3J80f

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
69
structure length
69
Chain Sequence
KKVYTTPKKIRHKHKKVKLAVLNYYKVDDEGKVAKLRKECPNCGPGIFLANHGDRFYCGKCHSTFATQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ribosome
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 2
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF00240 ubiquitin Ubiquitin family
f PF01599 Ribosomal_S27 Ribosomal protein S27a
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.660 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3j80f00
3JAMf 3J81f 5A2Qf 5FLXf 5IT9f 3J80f
chains in the Genus database with same CATH superfamily
5D1OB 3M3YI 2RHBA 3CCQZ 3PO3S 3CQZI 3GTOI 2OTL1 2LIYA 2JA7I 2RPRA 4E2ZA 1X3ZA 2LFUA 1S721 2K3RA 3H3VJ 2Y0SA 1VQPZ 1I50I 2LEXA 2JIOA 3G4SZ 1VQ7Z 1VQ61 5C4JI 1Y1WI 3J81b 2OOXB 1Z02A 1YIJ1 4A3GI 1WCMI 4X6AI 2AKLA 1KD11 4A3II 1YJ91 3D9XA 2E2JI 1K9M1 1Q812 2DE5A 1VQ81 4Y52I 3CC71 1VQNZ 2WB1A 4NBAA 2QLVB 3CCE1 1TWAI 1VQK1 1QVGZ 3TE5B 5T64A 3NH8A 2QEXZ 1W2BY 1JJ2Z 4E2WA 2V8IA 3CCL1 3HOYI 2VPYA 5IP7I 3GTKI 3VTNA 3CMA1 3PO2I 1Q7Y1 4NBFA 3S15I 3RZDI 2WAQA 1RNIA 1KD12 2QA4Z 1QVFY 4EWCA 1VQM1 3P5JB 3I55Z 1Z01A 2JIRA 2RBLA 2PK7A 1K9M2 2F4MA 2O4HA 2VPWA 4NH1C 3OW2Z 3I56Z 3HOVI 2R6MA 2BJOA 3J7A4 2NVQI 3G711 3EEDA 2DE7A 1VQOZ 1M1K1 1SIWA 1YUAA 1YIT1 3HOUI 3M4OI 4E31A 4S1TA 1YHQ1 1Q7Y2 1KC81 2IV2X 1VQL1 1AA6A 3JAMb 1K731 1TWCI 2QRCB 4CL1A 2K5RA 3BG1B 1YJW1 3S2DI 4BBRI 2JR6A 3I07A 4NBGA 2V3VA 4E33A 3HOXI 1S72Z 3NH5A 2KI7B 3CCU1 1WW9A 1Y1VS 1I3QI 4E30A 5FLXb 1KRLA 2JIQA 1YI21 1RO4A 1WJ2A 4NFRA 1VQ6Z 2NVYI 2ZAEB 2QREB 3FQQA 2KPIA 1M1K2 3I4MI 3QWUA 1RLYA 3HOZI 1YIJZ 3IX0A 3CCV1 4MXUA 1YJ9Z 1KC82 1JJ2Y 3S2HI 5C4XI 3J81f 4RV9A 1M901 3G6E1 1Q862 4NOZA 4E32A 1Q822 2V45A 3CC7Z 1YJN1 2VUGA 3CCR1 5LL6f 3S1NI 3CCEZ 1VQKZ 5C3EI 2OTJ1 3F3FC 3RZOI 3S1MI 2NAPA 4E2YA 1KQSZ 2JIPA 1RQFA 3NH4A 4MD9A 2RIQA 1X3WA 1VQ91 3GKQA 3CCQ1 4MD7A 1VQMZ 2JMOA 3S16I 3GCFA 3CCSZ 1M902 4A3CI 3S1RI 2OZKA 4HGZA 5D1PA 3CPWZ 3IR7A 1VQ71 4NBEA 2GTHA 4BY1I 3MZLB 2VPZA 2AYDA 3D2LA 4NBDA 4HGYA 4RVGA 2H85A 4BBSI 3IF8A 2YU9I 2E2II 4A93I 1YITZ 4HH4A 2W03A 1YHQZ 3CXCY 2W04A 1VQLZ 1ZB8A 2E7ZA 2Q51A 1VQN1 1VLAA 1YJWZ 3CMEZ 5T6BA 2HF1A 1Y1VI 3CC2Z 2JUBA 1PFTA 2QKDA 1WZNA 3JAMf 1P9NA 3Q87A 2QRDB 4NBHA 4A3LI 1TWFI 2E9HA 3I4NI 5AN9F 2R7ZI 1QXFA 1ML8A 3CCVZ 5C44I 2OTLZ 3VMHA 2QA41 5FLXf 2M48A 3ESWA 1W2BZ 3K7AI 3I551 5T67A 2GTIA 2JIMA 2JA6I 3GTMS 2GU2A 1L1OC 1YJNZ 3I561 2O53A 5IP9I 3CCRZ 4AYBA 3CD61 4NBCA 4NBBA 3CC41 2IZ4A 1QVFZ 2JNYA 4A3EI 4BY7I 1K8A1 3GTPI 1QVGY 4A3JI 4RS4A 2V8JA 1K732 3NDIA 1VQ51 5CM2M 3GTQI 4NB9A 1VQ8Z 4DQYB 2J6AA 1S7MA 1NP6A 3GTGI 1SFOI 1VQ41 2R93I 1VQ9Z 3CCM1 3CCJ1 3CCLZ 4NB8A 2Q4ZA 3U50C 2PMZA 1ZH1A 3CMAZ 2PM9A 4A3BI 3OW2Y 2EGTA 1K8A2 1X0TA 1K83I 3MONA 4MRIA 4QTTA 2P28A 2RT9A 3LUSA 1USPA 1JWHC 1Q16A 1VQP1 2YADA 3FQMA 3BG0B 3G4S1 3VMGA 2DE6A 2JA5I 2F4OA 4XX2A 3KIFA 1USPB 3G71Z 1NJI1 2E2HI 1TWHI 1ZB9A 3GTLI 3IFUA 1Y8CA 3FKII 5A2Qf 1QYPA 2NVTI 1RO0A 3S17I 4MH4A 3TDHB 4A3MI 2V8KA 3S14I 5A2Qb 2OOYB 3NDJA 2VUMI 5IT9f 4A3KI 3EERA 1Z03A 3T4NB 3HOWI 1FDIA 2JS4A 3NFZA 4QTUA 3CCUZ 1TFIA 4Y7NI 2QEX1 3GTMI 1QF8A 5IT9b 4MONA 4RVHA 4DK1A 3CCS1 2IZ3A 3J80f 1YI2Z 3GTJI 2I3CA 4BXXI 3CD6Z 2NVXI 3J80b 1NJI2 1N8R1 1DL6A 1TWGI 3CC4Z 4DGLA 1RO2A 2VF1A 2P3YA 4RVFA 4A3DI 3D6WA 1N2FA 1WIIA 3F3PC 2VPXA 1VQ5Z 3VMIA 2M6NA 4E2XA 3G6EZ 2B63I 1KQSY 3PO3I 1FDOA 1Q861 1VQ4Z 1Q821 3CME1 3CCMZ 3H0GI 3CC21 1VQO1 2OTJZ 3MZKB 1YUKA 4TNUA 5D1OA 3CCJZ 1LQLA 1NUIA 3KIHA 4MD8A 5FLMI 1I6HI 4A3FI 3VB9A 2G2KA 1R9TI 3CXCZ 2QR1B 3HKZA 1N8R2 3CPWY 3S1QI 2JA8I 2R92I 2HU9A 4RVDA 1Q811
chains in the Genus database with same CATH topology
5D1OB 3M3YI 2RHBA 3CCQZ 3PO3S 3CQZI 3GTOI 2OTL1 2LIYA 2JA7I 2RPRA 4E2ZA 1X3ZA 2LFUA 1S721 2K3RA 3H3VJ 2Y0SA 1VQPZ 1I50I 3G4SZ 1VQ7Z 1VQ61 5C4JI 1Y1WI 3J81b 2OOXB 1Z02A 1YIJ1 4A3GI 1WCMI 4X6AI 2AKLA 1KD11 4A3II 1YJ91 3D9XA 2E2JI 1K9M1 1Q812 2DE5A 1VQ81 4Y52I 3CC71 1VQNZ 2WB1A 4NBAA 2QLVB 3CCE1 1TWAI 1VQK1 1QVGZ 3TE5B 5T64A 3NH8A 2QEXZ 1W2BY 1JJ2Z 4E2WA 2V8IA 3CCL1 3HOYI 5IP7I 3GTKI 3VTNA 3CMA1 3PO2I 1Q7Y1 4NBFA 3S15I 3RZDI 2WAQA 1RNIA 1KD12 2QA4Z 1QVFY 1VQM1 4EWCA 3P5JB 3I55Z 1Z01A 2RBLA 2PK7A 1K9M2 2F4MA 2O4HA 3OW2Z 4NH1C 3I56Z 3HOVI 2R6MA 2BJOA 3J7A4 2NVQI 3G711 3EEDA 2DE7A 1VQOZ 1M1K1 1YUAA 1YIT1 3HOUI 3M4OI 4E31A 4S1TA 1YHQ1 1Q7Y2 1KC81 1VQL1 3JAMb 1K731 1TWCI 2QRCB 4CL1A 2K5RA 3BG1B 1YJW1 3S2DI 4BBRI 2JR6A 3I07A 4NBGA 4E33A 3HOXI 1S72Z 3NH5A 2KI7B 3CCU1 1WW9A 1Y1VS 1I3QI 4E30A 5FLXb 1KRLA 1YI21 1RO4A 4NFRA 1VQ6Z 2NVYI 2ZAEB 2QREB 3FQQA 2KPIA 1M1K2 3I4MI 3QWUA 1RLYA 3HOZI 1YIJZ 3IX0A 3CCV1 4MXUA 1YJ9Z 1KC82 1JJ2Y 3S2HI 5C4XI 3J81f 4RV9A 1M901 3G6E1 1Q862 4NOZA 4E32A 1Q822 3CC7Z 1YJN1 2VUGA 3CCR1 5LL6f 3S1NI 3CCEZ 1VQKZ 5C3EI 2OTJ1 3F3FC 3RZOI 3S1MI 4E2YA 1KQSZ 1RQFA 3NH4A 4MD9A 2RIQA 1X3WA 1VQ91 3GKQA 3CCQ1 4MD7A 1VQMZ 2JMOA 3S16I 3GCFA 3CCSZ 1M902 4A3CI 3S1RI 2OZKA 4HGZA 5D1PA 3CPWZ 1VQ71 4NBEA 2GTHA 4BY1I 3MZLB 4NBDA 4HGYA 4RVGA 2H85A 4BBSI 3IF8A 2YU9I 2E2II 4A93I 1YITZ 4HH4A 2W03A 1YHQZ 3CXCY 2W04A 1VQLZ 1ZB8A 2Q51A 1VQN1 1VLAA 1YJWZ 3CMEZ 5T6BA 2HF1A 1Y1VI 3CC2Z 2JUBA 1PFTA 2QKDA 3JAMf 1P9NA 3Q87A 2QRDB 4NBHA 4A3LI 1TWFI 2E9HA 3I4NI 5AN9F 2R7ZI 1ML8A 3CCVZ 5C44I 2OTLZ 3VMHA 2QA41 5FLXf 2M48A 3ESWA 1W2BZ 3K7AI 3I551 5T67A 2GTIA 2JA6I 3GTMS 2GU2A 1L1OC 1YJNZ 3I561 2O53A 5IP9I 3CCRZ 4AYBA 3CD61 4NBCA 4NBBA 3CC41 2IZ4A 1QVFZ 2JNYA 4A3EI 4BY7I 1K8A1 3GTPI 1QVGY 4A3JI 4RS4A 2V8JA 1K732 3NDIA 1VQ51 5CM2M 3GTQI 4NB9A 1VQ8Z 4DQYB 1S7MA 2J6AA 1NP6A 3GTGI 1SFOI 1VQ41 2R93I 1VQ9Z 3CCM1 3CCJ1 3CCLZ 4NB8A 2Q4ZA 3U50C 2PMZA 1ZH1A 3CMAZ 2PM9A 4A3BI 3OW2Y 2EGTA 1K8A2 1X0TA 1K83I 3MONA 4MRIA 4QTTA 2P28A 2RT9A 3LUSA 1USPA 1JWHC 1VQP1 2YADA 3FQMA 3BG0B 3G4S1 3VMGA 2DE6A 2JA5I 2F4OA 4XX2A 3KIFA 1USPB 3G71Z 1NJI1 2E2HI 1TWHI 1ZB9A 3GTLI 3IFUA 3FKII 5A2Qf 1QYPA 2NVTI 1RO0A 3S17I 4MH4A 3TDHB 4A3MI 2V8KA 3S14I 5A2Qb 2OOYB 3NDJA 2VUMI 5IT9f 4A3KI 3EERA 1Z03A 3T4NB 3HOWI 2JS4A 4QTUA 3NFZA 3CCUZ 1TFIA 4Y7NI 2QEX1 3GTMI 1QF8A 5IT9b 4MONA 4RVHA 4DK1A 3CCS1 2IZ3A 3J80f 1YI2Z 3GTJI 2I3CA 4BXXI 3CD6Z 2NVXI 3J80b 1NJI2 1N8R1 1DL6A 1TWGI 3CC4Z 4DGLA 1RO2A 2VF1A 2P3YA 4RVFA 4A3DI 3D6WA 1N2FA 1WIIA 3F3PC 1VQ5Z 3VMIA 2M6NA 4E2XA 3G6EZ 2B63I 1KQSY 3PO3I 1Q861 1VQ4Z 1Q821 3CME1 3CCMZ 3H0GI 3CC21 1VQO1 2OTJZ 3MZKB 1YUKA 4TNUA 5D1OA 3CCJZ 1LQLA 1NUIA 3KIHA 4MD8A 5FLMI 1I6HI 4A3FI 3VB9A 2G2KA 1R9TI 3CXCZ 2QR1B 3HKZA 1N8R2 3CPWY 3S1QI 2JA8I 2R92I 2HU9A 4RVDA 1Q811
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAM f;  3J81 f;  5A2Q f;  5FLX f;  5IT9 f;  3J80 f; 
#chains in the Genus database with same CATH topology
 5D1O B;  3M3Y I;  2RHB A;  3CCQ Z;  3PO3 S;  3CQZ I;  3GTO I;  2OTL 1;  2LIY A;  2JA7 I;  2RPR A;  4E2Z A;  1X3Z A;  2LFU A;  1S72 1;  2K3R A;  3H3V J;  2Y0S A;  1VQP Z;  1I50 I;  2LEX A;  2JIO A;  3G4S Z;  1VQ7 Z;  1VQ6 1;  5C4J I;  1Y1W I;  3J81 b;  2OOX B;  1Z02 A;  1YIJ 1;  4A3G I;  1WCM I;  4X6A I;  2AKL A;  1KD1 1;  4A3I I;  1YJ9 1;  3D9X A;  2E2J I;  1K9M 1;  1Q81 2;  2DE5 A;  1VQ8 1;  4Y52 I;  3CC7 1;  1VQN Z;  2WB1 A;  4NBA A;  2QLV B;  3CCE 1;  1TWA I;  1VQK 1;  1QVG Z;  3TE5 B;  5T64 A;  3NH8 A;  2QEX Z;  1W2B Y;  1JJ2 Z;  4E2W A;  2V8I A;  3CCL 1;  3HOY I;  2VPY A;  5IP7 I;  3GTK I;  3VTN A;  3CMA 1;  3PO2 I;  1Q7Y 1;  4NBF A;  3S15 I;  3RZD I;  2WAQ A;  1RNI A;  1KD1 2;  2QA4 Z;  1QVF Y;  4EWC A;  1VQM 1;  3P5J B;  3I55 Z;  1Z01 A;  2JIR A;  2RBL A;  2PK7 A;  1K9M 2;  2F4M A;  2O4H A;  2VPW A;  4NH1 C;  3OW2 Z;  3I56 Z;  3HOV I;  2R6M A;  2BJO A;  3J7A 4;  2NVQ I;  3G71 1;  3EED A;  2DE7 A;  1VQO Z;  1M1K 1;  1SIW A;  1YUA A;  1YIT 1;  3HOU I;  3M4O I;  4E31 A;  4S1T A;  1YHQ 1;  1Q7Y 2;  1KC8 1;  2IV2 X;  1VQL 1;  1AA6 A;  3JAM b;  1K73 1;  1TWC I;  2QRC B;  4CL1 A;  2K5R A;  3BG1 B;  1YJW 1;  3S2D I;  4BBR I;  2JR6 A;  3I07 A;  4NBG A;  2V3V A;  4E33 A;  3HOX I;  1S72 Z;  3NH5 A;  2KI7 B;  3CCU 1;  1WW9 A;  1Y1V S;  1I3Q I;  4E30 A;  5FLX b;  1KRL A;  2JIQ A;  1YI2 1;  1RO4 A;  1WJ2 A;  4NFR A;  1VQ6 Z;  2NVY I;  2ZAE B;  2QRE B;  3FQQ A;  2KPI A;  1M1K 2;  3I4M I;  3QWU A;  1RLY A;  3HOZ I;  1YIJ Z;  3IX0 A;  3CCV 1;  4MXU A;  1YJ9 Z;  1KC8 2;  1JJ2 Y;  3S2H I;  5C4X I;  3J81 f;  4RV9 A;  1M90 1;  3G6E 1;  1Q86 2;  4NOZ A;  4E32 A;  1Q82 2;  2V45 A;  3CC7 Z;  1YJN 1;  2VUG A;  3CCR 1;  5LL6 f;  3S1N I;  3CCE Z;  1VQK Z;  5C3E I;  2OTJ 1;  3F3F C;  3RZO I;  3S1M I;  2NAP A;  4E2Y A;  1KQS Z;  2JIP A;  1RQF A;  3NH4 A;  4MD9 A;  2RIQ A;  1X3W A;  1VQ9 1;  3GKQ A;  3CCQ 1;  4MD7 A;  1VQM Z;  2JMO A;  3S16 I;  3GCF A;  3CCS Z;  1M90 2;  4A3C I;  3S1R I;  2OZK A;  4HGZ A;  5D1P A;  3CPW Z;  3IR7 A;  1VQ7 1;  4NBE A;  2GTH A;  4BY1 I;  3MZL B;  2VPZ A;  2AYD A;  3D2L A;  4NBD A;  4HGY A;  4RVG A;  2H85 A;  4BBS I;  3IF8 A;  2YU9 I;  2E2I I;  4A93 I;  1YIT Z;  4HH4 A;  2W03 A;  1YHQ Z;  3CXC Y;  2W04 A;  1VQL Z;  1ZB8 A;  2E7Z A;  2Q51 A;  1VQN 1;  1VLA A;  1YJW Z;  3CME Z;  5T6B A;  2HF1 A;  1Y1V I;  3CC2 Z;  2JUB A;  1PFT A;  2QKD A;  1WZN A;  3JAM f;  1P9N A;  3Q87 A;  2QRD B;  4NBH A;  4A3L I;  1TWF I;  2E9H A;  3I4N I;  5AN9 F;  2R7Z I;  1QXF A;  1ML8 A;  3CCV Z;  5C44 I;  2OTL Z;  3VMH A;  2QA4 1;  5FLX f;  2M48 A;  3ESW A;  1W2B Z;  3K7A I;  3I55 1;  5T67 A;  2GTI A;  2JIM A;  2JA6 I;  3GTM S;  2GU2 A;  1L1O C;  1YJN Z;  3I56 1;  2O53 A;  5IP9 I;  3CCR Z;  4AYB A;  3CD6 1;  4NBC A;  4NBB A;  3CC4 1;  2IZ4 A;  1QVF Z;  2JNY A;  4A3E I;  4BY7 I;  1K8A 1;  3GTP I;  1QVG Y;  4A3J I;  4RS4 A;  2V8J A;  1K73 2;  3NDI A;  1VQ5 1;  5CM2 M;  3GTQ I;  4NB9 A;  1VQ8 Z;  4DQY B;  2J6A A;  1S7M A;  1NP6 A;  3GTG I;  1SFO I;  1VQ4 1;  2R93 I;  1VQ9 Z;  3CCM 1;  3CCJ 1;  3CCL Z;  4NB8 A;  2Q4Z A;  3U50 C;  2PMZ A;  1ZH1 A;  3CMA Z;  2PM9 A;  4A3B I;  3OW2 Y;  2EGT A;  1K8A 2;  1X0T A;  1K83 I;  3MON A;  4MRI A;  4QTT A;  2P28 A;  2RT9 A;  3LUS A;  1USP A;  1JWH C;  1Q16 A;  1VQP 1;  2YAD A;  3FQM A;  3BG0 B;  3G4S 1;  3VMG A;  2DE6 A;  2JA5 I;  2F4O A;  4XX2 A;  3KIF A;  1USP B;  3G71 Z;  1NJI 1;  2E2H I;  1TWH I;  1ZB9 A;  3GTL I;  3IFU A;  1Y8C A;  3FKI I;  5A2Q f;  1QYP A;  2NVT I;  1RO0 A;  3S17 I;  4MH4 A;  3TDH B;  4A3M I;  2V8K A;  3S14 I;  5A2Q b;  2OOY B;  3NDJ A;  2VUM I;  5IT9 f;  4A3K I;  3EER A;  1Z03 A;  3T4N B;  3HOW I;  1FDI A;  2JS4 A;  3NFZ A;  4QTU A;  3CCU Z;  1TFI A;  4Y7N I;  2QEX 1;  3GTM I;  1QF8 A;  5IT9 b;  4MON A;  4RVH A;  4DK1 A;  3CCS 1;  2IZ3 A;  3J80 f;  1YI2 Z;  3GTJ I;  2I3C A;  4BXX I;  3CD6 Z;  2NVX I;  3J80 b;  1NJI 2;  1N8R 1;  1DL6 A;  1TWG I;  3CC4 Z;  4DGL A;  1RO2 A;  2VF1 A;  2P3Y A;  4RVF A;  4A3D I;  3D6W A;  1N2F A;  1WII A;  3F3P C;  2VPX A;  1VQ5 Z;  3VMI A;  2M6N A;  4E2X A;  3G6E Z;  2B63 I;  1KQS Y;  3PO3 I;  1FDO A;  1Q86 1;  1VQ4 Z;  1Q82 1;  3CME 1;  3CCM Z;  3H0G I;  3CC2 1;  1VQO 1;  2OTJ Z;  3MZK B;  1YUK A;  4TNU A;  5D1O A;  3CCJ Z;  1LQL A;  1NUI A;  3KIH A;  4MD8 A;  5FLM I;  1I6H I;  4A3F I;  3VB9 A;  2G2K A;  1R9T I;  3CXC Z;  2QR1 B;  3HKZ A;  1N8R 2;  3CPW Y;  3S1Q I;  2JA8 I;  2R92 I;  2HU9 A;  4RVD A;  1Q81 1; 
#chains in the Genus database with same CATH homology
 5D1O B;  3M3Y I;  2RHB A;  3CCQ Z;  3PO3 S;  3CQZ I;  3GTO I;  2OTL 1;  2LIY A;  2JA7 I;  2RPR A;  4E2Z A;  1X3Z A;  2LFU A;  1S72 1;  2K3R A;  3H3V J;  2Y0S A;  1VQP Z;  1I50 I;  3G4S Z;  1VQ7 Z;  1VQ6 1;  5C4J I;  1Y1W I;  3J81 b;  2OOX B;  1Z02 A;  1YIJ 1;  4A3G I;  1WCM I;  4X6A I;  2AKL A;  1KD1 1;  4A3I I;  1YJ9 1;  3D9X A;  2E2J I;  1K9M 1;  1Q81 2;  2DE5 A;  1VQ8 1;  4Y52 I;  3CC7 1;  1VQN Z;  2WB1 A;  4NBA A;  2QLV B;  3CCE 1;  1TWA I;  1VQK 1;  1QVG Z;  3TE5 B;  5T64 A;  3NH8 A;  2QEX Z;  1W2B Y;  1JJ2 Z;  4E2W A;  2V8I A;  3CCL 1;  3HOY I;  5IP7 I;  3GTK I;  3VTN A;  3CMA 1;  3PO2 I;  1Q7Y 1;  4NBF A;  3S15 I;  3RZD I;  2WAQ A;  1RNI A;  1KD1 2;  2QA4 Z;  1QVF Y;  1VQM 1;  4EWC A;  3P5J B;  3I55 Z;  1Z01 A;  2RBL A;  2PK7 A;  1K9M 2;  2F4M A;  2O4H A;  3OW2 Z;  4NH1 C;  3I56 Z;  3HOV I;  2R6M A;  2BJO A;  3J7A 4;  2NVQ I;  3G71 1;  3EED A;  2DE7 A;  1VQO Z;  1M1K 1;  1YUA A;  1YIT 1;  3HOU I;  3M4O I;  4E31 A;  4S1T A;  1YHQ 1;  1Q7Y 2;  1KC8 1;  1VQL 1;  3JAM b;  1K73 1;  1TWC I;  2QRC B;  4CL1 A;  2K5R A;  3BG1 B;  1YJW 1;  3S2D I;  4BBR I;  2JR6 A;  3I07 A;  4NBG A;  4E33 A;  3HOX I;  1S72 Z;  3NH5 A;  2KI7 B;  3CCU 1;  1WW9 A;  1Y1V S;  1I3Q I;  4E30 A;  5FLX b;  1KRL A;  1YI2 1;  1RO4 A;  4NFR A;  1VQ6 Z;  2NVY I;  2ZAE B;  2QRE B;  3FQQ A;  2KPI A;  1M1K 2;  3I4M I;  3QWU A;  1RLY A;  3HOZ I;  1YIJ Z;  3IX0 A;  3CCV 1;  4MXU A;  1YJ9 Z;  1KC8 2;  1JJ2 Y;  3S2H I;  5C4X I;  3J81 f;  4RV9 A;  1M90 1;  3G6E 1;  1Q86 2;  4NOZ A;  4E32 A;  1Q82 2;  3CC7 Z;  1YJN 1;  2VUG A;  3CCR 1;  5LL6 f;  3S1N I;  3CCE Z;  1VQK Z;  5C3E I;  2OTJ 1;  3F3F C;  3RZO I;  3S1M I;  4E2Y A;  1KQS Z;  1RQF A;  3NH4 A;  4MD9 A;  2RIQ A;  1X3W A;  1VQ9 1;  3GKQ A;  3CCQ 1;  4MD7 A;  1VQM Z;  2JMO A;  3S16 I;  3GCF A;  3CCS Z;  1M90 2;  4A3C I;  3S1R I;  2OZK A;  4HGZ A;  5D1P A;  3CPW Z;  1VQ7 1;  4NBE A;  2GTH A;  4BY1 I;  3MZL B;  4NBD A;  4HGY A;  4RVG A;  2H85 A;  4BBS I;  3IF8 A;  2YU9 I;  2E2I I;  4A93 I;  1YIT Z;  4HH4 A;  2W03 A;  1YHQ Z;  3CXC Y;  2W04 A;  1VQL Z;  1ZB8 A;  2Q51 A;  1VQN 1;  1VLA A;  1YJW Z;  3CME Z;  5T6B A;  2HF1 A;  1Y1V I;  3CC2 Z;  2JUB A;  1PFT A;  2QKD A;  3JAM f;  1P9N A;  3Q87 A;  2QRD B;  4NBH A;  4A3L I;  1TWF I;  2E9H A;  3I4N I;  5AN9 F;  2R7Z I;  1ML8 A;  3CCV Z;  5C44 I;  2OTL Z;  3VMH A;  2QA4 1;  5FLX f;  2M48 A;  3ESW A;  1W2B Z;  3K7A I;  3I55 1;  5T67 A;  2GTI A;  2JA6 I;  3GTM S;  2GU2 A;  1L1O C;  1YJN Z;  3I56 1;  2O53 A;  5IP9 I;  3CCR Z;  4AYB A;  3CD6 1;  4NBC A;  4NBB A;  3CC4 1;  2IZ4 A;  1QVF Z;  2JNY A;  4A3E I;  4BY7 I;  1K8A 1;  3GTP I;  1QVG Y;  4A3J I;  4RS4 A;  2V8J A;  1K73 2;  3NDI A;  1VQ5 1;  5CM2 M;  3GTQ I;  4NB9 A;  1VQ8 Z;  4DQY B;  1S7M A;  2J6A A;  1NP6 A;  3GTG I;  1SFO I;  1VQ4 1;  2R93 I;  1VQ9 Z;  3CCM 1;  3CCJ 1;  3CCL Z;  4NB8 A;  2Q4Z A;  3U50 C;  2PMZ A;  1ZH1 A;  3CMA Z;  2PM9 A;  4A3B I;  3OW2 Y;  2EGT A;  1K8A 2;  1X0T A;  1K83 I;  3MON A;  4MRI A;  4QTT A;  2P28 A;  2RT9 A;  3LUS A;  1USP A;  1JWH C;  1VQP 1;  2YAD A;  3FQM A;  3BG0 B;  3G4S 1;  3VMG A;  2DE6 A;  2JA5 I;  2F4O A;  4XX2 A;  3KIF A;  1USP B;  3G71 Z;  1NJI 1;  2E2H I;  1TWH I;  1ZB9 A;  3GTL I;  3IFU A;  3FKI I;  5A2Q f;  1QYP A;  2NVT I;  1RO0 A;  3S17 I;  4MH4 A;  3TDH B;  4A3M I;  2V8K A;  3S14 I;  5A2Q b;  2OOY B;  3NDJ A;  2VUM I;  5IT9 f;  4A3K I;  3EER A;  1Z03 A;  3T4N B;  3HOW I;  2JS4 A;  4QTU A;  3NFZ A;  3CCU Z;  1TFI A;  4Y7N I;  2QEX 1;  3GTM I;  1QF8 A;  5IT9 b;  4MON A;  4RVH A;  4DK1 A;  3CCS 1;  2IZ3 A;  3J80 f;  1YI2 Z;  3GTJ I;  2I3C A;  4BXX I;  3CD6 Z;  2NVX I;  3J80 b;  1NJI 2;  1N8R 1;  1DL6 A;  1TWG I;  3CC4 Z;  4DGL A;  1RO2 A;  2VF1 A;  2P3Y A;  4RVF A;  4A3D I;  3D6W A;  1N2F A;  1WII A;  3F3P C;  1VQ5 Z;  3VMI A;  2M6N A;  4E2X A;  3G6E Z;  2B63 I;  1KQS Y;  3PO3 I;  1Q86 1;  1VQ4 Z;  1Q82 1;  3CME 1;  3CCM Z;  3H0G I;  3CC2 1;  1VQO 1;  2OTJ Z;  3MZK B;  1YUK A;  4TNU A;  5D1O A;  3CCJ Z;  1LQL A;  1NUI A;  3KIH A;  4MD8 A;  5FLM I;  1I6H I;  4A3F I;  3VB9 A;  2G2K A;  1R9T I;  3CXC Z;  2QR1 B;  3HKZ A;  1N8R 2;  3CPW Y;  3S1Q I;  2JA8 I;  2R92 I;  2HU9 A;  4RVD A;  1Q81 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...