3J80f

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
69
structure length
69
Chain Sequence
KKVYTTPKKIRHKHKKVKLAVLNYYKVDDEGKVAKLRKECPNCGPGIFLANHGDRFYCGKCHSTFATQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 2
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF00240 ubiquitin Ubiquitin family
f PF01599 Ribosomal_S27 Ribosomal protein S27a
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.660 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3j80f00
5IT9f 3JAMf 3J80f 5A2Qf 3J81f 5FLXf
chains in the Genus database with same CATH superfamily
2JMOA 2F4OA 2NVTI 2K3RA 3CMAZ 1VQ6Z 2V45A 4A3JI 3CC2Z 1KD11 1KQSZ 2O4HA 4HH4A 1KD12 1QVGZ 2Q4ZA 2OOXB 1M1K1 5FLXb 1K732 1K9M2 2JA5I 4RS4A 3GCFA 2AKLA 2LIYA 1Z02A 3GKQA 4QTUA 4NB9A 1YJWZ 3G4S1 5A2Qb 1QF8A 1VQ81 3J7A4 1VQ61 1Q7Y1 2HU9A 1Z01A 1DL6A 3ESWA 2QKDA 3CC7Z 1YHQZ 1W2BZ 4DK1A 2W04A 4MD7A 4A3BI 1N2FA 1VQLZ 2E2JI 3HOVI 1K8A2 2VPXA 1QVGY 1Q811 3KIFA 1R9TI 4A3KI 3OW2Z 1NP6A 2RBLA 1Q812 3K7AI 4BBRI 3J81f 2M48A 1VQ4Z 3U50C 3GTKI 1Q821 1YUKA 3RZDI 1YJW1 4RVFA 4Y7NI 1KRLA 3FKII 1L1OC 1TWHI 1Q822 3PO2I 3CCMZ 1S7MA 3CC71 3CCLZ 4MD8A 2RT9A 1VQL1 3D9XA 3HOWI 5C3EI 3OW2Y 2E9HA 1VQ41 3CCQZ 3I07A 3VMIA 3H3VJ 3S14I 2DE5A 4NBCA 3CCM1 3GTQI 2E2HI 3CCSZ 3NDIA 5A2Qf 3CCL1 1VQ5Z 3CCJZ 2R92I 2NAPA 2JA6I 2ZAEB 1ML8A 3MZKB 2QA41 2K5RA 5D1OB 2VF1A 1JJ2Z 4E2YA 4NBDA 3FQMA 4NOZA 2EGTA 3CCQ1 1TWCI 3M4OI 1WZNA 2Q51A 5T67A 5T6BA 2VPWA 3CQZI 1X3ZA 3JAMb 1VQ51 3CCJ1 3LUSA 2JIMA 3G4SZ 1RO2A 1TWGI 1RO4A 1VQ8Z 3D2LA 3Q87A 1QXFA 3IFUA 2NVXI 3CXCZ 2WAQA 2RHBA 3EERA 3I551 2V8KA 3QWUA 2P28A 2LEXA 3EEDA 2H85A 4MONA 3GTMS 1M1K2 1NUIA 3HOXI 4A3II 4BY7I 4HGYA 1VQPZ 1YUAA 2BJOA 2QRCB 4DQYB 3IF8A 2RPRA 1VLAA 1P9NA 4MH4A 3J80b 3I4NI 3GTJI 2QEXZ 3D6WA 1Q7Y2 3NFZA 2VUMI 3KIHA 1KQSY 2KPIA 3TE5B 3S2HI 5IP7I 4NFRA 3IR7A 1PFTA 3CD6Z 3S1QI 1VQM1 2E2II 1VQP1 3HOYI 4S1TA 3S1MI 4NBEA 3HKZA 2IZ3A 1ZB8A 2DE6A 2OOYB 4A3CI 5C44I 3JAMf 1TWFI 2NVYI 2QEX1 2KI7B 4A3DI 1YJNZ 1Y8CA 1QVFZ 5IT9b 1YIT1 2NVQI 1W2BY 2QA4Z 1WJ2A 2QR1B 3BG1B 3CD61 1NJI1 1M901 3I561 2WB1A 2OTLZ 4MRIA 5FLXf 1M902 2VUGA 1QYPA 1USPB 2GTIA 2YU9I 3F3PC 5AN9F 1WW9A 1VQO1 3MZLB 1YJN1 1TWAI 2OZKA 3NH8A 3CCEZ 3NH5A 2GTHA 1RQFA 2AYDA 4QTTA 2JA7I 5CM2M 3I55Z 5D1PA 2OTL1 3I4MI 1YI21 4NB8A 2GU2A 5LL6f 5D1OA 2JR6A 3P5JB 4NBAA 3NDJA 4NBFA 1VQN1 3CCE1 1Z03A 2JUBA 3GTPI 1KC81 3MONA 5IT9f 3J81b 4XX2A 4A3LI 1KC82 1JJ2Y 1YJ9Z 2JS4A 1VQ7Z 2F4MA 3NH4A 4A3MI 2LFUA 1AA6A 3F3FC 1TFIA 3CPWZ 4NBBA 2VPYA 2E7ZA 5C4XI 4RVDA 2QRDB 2M6NA 2V8JA 1VQMZ 2QLVB 3IX0A 3S1NI 3S16I 1VQK1 4RVHA 3S2DI 3BG0B 4Y52I 1LQLA 3S17I 1SIWA 3FQQA 3CCUZ 2V3VA 1K731 1K9M1 2R93I 3VMHA 4DGLA 4EWCA 3CXCY 4A3EI 1YJ91 1VQ71 4TNUA 3CCVZ 1YITZ 1VQ9Z 3GTMI 4E30A 2OTJZ 2Y0SA 3VB9A 1ZH1A 3G71Z 3S1RI 2JIRA 3VTNA 3CPWY 2PM9A 3I56Z 3CCRZ 5T64A 3HOZI 2RIQA 3CMA1 3TDHB 3S15I 4RV9A 1ZB9A 4MD9A 3H0GI 4E31A 3CC21 1Q16A 4E2ZA 1N8R1 1VQOZ 4NBHA 1K8A1 1N8R2 3GTLI 3CCU1 2JNYA 3VMGA 1Y1VS 2G2KA 3CCV1 3RZOI 3CMEZ 1VQ91 2OTJ1 2QREB 2JA8I 4RVGA 4HGZA 3GTOI 3G711 1YIJZ 3GTGI 4E33A 4CL1A 1WIIA 2IZ4A 3G6EZ 1RLYA 3CCR1 1FDOA 1NJI2 4A93I 1YI2Z 1K83I 4E2XA 1SFOI 1YHQ1 3CC4Z 2I3CA 2R7ZI 4NH1C 4X6AI 4A3FI 2DE7A 1Y1VI 5IP9I 3J80f 2J6AA 3HOUI 2YADA 2P3YA 3CME1 1RNIA 1VQNZ 1QVFY 1Y1WI 5FLMI 1I50I 1FDIA 1I3QI 4E2WA 1YIJ1 1Q861 1USPA 3G6E1 1Q862 4BBSI 4NBGA 1S72Z 4BXXI 2V8IA 3PO3S 1RO0A 1X0TA 3CC41 1X3WA 2JIOA 2R6MA 2HF1A 2O53A 2VPZA 4A3GI 2JIPA 3T4NB 1VQKZ 1I6HI 2IV2X 4MXUA 1WCMI 2W03A 4BY1I 3M3YI 2JIQA 4E32A 1JWHC 2B63I 3PO3I 2PK7A 3CCS1 1S721 4AYBA 5C4JI 2PMZA
chains in the Genus database with same CATH topology
2JMOA 2F4OA 2NVTI 2K3RA 3CMAZ 1VQ6Z 4A3JI 3CC2Z 1KD11 1KQSZ 2O4HA 4HH4A 1KD12 1QVGZ 2Q4ZA 2OOXB 1M1K1 5FLXb 1K732 1K9M2 2JA5I 4RS4A 3GCFA 2AKLA 2LIYA 1Z02A 3GKQA 4QTUA 4NB9A 1YJWZ 3G4S1 5A2Qb 1QF8A 1VQ81 3J7A4 1VQ61 1Q7Y1 2HU9A 1Z01A 1DL6A 3ESWA 2QKDA 3CC7Z 1YHQZ 1W2BZ 4DK1A 2W04A 4MD7A 4A3BI 1N2FA 1VQLZ 2E2JI 3HOVI 1K8A2 1QVGY 1Q811 3KIFA 1R9TI 4A3KI 3OW2Z 1NP6A 2RBLA 1Q812 3K7AI 4BBRI 3J81f 2M48A 1VQ4Z 3U50C 3GTKI 1Q821 1YUKA 3RZDI 1YJW1 4RVFA 4Y7NI 1KRLA 3FKII 1L1OC 1TWHI 1Q822 3PO2I 3CCMZ 1S7MA 3CC71 3CCLZ 4MD8A 2RT9A 1VQL1 3D9XA 3HOWI 5C3EI 3OW2Y 2E9HA 1VQ41 3CCQZ 3I07A 3VMIA 3H3VJ 3S14I 2DE5A 4NBCA 3CCM1 3GTQI 2E2HI 3CCSZ 3NDIA 5A2Qf 3CCL1 1VQ5Z 3CCJZ 2R92I 2JA6I 2ZAEB 1ML8A 3MZKB 2QA41 2K5RA 5D1OB 2VF1A 1JJ2Z 4E2YA 4NBDA 3FQMA 4NOZA 2EGTA 3CCQ1 1TWCI 3M4OI 2Q51A 5T67A 5T6BA 3CQZI 1X3ZA 3JAMb 1VQ51 3CCJ1 3LUSA 3G4SZ 1RO2A 1TWGI 1RO4A 1VQ8Z 3Q87A 3IFUA 2NVXI 3CXCZ 2WAQA 2RHBA 3EERA 3I551 2V8KA 3QWUA 2P28A 3EEDA 2H85A 4MONA 3GTMS 1M1K2 1NUIA 3HOXI 4A3II 4BY7I 4HGYA 1VQPZ 1YUAA 2BJOA 2QRCB 4DQYB 3IF8A 2RPRA 1VLAA 1P9NA 4MH4A 3J80b 3I4NI 3GTJI 2QEXZ 3D6WA 1Q7Y2 3NFZA 2VUMI 3KIHA 1KQSY 2KPIA 3TE5B 3S2HI 5IP7I 4NFRA 1PFTA 3CD6Z 3S1QI 1VQM1 2E2II 1VQP1 3HOYI 4S1TA 3S1MI 4NBEA 3HKZA 2IZ3A 1ZB8A 2DE6A 2OOYB 4A3CI 5C44I 3JAMf 1TWFI 2NVYI 2QEX1 2KI7B 4A3DI 1YJNZ 1QVFZ 5IT9b 1YIT1 2NVQI 1W2BY 2QA4Z 2QR1B 3BG1B 3CD61 1NJI1 1M901 3I561 2WB1A 2OTLZ 4MRIA 5FLXf 1M902 2VUGA 1QYPA 1USPB 2GTIA 2YU9I 3F3PC 5AN9F 1WW9A 1VQO1 3MZLB 1YJN1 1TWAI 2OZKA 3NH8A 3CCEZ 3NH5A 2GTHA 1RQFA 4QTTA 2JA7I 5CM2M 3I55Z 5D1PA 2OTL1 3I4MI 1YI21 4NB8A 2GU2A 5LL6f 5D1OA 2JR6A 3P5JB 4NBAA 3NDJA 4NBFA 1VQN1 3CCE1 1Z03A 2JUBA 3GTPI 1KC81 3MONA 5IT9f 3J81b 4XX2A 4A3LI 1KC82 1JJ2Y 1YJ9Z 2JS4A 1VQ7Z 2F4MA 3NH4A 4A3MI 2LFUA 3F3FC 1TFIA 3CPWZ 4NBBA 5C4XI 4RVDA 2QRDB 2M6NA 2V8JA 1VQMZ 2QLVB 3IX0A 3S1NI 3S16I 1VQK1 4RVHA 3S2DI 3BG0B 4Y52I 1LQLA 3S17I 3FQQA 3CCUZ 1K731 1K9M1 2R93I 3VMHA 4DGLA 4EWCA 3CXCY 4A3EI 1YJ91 1VQ71 4TNUA 3CCVZ 1YITZ 1VQ9Z 3GTMI 4E30A 2OTJZ 2Y0SA 3VB9A 1ZH1A 3G71Z 3S1RI 3VTNA 3CPWY 2PM9A 3I56Z 3CCRZ 5T64A 3HOZI 2RIQA 3CMA1 3TDHB 3S15I 4RV9A 1ZB9A 4MD9A 3H0GI 4E31A 3CC21 4E2ZA 1N8R1 1VQOZ 4NBHA 1K8A1 1N8R2 3GTLI 3CCU1 2JNYA 3VMGA 1Y1VS 2G2KA 3CCV1 3RZOI 3CMEZ 1VQ91 2OTJ1 2QREB 2JA8I 4RVGA 4HGZA 3GTOI 3G711 1YIJZ 3GTGI 4E33A 4CL1A 1WIIA 2IZ4A 3G6EZ 1RLYA 3CCR1 1NJI2 4A93I 1YI2Z 1K83I 4E2XA 1SFOI 1YHQ1 3CC4Z 2I3CA 2R7ZI 4NH1C 4X6AI 4A3FI 2DE7A 1Y1VI 5IP9I 3J80f 2J6AA 3HOUI 2YADA 2P3YA 3CME1 1RNIA 1VQNZ 1QVFY 1Y1WI 5FLMI 1I50I 1I3QI 4E2WA 1YIJ1 1Q861 1USPA 3G6E1 1Q862 4BBSI 4NBGA 1S72Z 4BXXI 2V8IA 3PO3S 1RO0A 1X0TA 3CC41 1X3WA 2R6MA 2HF1A 2O53A 4A3GI 3T4NB 1VQKZ 1I6HI 4MXUA 1WCMI 2W03A 4BY1I 3M3YI 4E32A 1JWHC 2B63I 3PO3I 2PK7A 3CCS1 1S721 4AYBA 5C4JI 2PMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IT9 f;  3JAM f;  3J80 f;  5A2Q f;  3J81 f;  5FLX f; 
#chains in the Genus database with same CATH topology
 2JMO A;  2F4O A;  2NVT I;  2K3R A;  3CMA Z;  1VQ6 Z;  2V45 A;  4A3J I;  3CC2 Z;  1KD1 1;  1KQS Z;  2O4H A;  4HH4 A;  1KD1 2;  1QVG Z;  2Q4Z A;  2OOX B;  1M1K 1;  5FLX b;  1K73 2;  1K9M 2;  2JA5 I;  4RS4 A;  3GCF A;  2AKL A;  2LIY A;  1Z02 A;  3GKQ A;  4QTU A;  4NB9 A;  1YJW Z;  3G4S 1;  5A2Q b;  1QF8 A;  1VQ8 1;  3J7A 4;  1VQ6 1;  1Q7Y 1;  2HU9 A;  1Z01 A;  1DL6 A;  3ESW A;  2QKD A;  3CC7 Z;  1YHQ Z;  1W2B Z;  4DK1 A;  2W04 A;  4MD7 A;  4A3B I;  1N2F A;  1VQL Z;  2E2J I;  3HOV I;  1K8A 2;  2VPX A;  1QVG Y;  1Q81 1;  3KIF A;  1R9T I;  4A3K I;  3OW2 Z;  1NP6 A;  2RBL A;  1Q81 2;  3K7A I;  4BBR I;  3J81 f;  2M48 A;  1VQ4 Z;  3U50 C;  3GTK I;  1Q82 1;  1YUK A;  3RZD I;  1YJW 1;  4RVF A;  4Y7N I;  1KRL A;  3FKI I;  1L1O C;  1TWH I;  1Q82 2;  3PO2 I;  3CCM Z;  1S7M A;  3CC7 1;  3CCL Z;  4MD8 A;  2RT9 A;  1VQL 1;  3D9X A;  3HOW I;  5C3E I;  3OW2 Y;  2E9H A;  1VQ4 1;  3CCQ Z;  3I07 A;  3VMI A;  3H3V J;  3S14 I;  2DE5 A;  4NBC A;  3CCM 1;  3GTQ I;  2E2H I;  3CCS Z;  3NDI A;  5A2Q f;  3CCL 1;  1VQ5 Z;  3CCJ Z;  2R92 I;  2NAP A;  2JA6 I;  2ZAE B;  1ML8 A;  3MZK B;  2QA4 1;  2K5R A;  5D1O B;  2VF1 A;  1JJ2 Z;  4E2Y A;  4NBD A;  3FQM A;  4NOZ A;  2EGT A;  3CCQ 1;  1TWC I;  3M4O I;  1WZN A;  2Q51 A;  5T67 A;  5T6B A;  2VPW A;  3CQZ I;  1X3Z A;  3JAM b;  1VQ5 1;  3CCJ 1;  3LUS A;  2JIM A;  3G4S Z;  1RO2 A;  1TWG I;  1RO4 A;  1VQ8 Z;  3D2L A;  3Q87 A;  1QXF A;  3IFU A;  2NVX I;  3CXC Z;  2WAQ A;  2RHB A;  3EER A;  3I55 1;  2V8K A;  3QWU A;  2P28 A;  2LEX A;  3EED A;  2H85 A;  4MON A;  3GTM S;  1M1K 2;  1NUI A;  3HOX I;  4A3I I;  4BY7 I;  4HGY A;  1VQP Z;  1YUA A;  2BJO A;  2QRC B;  4DQY B;  3IF8 A;  2RPR A;  1VLA A;  1P9N A;  4MH4 A;  3J80 b;  3I4N I;  3GTJ I;  2QEX Z;  3D6W A;  1Q7Y 2;  3NFZ A;  2VUM I;  3KIH A;  1KQS Y;  2KPI A;  3TE5 B;  3S2H I;  5IP7 I;  4NFR A;  3IR7 A;  1PFT A;  3CD6 Z;  3S1Q I;  1VQM 1;  2E2I I;  1VQP 1;  3HOY I;  4S1T A;  3S1M I;  4NBE A;  3HKZ A;  2IZ3 A;  1ZB8 A;  2DE6 A;  2OOY B;  4A3C I;  5C44 I;  3JAM f;  1TWF I;  2NVY I;  2QEX 1;  2KI7 B;  4A3D I;  1YJN Z;  1Y8C A;  1QVF Z;  5IT9 b;  1YIT 1;  2NVQ I;  1W2B Y;  2QA4 Z;  1WJ2 A;  2QR1 B;  3BG1 B;  3CD6 1;  1NJI 1;  1M90 1;  3I56 1;  2WB1 A;  2OTL Z;  4MRI A;  5FLX f;  1M90 2;  2VUG A;  1QYP A;  1USP B;  2GTI A;  2YU9 I;  3F3P C;  5AN9 F;  1WW9 A;  1VQO 1;  3MZL B;  1YJN 1;  1TWA I;  2OZK A;  3NH8 A;  3CCE Z;  3NH5 A;  2GTH A;  1RQF A;  2AYD A;  4QTT A;  2JA7 I;  5CM2 M;  3I55 Z;  5D1P A;  2OTL 1;  3I4M I;  1YI2 1;  4NB8 A;  2GU2 A;  5LL6 f;  5D1O A;  2JR6 A;  3P5J B;  4NBA A;  3NDJ A;  4NBF A;  1VQN 1;  3CCE 1;  1Z03 A;  2JUB A;  3GTP I;  1KC8 1;  3MON A;  5IT9 f;  3J81 b;  4XX2 A;  4A3L I;  1KC8 2;  1JJ2 Y;  1YJ9 Z;  2JS4 A;  1VQ7 Z;  2F4M A;  3NH4 A;  4A3M I;  2LFU A;  1AA6 A;  3F3F C;  1TFI A;  3CPW Z;  4NBB A;  2VPY A;  2E7Z A;  5C4X I;  4RVD A;  2QRD B;  2M6N A;  2V8J A;  1VQM Z;  2QLV B;  3IX0 A;  3S1N I;  3S16 I;  1VQK 1;  4RVH A;  3S2D I;  3BG0 B;  4Y52 I;  1LQL A;  3S17 I;  1SIW A;  3FQQ A;  3CCU Z;  2V3V A;  1K73 1;  1K9M 1;  2R93 I;  3VMH A;  4DGL A;  4EWC A;  3CXC Y;  4A3E I;  1YJ9 1;  1VQ7 1;  4TNU A;  3CCV Z;  1YIT Z;  1VQ9 Z;  3GTM I;  4E30 A;  2OTJ Z;  2Y0S A;  3VB9 A;  1ZH1 A;  3G71 Z;  3S1R I;  2JIR A;  3VTN A;  3CPW Y;  2PM9 A;  3I56 Z;  3CCR Z;  5T64 A;  3HOZ I;  2RIQ A;  3CMA 1;  3TDH B;  3S15 I;  4RV9 A;  1ZB9 A;  4MD9 A;  3H0G I;  4E31 A;  3CC2 1;  1Q16 A;  4E2Z A;  1N8R 1;  1VQO Z;  4NBH A;  1K8A 1;  1N8R 2;  3GTL I;  3CCU 1;  2JNY A;  3VMG A;  1Y1V S;  2G2K A;  3CCV 1;  3RZO I;  3CME Z;  1VQ9 1;  2OTJ 1;  2QRE B;  2JA8 I;  4RVG A;  4HGZ A;  3GTO I;  3G71 1;  1YIJ Z;  3GTG I;  4E33 A;  4CL1 A;  1WII A;  2IZ4 A;  3G6E Z;  1RLY A;  3CCR 1;  1FDO A;  1NJI 2;  4A93 I;  1YI2 Z;  1K83 I;  4E2X A;  1SFO I;  1YHQ 1;  3CC4 Z;  2I3C A;  2R7Z I;  4NH1 C;  4X6A I;  4A3F I;  2DE7 A;  1Y1V I;  5IP9 I;  3J80 f;  2J6A A;  3HOU I;  2YAD A;  2P3Y A;  3CME 1;  1RNI A;  1VQN Z;  1QVF Y;  1Y1W I;  5FLM I;  1I50 I;  1FDI A;  1I3Q I;  4E2W A;  1YIJ 1;  1Q86 1;  1USP A;  3G6E 1;  1Q86 2;  4BBS I;  4NBG A;  1S72 Z;  4BXX I;  2V8I A;  3PO3 S;  1RO0 A;  1X0T A;  3CC4 1;  1X3W A;  2JIO A;  2R6M A;  2HF1 A;  2O53 A;  2VPZ A;  4A3G I;  2JIP A;  3T4N B;  1VQK Z;  1I6H I;  2IV2 X;  4MXU A;  1WCM I;  2W03 A;  4BY1 I;  3M3Y I;  2JIQ A;  4E32 A;  1JWH C;  2B63 I;  3PO3 I;  2PK7 A;  3CCS 1;  1S72 1;  4AYB A;  5C4J I;  2PMZ A; 
#chains in the Genus database with same CATH homology
 2JMO A;  2F4O A;  2NVT I;  2K3R A;  3CMA Z;  1VQ6 Z;  4A3J I;  3CC2 Z;  1KD1 1;  1KQS Z;  2O4H A;  4HH4 A;  1KD1 2;  1QVG Z;  2Q4Z A;  2OOX B;  1M1K 1;  5FLX b;  1K73 2;  1K9M 2;  2JA5 I;  4RS4 A;  3GCF A;  2AKL A;  2LIY A;  1Z02 A;  3GKQ A;  4QTU A;  4NB9 A;  1YJW Z;  3G4S 1;  5A2Q b;  1QF8 A;  1VQ8 1;  3J7A 4;  1VQ6 1;  1Q7Y 1;  2HU9 A;  1Z01 A;  1DL6 A;  3ESW A;  2QKD A;  3CC7 Z;  1YHQ Z;  1W2B Z;  4DK1 A;  2W04 A;  4MD7 A;  4A3B I;  1N2F A;  1VQL Z;  2E2J I;  3HOV I;  1K8A 2;  1QVG Y;  1Q81 1;  3KIF A;  1R9T I;  4A3K I;  3OW2 Z;  1NP6 A;  2RBL A;  1Q81 2;  3K7A I;  4BBR I;  3J81 f;  2M48 A;  1VQ4 Z;  3U50 C;  3GTK I;  1Q82 1;  1YUK A;  3RZD I;  1YJW 1;  4RVF A;  4Y7N I;  1KRL A;  3FKI I;  1L1O C;  1TWH I;  1Q82 2;  3PO2 I;  3CCM Z;  1S7M A;  3CC7 1;  3CCL Z;  4MD8 A;  2RT9 A;  1VQL 1;  3D9X A;  3HOW I;  5C3E I;  3OW2 Y;  2E9H A;  1VQ4 1;  3CCQ Z;  3I07 A;  3VMI A;  3H3V J;  3S14 I;  2DE5 A;  4NBC A;  3CCM 1;  3GTQ I;  2E2H I;  3CCS Z;  3NDI A;  5A2Q f;  3CCL 1;  1VQ5 Z;  3CCJ Z;  2R92 I;  2JA6 I;  2ZAE B;  1ML8 A;  3MZK B;  2QA4 1;  2K5R A;  5D1O B;  2VF1 A;  1JJ2 Z;  4E2Y A;  4NBD A;  3FQM A;  4NOZ A;  2EGT A;  3CCQ 1;  1TWC I;  3M4O I;  2Q51 A;  5T67 A;  5T6B A;  3CQZ I;  1X3Z A;  3JAM b;  1VQ5 1;  3CCJ 1;  3LUS A;  3G4S Z;  1RO2 A;  1TWG I;  1RO4 A;  1VQ8 Z;  3Q87 A;  3IFU A;  2NVX I;  3CXC Z;  2WAQ A;  2RHB A;  3EER A;  3I55 1;  2V8K A;  3QWU A;  2P28 A;  3EED A;  2H85 A;  4MON A;  3GTM S;  1M1K 2;  1NUI A;  3HOX I;  4A3I I;  4BY7 I;  4HGY A;  1VQP Z;  1YUA A;  2BJO A;  2QRC B;  4DQY B;  3IF8 A;  2RPR A;  1VLA A;  1P9N A;  4MH4 A;  3J80 b;  3I4N I;  3GTJ I;  2QEX Z;  3D6W A;  1Q7Y 2;  3NFZ A;  2VUM I;  3KIH A;  1KQS Y;  2KPI A;  3TE5 B;  3S2H I;  5IP7 I;  4NFR A;  1PFT A;  3CD6 Z;  3S1Q I;  1VQM 1;  2E2I I;  1VQP 1;  3HOY I;  4S1T A;  3S1M I;  4NBE A;  3HKZ A;  2IZ3 A;  1ZB8 A;  2DE6 A;  2OOY B;  4A3C I;  5C44 I;  3JAM f;  1TWF I;  2NVY I;  2QEX 1;  2KI7 B;  4A3D I;  1YJN Z;  1QVF Z;  5IT9 b;  1YIT 1;  2NVQ I;  1W2B Y;  2QA4 Z;  2QR1 B;  3BG1 B;  3CD6 1;  1NJI 1;  1M90 1;  3I56 1;  2WB1 A;  2OTL Z;  4MRI A;  5FLX f;  1M90 2;  2VUG A;  1QYP A;  1USP B;  2GTI A;  2YU9 I;  3F3P C;  5AN9 F;  1WW9 A;  1VQO 1;  3MZL B;  1YJN 1;  1TWA I;  2OZK A;  3NH8 A;  3CCE Z;  3NH5 A;  2GTH A;  1RQF A;  4QTT A;  2JA7 I;  5CM2 M;  3I55 Z;  5D1P A;  2OTL 1;  3I4M I;  1YI2 1;  4NB8 A;  2GU2 A;  5LL6 f;  5D1O A;  2JR6 A;  3P5J B;  4NBA A;  3NDJ A;  4NBF A;  1VQN 1;  3CCE 1;  1Z03 A;  2JUB A;  3GTP I;  1KC8 1;  3MON A;  5IT9 f;  3J81 b;  4XX2 A;  4A3L I;  1KC8 2;  1JJ2 Y;  1YJ9 Z;  2JS4 A;  1VQ7 Z;  2F4M A;  3NH4 A;  4A3M I;  2LFU A;  3F3F C;  1TFI A;  3CPW Z;  4NBB A;  5C4X I;  4RVD A;  2QRD B;  2M6N A;  2V8J A;  1VQM Z;  2QLV B;  3IX0 A;  3S1N I;  3S16 I;  1VQK 1;  4RVH A;  3S2D I;  3BG0 B;  4Y52 I;  1LQL A;  3S17 I;  3FQQ A;  3CCU Z;  1K73 1;  1K9M 1;  2R93 I;  3VMH A;  4DGL A;  4EWC A;  3CXC Y;  4A3E I;  1YJ9 1;  1VQ7 1;  4TNU A;  3CCV Z;  1YIT Z;  1VQ9 Z;  3GTM I;  4E30 A;  2OTJ Z;  2Y0S A;  3VB9 A;  1ZH1 A;  3G71 Z;  3S1R I;  3VTN A;  3CPW Y;  2PM9 A;  3I56 Z;  3CCR Z;  5T64 A;  3HOZ I;  2RIQ A;  3CMA 1;  3TDH B;  3S15 I;  4RV9 A;  1ZB9 A;  4MD9 A;  3H0G I;  4E31 A;  3CC2 1;  4E2Z A;  1N8R 1;  1VQO Z;  4NBH A;  1K8A 1;  1N8R 2;  3GTL I;  3CCU 1;  2JNY A;  3VMG A;  1Y1V S;  2G2K A;  3CCV 1;  3RZO I;  3CME Z;  1VQ9 1;  2OTJ 1;  2QRE B;  2JA8 I;  4RVG A;  4HGZ A;  3GTO I;  3G71 1;  1YIJ Z;  3GTG I;  4E33 A;  4CL1 A;  1WII A;  2IZ4 A;  3G6E Z;  1RLY A;  3CCR 1;  1NJI 2;  4A93 I;  1YI2 Z;  1K83 I;  4E2X A;  1SFO I;  1YHQ 1;  3CC4 Z;  2I3C A;  2R7Z I;  4NH1 C;  4X6A I;  4A3F I;  2DE7 A;  1Y1V I;  5IP9 I;  3J80 f;  2J6A A;  3HOU I;  2YAD A;  2P3Y A;  3CME 1;  1RNI A;  1VQN Z;  1QVF Y;  1Y1W I;  5FLM I;  1I50 I;  1I3Q I;  4E2W A;  1YIJ 1;  1Q86 1;  1USP A;  3G6E 1;  1Q86 2;  4BBS I;  4NBG A;  1S72 Z;  4BXX I;  2V8I A;  3PO3 S;  1RO0 A;  1X0T A;  3CC4 1;  1X3W A;  2R6M A;  2HF1 A;  2O53 A;  4A3G I;  3T4N B;  1VQK Z;  1I6H I;  4MXU A;  1WCM I;  2W03 A;  4BY1 I;  3M3Y I;  4E32 A;  1JWH C;  2B63 I;  3PO3 I;  2PK7 A;  3CCS 1;  1S72 1;  4AYB A;  5C4J I;  2PMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...