z;  4NBH A;  3G71 Z;  3D6W A;  4E2Z A;  1Q16 A;  3CCS Z;  3CCV Z;  3S1R I;  3J81 b;  3LUS A;  3IX0 A;  4E31 A;  3CC2 1;  3GTP I;  5IT9 f;  2JIM A;  1TFI A;  2VPZ A;  1KD1 1;  2WAQ A;  4MH4 A;  2JA7 I;  5A2Q b;  1WW9 A;  5AN9 F;  2QLV B;  2R93 I;  4Y52 I;  1Q81 2;  2E2H I;  2O53 A;  4BBS I;  3IFU A;  1NP6 A;  2AYD A;  3GTG I;  1VQP Z;  3G4S 1;  2H85 A;  3BG0 B;  4DQY B;  3HOU I;  1X0T A;  4BY7 I;  3I55 1;  1KC8 1;  5D1O B;  3M3Y I;  3JAM b;  1Q7Y 1;  5CM2 M;  2DE6 A;  4DGL A;  1I50 I;  2ZAE B;  2M48 A;  4MON A;  1WZN A;  3S16 I;  1Y1V S;  5D1O A;  4NBD A;  3H0G I;  3GTJ I;  4A3E I;  4E2W A;  4CL1 A;  3GCF A;  1TWF I;  2R6M A;  3GTM S;  2OTL Z;  2QRD B;  2VF1 A;  3JAM f;  1VQ8 Z;  2QRC B;  3CCL 1;  5FLX b;  3HOY I;  1VQ5 Z;  3VMI A;  1ML8 A;  1R9T I;  1VQ9 Z;  1RO0 A;  2Q4Z A;  2IZ4 A;  3S1N I;  3I07 A;  2NVQ I;  3KIH A;  3HOV I;  3GTK I;  3CC2 Z;  1Q81 1;  2HF1 A;  4NFR A;  4E32 A;  3G6E 1;  4A3L I;  3MZK B;  3FQQ A;  3HOW I;  1RO4 A;  2OOY B;  3J80 f;  3GKQ A;  2K5R A;  3G4S Z;  2IZ3 A;  3NH4 A;  3FQM A;  3H3V J;  3M4O I;  3I55 Z;  4EWC A;  3I4N I;  1S7M A;  2JIO A;  2VUG A;  4QTU A;  2W04 A;  3GTL I;  2F4M A;  3PO2 I;  1YJW Z;  2V8K A;  4NBE A;  4E30 A;  2KPI A;  4X6A I;  4NB8 A;  2NVT I;  2YAD A;  3CC7 Z;  1TWG I;  1JWH C;  5C4X I;  2YU9 I;  1QF8 A;  3S1M I;  3CPW Z;  2QA4 1;  2W03 A;  1Z03 A;  2HU9 A;  3Q87 A;  1VQK 1;  5D1P A;  2V8J A;  3CME 1;  2VPW A;  1X3W A;  3D2L A;  3F3P C;  1N8R 2;  4RVD A;  3D9X A;  3S2D I;  2V8I A;  3CCL Z;  3CCU 1;  2JUB A;  4NBC A;  1P9N A;  1Q86 2;  2VPY A;  3OW2 Z;  4RVH A;  5FLM I;  2LFU A;  4XX2 A;  5IP7 I;  2P28 A;  3P5J B;  3GTM I;  2LIY A;  2OTJ 1;  3HKZ A;  1Y8C A;  3F3F C;  4NBA A;  4E2X A;  1YJN 1;  2E2J I;  3G6E Z;  3RZO I;  2VUM I;  1Z02 A;  2RBL A;  2RHB A;  4NBF A;  1K9M 2;  2GU2 A;  3MON A;  2AKL A;  4A3G I;  3NFZ A;  3TE5 B;  2DE5 A;  3TDH B;  1ZH1 A;  1YIJ 1;  4A3D I;  1VQ6 1;  4E33 A;  3CC4 1;  2Q51 A;  2JR6 A;  2NVX I;  4HGY A;  3ESW A;  3S14 I;  1I3Q I;  4NBB A;  1KQS Z;  3J7A 4;  2OOX B;  2QKD A;  3J80 b;  3HOX I;  1YUA A;  2JIR A;  1K83 I;  3MZL B;  1YI2 1;  3NDJ A;  2QR1 B;  2O4H A;  1DL6 A;  3EED A;  2QA4 Z;  1QVF Y;  3CMA 1;  2F4O A;  1VQK Z;  4MD9 A;  1N2F A;  1Y1W I;  1N8R 1;  3CXC Y;  3CME Z;  1VQL 1;  1VQN 1;  2RT9 A;  1SFO I;  2WB1 A;  3U50 C;  3PO3 S;  1Q86 1;  2I3C A;  1RQF A;  1QYP A;  3CCR 1;  5T67 A;  2P3Y A;  1S72 1;  3GTQ I;  3IR7 A;  1YJ9 1;  1RO2 A;  1ZB8 A;  2JS4 A;  1YIT 1;  3CCU Z;  4BY1 I;  2RPR A;  2M6N A;  4MD7 A;  3GTO I;  3CCE 1;  4RVG A;  1ZB9 A;  4Y7N I;  1NUI A;  1VQM 1;  2B63 I;  3IF8 A;  1VQ4 1;  4DK1 A;  4QTT A;  2OTJ Z;  3K7A I;  1VQO 1;  2KI7 B;  1K9M 1;  4RS4 A;  4HH4 A;  1YJN Z;  2JA6 I;  1TWC I;  1M1K 2;  1KRL A;  2DE7 A;  3CD6 1;  3S1Q I;  4A3I I;  2Y0S A;  1M90 2;  4TNU A;  3BG1 B;  1QVG Z;  4A3F I;  1SIW A;  1FDI A;  1QXF A;  1VQ9 1;  1W2B Z;  2OZK A;  2J6A A;  1YIJ Z;  1VQ6 Z;  1VQ7 1;  2QEX 1;  3CCM 1;  3CC4 Z;  4RV9 A;  1YUK A;  4HGZ A;  2BJO A;  1RNI A;  4A93 I;  1WCM I;  4S1T A;  1Y1V I;  1WII A;  4A3J I;  1K8A 2;  3KIF A;  1K73 2;  1JJ2 Z;  1YHQ 1;  4NBG A;  1VLA A;  3CCQ 1;  1PFT A;  2GTH A;  2JIP A;  1YI2 Z;  2EGT A;  2JNY A;  3CCJ 1;  1Q82 2;  3CMA Z;  5LL6 f;  4NB9 A;  3NH8 A;  1X3Z A;  1NJI 2;  1VQL Z;  1VQN Z;  3J81 f;  5IP9 I;  2JMO A;  1KQS Y;  1FDO A;  3CCR Z;  4BBR I;  2JIQ A;  1S72 Z;  2E2I I;  2RIQ A;  4E2Y A;  3I56 1;  3S17 I;  1YJ9 Z;  4NOZ A;  3G71 1;  4NH1 C;  4MXU A;  4A3K I;  1YIT Z;  1YJW 1;  5A2Q f;  1TWH I;  3CCS 1;  3CCV 1;  1I6H I;  3CCE Z;  3CC7 1;  2PK7 A;  1VQM Z;  5C44 I;  1VQ4 Z;  2JA8 I;  3S15 I;  1M1K 1;  3PO3 I;  1VQO Z;  2GTI A;  1M90 1;  4RVF A;  3HOZ I;  3VMH A;  1WJ2 A;  1RLY A;  3CD6 Z;  3VB9 A;  2V45 A;  1KD1 2;  2R7Z I;  4BXX I;  5C3E I;  1VQP 1;  1USP B;  3EER A;  4MRI A;  1AA6 A;  5C4J I;  3QWU A;  1K8A 1;  3FKI I;  1K73 1;  1L1O C;  1VQ7 Z;  4MD8 A;  2QEX Z;  5T64 A;  3RZD I;  3CCM Z;  4A3M I;  4A3B I;  3NDI A;  2R92 I;  2NVY I;  3T4N B;  3CPW Y;  2E7Z A;  2PMZ A;  3CQZ I;  1Q82 1;  1KC8 2;  2VPX A;  1USP A;  1YHQ Z;  2IV2 X;  1QVG Y;  3CCQ Z;  4A3C I;  1Q7Y 2;  1NJI 1;  1W2B Y;  3I4M I;  5FLX f;  1TWA I;  2NAP A; 
#chains in the Genus database with same CATH homology
 5T6B A;  3VTN A;  4AYB A;  2E9H A;  2K3R A;  3NH5 A;  3CCJ Z;  2JA5 I;  5IT9 b;  2OTL 1;  1LQL A;  3OW2 Y;  2G2K A;  1VQ8 1;  1QVF Z;  1JJ2 Y;  1Z01 A;  2QRE B;  2PM9 A;  3S2H I;  3VMG A;  3I56 Z;  1VQ5 1;  3CXC Z;  4NBH A;  3G71 Z;  3D6W A;  4E2Z A;  3CCS Z;  3CCV Z;  3S1R I;  3J81 b;  3LUS A;  3IX0 A;  4E31 A;  3CC2 1;  3GTP I;  5IT9 f;  1TFI A;  1KD1 1;  2WAQ A;  4MH4 A;  2JA7 I;  5A2Q b;  1WW9 A;  5AN9 F;  2QLV B;  2R93 I;  4Y52 I;  1Q81 2;  2E2H I;  2O53 A;  4BBS I;  3IFU A;  1NP6 A;  3GTG I;  1VQP Z;  3G4S 1;  2H85 A;  3BG0 B;  4DQY B;  3HOU I;  1X0T A;  4BY7 I;  3I55 1;  1KC8 1;  5D1O B;  3M3Y I;  3JAM b;  1Q7Y 1;  5CM2 M;  2DE6 A;  4DGL A;  1I50 I;  2ZAE B;  2M48 A;  4MON A;  3S16 I;  1Y1V S;  5D1O A;  4NBD A;  3H0G I;  3GTJ I;  4A3E I;  4E2W A;  4CL1 A;  3GCF A;  1TWF I;  2R6M A;  3GTM S;  2OTL Z;  2QRD B;  2VF1 A;  3JAM f;  1VQ8 Z;  2QRC B;  3CCL 1;  5FLX b;  3HOY I;  1VQ5 Z;  3VMI A;  1ML8 A;  1R9T I;  1VQ9 Z;  1RO0 A;  2Q4Z A;  2IZ4 A;  3S1N I;  3I07 A;  2NVQ I;  3KIH A;  3HOV I;  3GTK I;  3CC2 Z;  1Q81 1;  2HF1 A;  4NFR A;  4E32 A;  3G6E 1;  4A3L I;  3MZK B;  3FQQ A;  3HOW I;  1RO4 A;  2OOY B;  3J80 f;  3GKQ A;  2K5R A;  3G4S Z;  2IZ3 A;  3NH4 A;  3FQM A;  3H3V J;  3M4O I;  3I55 Z;  4EWC A;  3I4N I;  1S7M A;  2VUG A;  4QTU A;  2W04 A;  3GTL I;  2F4M A;  3PO2 I;  1YJW Z;  2V8K A;  4NBE A;  4E30 A;  2KPI A;  4X6A I;  4NB8 A;  2NVT I;  2YAD A;  3CC7 Z;  1TWG I;  1JWH C;  5C4X I;  2YU9 I;  1QF8 A;  3S1M I;  3CPW Z;  2QA4 1;  2W03 A;  1Z03 A;  2HU9 A;  3Q87 A;  1VQK 1;  5D1P A;  2V8J A;  3CME 1;  1X3W A;  3F3P C;  1N8R 2;  4RVD A;  3D9X A;  3S2D I;  2V8I A;  3CCL Z;  3CCU 1;  2JUB A;  4NBC A;  1P9N A;  1Q86 2;  3OW2 Z;  4RVH A;  5FLM I;  2LFU A;  4XX2 A;  5IP7 I;  2P28 A;  3P5J B;  3GTM I;  2LIY A;  2OTJ 1;  3HKZ A;  3F3F C;  4NBA A;  4E2X A;  1YJN 1;  2E2J I;  3G6E Z;  3RZO I;  2VUM I;  1Z02 A;  2RBL A;  2RHB A;  4NBF A;  1K9M 2;  2GU2 A;  3MON A;  2AKL A;  4A3G I;  3NFZ A;  3TE5 B;  2DE5 A;  3TDH B;  1ZH1 A;  1YIJ 1;  4A3D I;  1VQ6 1;  4E33 A;  3CC4 1;  2Q51 A;  2JR6 A;  2NVX I;  4HGY A;  3ESW A;  3S14 I;  1I3Q I;  4NBB A;  1KQS Z;  3J7A 4;  2OOX B;  2QKD A;  3J80 b;  3HOX I;  1YUA A;  1K83 I;  3MZL B;  1YI2 1;  3NDJ A;  2QR1 B;  2O4H A;  1DL6 A;  3EED A;  2QA4 Z;  1QVF Y;  3CMA 1;  2F4O A;  1VQK Z;  4MD9 A;  1N2F A;  1Y1W I;  1N8R 1;  3CXC Y;  3CME Z;  1VQL 1;  1VQN 1;  2RT9 A;  1SFO I;  2WB1 A;  3U50 C;  3PO3 S;  1Q86 1;  2I3C A;  1RQF A;  1QYP A;  3CCR 1;  5T67 A;  2P3Y A;  1S72 1;  3GTQ I;  1YJ9 1;  1RO2 A;  1ZB8 A;  2JS4 A;  1YIT 1;  3CCU Z;  4BY1 I;  2RPR A;  2M6N A;  4MD7 A;  3GTO I;  3CCE 1;  4RVG A;  1ZB9 A;  4Y7N I;  1NUI A;  1VQM 1;  2B63 I;  3IF8 A;  1VQ4 1;  4DK1 A;  4QTT A;  2OTJ Z;  3K7A I;  1VQO 1;  2KI7 B;  1K9M 1;  4RS4 A;  4HH4 A;  1YJN Z;  2JA6 I;  1TWC I;  1M1K 2;  1KRL A;  2DE7 A;  3CD6 1;  3S1Q I;  4A3I I;  2Y0S A;  1M90 2;  4TNU A;  3BG1 B;  1QVG Z;  4A3F I;  1VQ9 1;  1W2B Z;  2OZK A;  2J6A A;  1YIJ Z;  1VQ6 Z;  1VQ7 1;  2QEX 1;  3CCM 1;  3CC4 Z;  4RV9 A;  1YUK A;  4HGZ A;  2BJO A;  1RNI A;  4A93 I;  1WCM I;  4S1T A;  1Y1V I;  1WII A;  4A3J I;  1K8A 2;  3KIF A;  1K73 2;  1JJ2 Z;  1YHQ 1;  4NBG A;  1VLA A;  3CCQ 1;  1PFT A;  2GTH A;  1YI2 Z;  2EGT A;  2JNY A;  3CCJ 1;  1Q82 2;  3CMA Z;  5LL6 f;  4NB9 A;  3NH8 A;  1X3Z A;  1NJI 2;  1VQL Z;  1VQN Z;  3J81 f;  5IP9 I;  2JMO A;  1KQS Y;  3CCR Z;  4BBR I;  1S72 Z;  2E2I I;  2RIQ A;  4E2Y A;  3I56 1;  3S17 I;  1YJ9 Z;  4NOZ A;  3G71 1;  4NH1 C;  4MXU A;  4A3K I;  1YIT Z;  1YJW 1;  5A2Q f;  1TWH I;  3CCS 1;  3CCV 1;  1I6H I;  3CCE Z;  3CC7 1;  2PK7 A;  1VQM Z;  5C44 I;  1VQ4 Z;  2JA8 I;  3S15 I;  1M1K 1;  3PO3 I;  1VQO Z;  2GTI A;  1M90 1;  4RVF A;  3HOZ I;  3VMH A;  1RLY A;  3CD6 Z;  3VB9 A;  1KD1 2;  2R7Z I;  4BXX I;  5C3E I;  1VQP 1;  1USP B;  3EER A;  4MRI A;  5C4J I;  3QWU A;  1K8A 1;  3FKI I;  1K73 1;  1L1O C;  1VQ7 Z;  4MD8 A;  2QEX Z;  5T64 A;  3RZD I;  3CCM Z;  4A3M I;  4A3B I;  3NDI A;  2R92 I;  2NVY I;  3T4N B;  3CPW Y;  2PMZ A;  3CQZ I;  1Q82 1;  1KC8 2;  1USP A;  1YHQ Z;  1QVG Y;  3CCQ Z;  4A3C I;  1Q7Y 2;  1NJI 1;  1W2B Y;  3I4M I;  5FLX f;  1TWA I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...