3J80f

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
69
structure length
69
Chain Sequence
KKVYTTPKKIRHKHKKVKLAVLNYYKVDDEGKVAKLRKECPNCGPGIFLANHGDRFYCGKCHSTFATQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 2
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF00240 ubiquitin Ubiquitin family
f PF01599 Ribosomal_S27 Ribosomal protein S27a
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.660 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3j80f00
5IT9f 3J81f 3J80f 3JAMf 5A2Qf 5FLXf
chains in the Genus database with same CATH superfamily
2PM9A 3MONA 4A3GI 4A3DI 1USPA 3NDIA 2HU9A 3CC21 4RVFA 1Q7Y2 2H85A 1YI21 3F3PC 1Q862 1YJ91 4RS4A 1KQSY 2JIPA 3CC7Z 1VQO1 1WJ2A 1PFTA 4A3FI 1QVFY 1Q821 1KQSZ 2F4OA 3OW2Y 1K732 4QTTA 3CMA1 2LIYA 1YJW1 2IZ4A 3D6WA 2QKDA 4Y52I 2M48A 1VQOZ 3IR7A 2RPRA 4CL1A 2JIRA 2QREB 3NDJA 2WAQA 2LEXA 2NVTI 1YUAA 4A93I 2RIQA 1S7MA 1YJWZ 2WB1A 2NVQI 1K8A1 2IV2X 1USPB 4E33A 3CCM1 1VQM1 5IT9b 1RO2A 5IP7I 5IT9f 1ZH1A 4HGZA 1L1OC 4E30A 1YUKA 4A3II 1QYPA 3I4MI 2Q4ZA 3I561 1P9NA 2JIQA 3CCMZ 2QLVB 1RLYA 2HF1A 2E7ZA 3S15I 4Y7NI 4NBHA 3I551 4NBGA 1YITZ 1Y1VI 2DE7A 1YIJZ 4HGYA 1M901 2AKLA 1RO0A 3GTGI 3M3YI 3G6E1 1WIIA 2YU9I 3CCJZ 3I56Z 1TWCI 3HOUI 2JNYA 3GTQI 2OOYB 4RV9A 5A2Qb 1FDIA 1ZB8A 3RZOI 2W04A 3I55Z 3CXCZ 1Q822 5T64A 4DK1A 3G6EZ 3HOZI 1NJI1 2B63I 1TWHI 4TNUA 2VPYA 1LQLA 3TE5B 2Q51A 1VQ51 3PO3I 3EERA 3I4NI 1M1K1 5IP9I 4BXXI 2GTIA 4NB8A 3IX0A 3BG1B 1VQ41 3GTMI 2NVXI 5FLMI 3CCL1 4RVGA 4NBEA 3S16I 4A3JI 3J80b 1I6HI 1K8A2 1VQ5Z 3CCR1 2QRDB 1K9M1 1VQ81 4E2WA 1VQL1 3VB9A 1VQ4Z 1I3QI 4A3LI 4XX2A 2E2JI 2O53A 1FDOA 3U50C 2AYDA 3GKQA 3CCLZ 3EEDA 1TFIA 1Y8CA 2EGTA 1QVGZ 1X3ZA 4BY7I 3CCRZ 2VPXA 1WCMI 3CC2Z 1KD12 1VQLZ 1YI2Z 1Y1WI 3GTPI 1QXFA 1YJ9Z 2OZKA 3QWUA 4DQYB 3CD61 2V3VA 1K83I 1M902 1RQFA 4NB9A 1R9TI 2LFUA 3HKZA 3PO3S 1KC81 1TWAI 1Z01A 1NP6A 3CCQ1 1VQ71 3CMAZ 3LUSA 1WW9A 2BJOA 3NH8A 1W2BZ 3K7AI 3GTMS 4A3MI 2W03A 3GTOI 3S14I 1YJN1 2M6NA 1RNIA 2YADA 2JMOA 2R92I 1ZB9A 1NJI2 2QR1B 1VQ7Z 3CQZI 1X3WA 1KRLA 1TWFI 5D1OA 5FLXb 4BBSI 5C44I 2E2HI 1M1K2 1VQMZ 1Q16A 2NAPA 3GTJI 2KI7B 3VMIA 1YHQ1 1N8R1 4NBDA 3G4S1 3H0GI 2NVYI 2JA6I 3FQQA 2VPWA 3FQMA 3T4NB 2DE5A 1K9M2 3FKII 4NH1C 1ML8A 3CC41 3CXCY 5T67A 3JAMb 1YHQZ 1VQ61 2QEX1 5A2Qf 3G4SZ 2V45A 2PK7A 2DE6A 1WZNA 2RT9A 4MONA 4BBRI 2JUBA 5D1OB 1VQP1 3CC4Z 1RO4A 3J81b 4HH4A 3GCFA 1VQ6Z 4NBBA 2R7ZI 1VLAA 3P5JB 4RVDA 3IFUA 2OOXB 1KC82 3H3VJ 2Y0SA 3VMHA 1JJ2Y 4MD7A 2JR6A 1Z02A 4MXUA 1JJ2Z 1Y1VS 3J80f 2IZ3A 4E2YA 3VTNA 1VQK1 2K3RA 1SFOI 4AYBA 4MRIA 1DL6A 1VQN1 3TDHB 3CC71 2R93I 2RHBA 1QVGY 2VF1A 4BY1I 4A3EI 3CPWY 2VUMI 3D2LA 2RBLA 3CME1 3PO2I 3CPWZ 3S2DI 1VQ8Z 3J7A4 2PMZA 1VQKZ 3CCE1 2OTL1 1I50I 1VQNZ 2JA7I 4NBCA 1N8R2 2E2II 3IF8A 5C4JI 2V8JA 4A3CI 4S1TA 3CMEZ 1W2BY 3S1QI 1QVFZ 5AN9F 2E9HA 5D1PA 3OW2Z 4QTUA 3CCEZ 2OTLZ 3CCV1 5C3EI 2KPIA 1QF8A 1Q811 3CD6Z 2I3CA 2JS4A 3G711 3M4OI 3KIHA 3Q87A 3I07A 4DGLA 1VQ91 2F4MA 3CCQZ 4NBFA 4E32A 3NFZA 3KIFA 1N2FA 3F3FC 3VMGA 3MZKB 3D9XA 2ZAEB 3S17I 3CCVZ 3BG0B 1Q7Y1 5FLXf 1YJNZ 2JIOA 1Q861 3G71Z 1TWGI 2JA8I 2K5RA 1YIT1 3RZDI 1VQ9Z 1YIJ1 4MD9A 3MZLB 2V8IA 4NOZA 1K731 3CCJ1 2GU2A 3NH5A 4E31A 2O4HA 2J6AA 1KD11 2P28A 3HOXI 4RVHA 5T6BA 2G2KA 2VPZA 1Z03A 3JAMf 3GTLI 2R6MA 3CCU1 3S1NI 4EWCA 3HOWI 4A3KI 2OTJ1 3CCS1 2JA5I 1AA6A 1JWHC 2QEXZ 2V8KA 3J81f 5C4XI 4X6AI 1S721 3S2HI 4MD8A 3CCUZ 2VUGA 2QA41 1X0TA 4E2XA 3NH4A 2GTHA 3CCSZ 2OTJZ 4NBAA 1VQPZ 4MH4A 2JIMA 1SIWA 3S1MI 3HOYI 4E2ZA 4A3BI 5CM2M 5LL6f 1Q812 3S1RI 3HOVI 1S72Z 2QRCB 1NUIA 2QA4Z 4NFRA 2P3YA 3ESWA 3GTKI
chains in the Genus database with same CATH topology
2PM9A 3MONA 4A3GI 4A3DI 1USPA 3NDIA 2HU9A 3CC21 4RVFA 1Q7Y2 2H85A 1YI21 3F3PC 1Q862 1YJ91 4RS4A 1KQSY 3CC7Z 1VQO1 4A3FI 1PFTA 1QVFY 1Q821 1KQSZ 2F4OA 3OW2Y 1K732 4QTTA 3CMA1 2LIYA 1YJW1 2IZ4A 3D6WA 2QKDA 4Y52I 2M48A 1VQOZ 2RPRA 4CL1A 2QREB 3NDJA 2WAQA 2NVTI 1YUAA 4A93I 2RIQA 1S7MA 1YJWZ 2WB1A 2NVQI 1K8A1 1USPB 4E33A 3CCM1 1VQM1 5IT9b 1RO2A 5IP7I 5IT9f 1ZH1A 4HGZA 1L1OC 4E30A 1YUKA 4A3II 1QYPA 3I4MI 2Q4ZA 3I561 1P9NA 3CCMZ 2QLVB 1RLYA 2HF1A 3S15I 4Y7NI 4NBHA 3I551 4NBGA 1YITZ 1Y1VI 2DE7A 1YIJZ 4HGYA 1M901 2AKLA 1RO0A 3GTGI 3M3YI 3G6E1 1WIIA 2YU9I 3CCJZ 3I56Z 1TWCI 3HOUI 2JNYA 3GTQI 2OOYB 4RV9A 5A2Qb 1ZB8A 3RZOI 2W04A 3I55Z 3CXCZ 1Q822 5T64A 4DK1A 3G6EZ 3HOZI 1NJI1 2B63I 1TWHI 4TNUA 1LQLA 3TE5B 2Q51A 1VQ51 3PO3I 3EERA 3I4NI 1M1K1 5IP9I 4BXXI 2GTIA 4NB8A 3IX0A 3BG1B 1VQ41 3GTMI 2NVXI 5FLMI 3CCL1 4RVGA 4NBEA 3S16I 4A3JI 3J80b 1I6HI 1K8A2 1VQ5Z 3CCR1 2QRDB 1K9M1 1VQ81 4E2WA 1VQL1 3VB9A 1VQ4Z 1I3QI 4A3LI 4XX2A 2E2JI 2O53A 3U50C 3GKQA 3CCLZ 3EEDA 1TFIA 2EGTA 1QVGZ 1X3ZA 4BY7I 3CCRZ 1WCMI 3CC2Z 1KD12 1VQLZ 1YI2Z 1Y1WI 3GTPI 1YJ9Z 2OZKA 3QWUA 4DQYB 3CD61 1K83I 1M902 1RQFA 4NB9A 1R9TI 2LFUA 3HKZA 3PO3S 1KC81 1TWAI 1Z01A 1NP6A 3CCQ1 1VQ71 3CMAZ 3LUSA 1WW9A 2BJOA 3NH8A 1W2BZ 3K7AI 3GTMS 4A3MI 2W03A 3GTOI 3S14I 1YJN1 2M6NA 1RNIA 2YADA 2JMOA 2R92I 1ZB9A 1NJI2 2QR1B 1VQ7Z 3CQZI 1X3WA 1KRLA 1TWFI 5D1OA 5FLXb 4BBSI 5C44I 2E2HI 1M1K2 1VQMZ 3GTJI 2KI7B 3VMIA 1YHQ1 1N8R1 4NBDA 3G4S1 3H0GI 2NVYI 2JA6I 3FQQA 3FQMA 3T4NB 2DE5A 1K9M2 3FKII 4NH1C 1ML8A 3CC41 3CXCY 5T67A 3JAMb 1YHQZ 1VQ61 2QEX1 5A2Qf 3G4SZ 2PK7A 2DE6A 2RT9A 4MONA 4BBRI 2JUBA 5D1OB 1VQP1 3CC4Z 1RO4A 3J81b 4HH4A 3GCFA 1VQ6Z 4NBBA 2R7ZI 1VLAA 3P5JB 4RVDA 3IFUA 2OOXB 1KC82 3H3VJ 2Y0SA 3VMHA 1JJ2Y 4MD7A 2JR6A 1Z02A 4MXUA 1JJ2Z 1Y1VS 3J80f 2IZ3A 4E2YA 3VTNA 1VQK1 2K3RA 1SFOI 4AYBA 4MRIA 1DL6A 1VQN1 3TDHB 3CC71 2R93I 2RHBA 1QVGY 2VF1A 4BY1I 4A3EI 3CPWY 2VUMI 2RBLA 3CME1 3PO2I 3CPWZ 3S2DI 1VQ8Z 3J7A4 2PMZA 1VQKZ 3CCE1 2OTL1 1I50I 1VQNZ 2JA7I 4NBCA 1N8R2 2E2II 3IF8A 5C4JI 2V8JA 4A3CI 4S1TA 3CMEZ 1W2BY 3S1QI 1QVFZ 5AN9F 2E9HA 5D1PA 3OW2Z 4QTUA 3CCEZ 2OTLZ 3CCV1 5C3EI 2KPIA 1QF8A 1Q811 3CD6Z 2I3CA 2JS4A 3G711 3M4OI 3KIHA 3Q87A 3I07A 4DGLA 1VQ91 2F4MA 3CCQZ 4NBFA 4E32A 3NFZA 3KIFA 1N2FA 3F3FC 3VMGA 3MZKB 3D9XA 2ZAEB 3S17I 3CCVZ 3BG0B 1Q7Y1 5FLXf 1YJNZ 1Q861 3G71Z 1TWGI 2JA8I 2K5RA 1YIT1 3RZDI 1VQ9Z 1YIJ1 4MD9A 3MZLB 2V8IA 4NOZA 1K731 3CCJ1 2GU2A 3NH5A 4E31A 2O4HA 2J6AA 1KD11 2P28A 3HOXI 4RVHA 5T6BA 2G2KA 1Z03A 3JAMf 3GTLI 2R6MA 3CCU1 3S1NI 4EWCA 3HOWI 4A3KI 2OTJ1 3CCS1 2JA5I 1JWHC 2QEXZ 2V8KA 3J81f 5C4XI 4X6AI 1S721 3S2HI 4MD8A 3CCUZ 2VUGA 2QA41 1X0TA 4E2XA 3NH4A 2GTHA 3CCSZ 2OTJZ 4NBAA 1VQPZ 4MH4A 3S1MI 3HOYI 4E2ZA 4A3BI 5CM2M 5LL6f 1Q812 3S1RI 3HOVI 1S72Z 2QRCB 1NUIA 2QA4Z 4NFRA 2P3YA 3ESWA 3GTKI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IT9 f;  3J81 f;  3J80 f;  3JAM f;  5A2Q f;  5FLX f; 
#chains in the Genus database with same CATH topology
 2PM9 A;  3MON A;  4A3G I;  4A3D I;  1USP A;  3NDI A;  2HU9 A;  3CC2 1;  4RVF A;  1Q7Y 2;  2H85 A;  1YI2 1;  3F3P C;  1Q86 2;  1YJ9 1;  4RS4 A;  1KQS Y;  2JIP A;  3CC7 Z;  1VQO 1;  1WJ2 A;  1PFT A;  4A3F I;  1QVF Y;  1Q82 1;  1KQS Z;  2F4O A;  3OW2 Y;  1K73 2;  4QTT A;  3CMA 1;  2LIY A;  1YJW 1;  2IZ4 A;  3D6W A;  2QKD A;  4Y52 I;  2M48 A;  1VQO Z;  3IR7 A;  2RPR A;  4CL1 A;  2JIR A;  2QRE B;  3NDJ A;  2WAQ A;  2LEX A;  2NVT I;  1YUA A;  4A93 I;  2RIQ A;  1S7M A;  1YJW Z;  2WB1 A;  2NVQ I;  1K8A 1;  2IV2 X;  1USP B;  4E33 A;  3CCM 1;  1VQM 1;  5IT9 b;  1RO2 A;  5IP7 I;  5IT9 f;  1ZH1 A;  4HGZ A;  1L1O C;  4E30 A;  1YUK A;  4A3I I;  1QYP A;  3I4M I;  2Q4Z A;  3I56 1;  1P9N A;  2JIQ A;  3CCM Z;  2QLV B;  1RLY A;  2HF1 A;  2E7Z A;  3S15 I;  4Y7N I;  4NBH A;  3I55 1;  4NBG A;  1YIT Z;  1Y1V I;  2DE7 A;  1YIJ Z;  4HGY A;  1M90 1;  2AKL A;  1RO0 A;  3GTG I;  3M3Y I;  3G6E 1;  1WII A;  2YU9 I;  3CCJ Z;  3I56 Z;  1TWC I;  3HOU I;  2JNY A;  3GTQ I;  2OOY B;  4RV9 A;  5A2Q b;  1FDI A;  1ZB8 A;  3RZO I;  2W04 A;  3I55 Z;  3CXC Z;  1Q82 2;  5T64 A;  4DK1 A;  3G6E Z;  3HOZ I;  1NJI 1;  2B63 I;  1TWH I;  4TNU A;  2VPY A;  1LQL A;  3TE5 B;  2Q51 A;  1VQ5 1;  3PO3 I;  3EER A;  3I4N I;  1M1K 1;  5IP9 I;  4BXX I;  2GTI A;  4NB8 A;  3IX0 A;  3BG1 B;  1VQ4 1;  3GTM I;  2NVX I;  5FLM I;  3CCL 1;  4RVG A;  4NBE A;  3S16 I;  4A3J I;  3J80 b;  1I6H I;  1K8A 2;  1VQ5 Z;  3CCR 1;  2QRD B;  1K9M 1;  1VQ8 1;  4E2W A;  1VQL 1;  3VB9 A;  1VQ4 Z;  1I3Q I;  4A3L I;  4XX2 A;  2E2J I;  2O53 A;  1FDO A;  3U50 C;  2AYD A;  3GKQ A;  3CCL Z;  3EED A;  1TFI A;  1Y8C A;  2EGT A;  1QVG Z;  1X3Z A;  4BY7 I;  3CCR Z;  2VPX A;  1WCM I;  3CC2 Z;  1KD1 2;  1VQL Z;  1YI2 Z;  1Y1W I;  3GTP I;  1QXF A;  1YJ9 Z;  2OZK A;  3QWU A;  4DQY B;  3CD6 1;  2V3V A;  1K83 I;  1M90 2;  1RQF A;  4NB9 A;  1R9T I;  2LFU A;  3HKZ A;  3PO3 S;  1KC8 1;  1TWA I;  1Z01 A;  1NP6 A;  3CCQ 1;  1VQ7 1;  3CMA Z;  3LUS A;  1WW9 A;  2BJO A;  3NH8 A;  1W2B Z;  3K7A I;  3GTM S;  4A3M I;  2W03 A;  3GTO I;  3S14 I;  1YJN 1;  2M6N A;  1RNI A;  2YAD A;  2JMO A;  2R92 I;  1ZB9 A;  1NJI 2;  2QR1 B;  1VQ7 Z;  3CQZ I;  1X3W A;  1KRL A;  1TWF I;  5D1O A;  5FLX b;  4BBS I;  5C44 I;  2E2H I;  1M1K 2;  1VQM Z;  1Q16 A;  2NAP A;  3GTJ I;  2KI7 B;  3VMI A;  1YHQ 1;  1N8R 1;  4NBD A;  3G4S 1;  3H0G I;  2NVY I;  2JA6 I;  3FQQ A;  2VPW A;  3FQM A;  3T4N B;  2DE5 A;  1K9M 2;  3FKI I;  4NH1 C;  1ML8 A;  3CC4 1;  3CXC Y;  5T67 A;  3JAM b;  1YHQ Z;  1VQ6 1;  2QEX 1;  5A2Q f;  3G4S Z;  2V45 A;  2PK7 A;  2DE6 A;  1WZN A;  2RT9 A;  4MON A;  4BBR I;  2JUB A;  5D1O B;  1VQP 1;  3CC4 Z;  1RO4 A;  3J81 b;  4HH4 A;  3GCF A;  1VQ6 Z;  4NBB A;  2R7Z I;  1VLA A;  3P5J B;  4RVD A;  3IFU A;  2OOX B;  1KC8 2;  3H3V J;  2Y0S A;  3VMH A;  1JJ2 Y;  4MD7 A;  2JR6 A;  1Z02 A;  4MXU A;  1JJ2 Z;  1Y1V S;  3J80 f;  2IZ3 A;  4E2Y A;  3VTN A;  1VQK 1;  2K3R A;  1SFO I;  4AYB A;  4MRI A;  1DL6 A;  1VQN 1;  3TDH B;  3CC7 1;  2R93 I;  2RHB A;  1QVG Y;  2VF1 A;  4BY1 I;  4A3E I;  3CPW Y;  2VUM I;  3D2L A;  2RBL A;  3CME 1;  3PO2 I;  3CPW Z;  3S2D I;  1VQ8 Z;  3J7A 4;  2PMZ A;  1VQK Z;  3CCE 1;  2OTL 1;  1I50 I;  1VQN Z;  2JA7 I;  4NBC A;  1N8R 2;  2E2I I;  3IF8 A;  5C4J I;  2V8J A;  4A3C I;  4S1T A;  3CME Z;  1W2B Y;  3S1Q I;  1QVF Z;  5AN9 F;  2E9H A;  5D1P A;  3OW2 Z;  4QTU A;  3CCE Z;  2OTL Z;  3CCV 1;  5C3E I;  2KPI A;  1QF8 A;  1Q81 1;  3CD6 Z;  2I3C A;  2JS4 A;  3G71 1;  3M4O I;  3KIH A;  3Q87 A;  3I07 A;  4DGL A;  1VQ9 1;  2F4M A;  3CCQ Z;  4NBF A;  4E32 A;  3NFZ A;  3KIF A;  1N2F A;  3F3F C;  3VMG A;  3MZK B;  3D9X A;  2ZAE B;  3S17 I;  3CCV Z;  3BG0 B;  1Q7Y 1;  5FLX f;  1YJN Z;  2JIO A;  1Q86 1;  3G71 Z;  1TWG I;  2JA8 I;  2K5R A;  1YIT 1;  3RZD I;  1VQ9 Z;  1YIJ 1;  4MD9 A;  3MZL B;  2V8I A;  4NOZ A;  1K73 1;  3CCJ 1;  2GU2 A;  3NH5 A;  4E31 A;  2O4H A;  2J6A A;  1KD1 1;  2P28 A;  3HOX I;  4RVH A;  5T6B A;  2G2K A;  2VPZ A;  1Z03 A;  3JAM f;  3GTL I;  2R6M A;  3CCU 1;  3S1N I;  4EWC A;  3HOW I;  4A3K I;  2OTJ 1;  3CCS 1;  2JA5 I;  1AA6 A;  1JWH C;  2QEX Z;  2V8K A;  3J81 f;  5C4X I;  4X6A I;  1S72 1;  3S2H I;  4MD8 A;  3CCU Z;  2VUG A;  2QA4 1;  1X0T A;  4E2X A;  3NH4 A;  2GTH A;  3CCS Z;  2OTJ Z;  4NBA A;  1VQP Z;  4MH4 A;  2JIM A;  1SIW A;  3S1M I;  3HOY I;  4E2Z A;  4A3B I;  5CM2 M;  5LL6 f;  1Q81 2;  3S1R I;  3HOV I;  1S72 Z;  2QRC B;  1NUI A;  2QA4 Z;  4NFR A;  2P3Y A;  3ESW A;  3GTK I; 
#chains in the Genus database with same CATH homology
 2PM9 A;  3MON A;  4A3G I;  4A3D I;  1USP A;  3NDI A;  2HU9 A;  3CC2 1;  4RVF A;  1Q7Y 2;  2H85 A;  1YI2 1;  3F3P C;  1Q86 2;  1YJ9 1;  4RS4 A;  1KQS Y;  3CC7 Z;  1VQO 1;  4A3F I;  1PFT A;  1QVF Y;  1Q82 1;  1KQS Z;  2F4O A;  3OW2 Y;  1K73 2;  4QTT A;  3CMA 1;  2LIY A;  1YJW 1;  2IZ4 A;  3D6W A;  2QKD A;  4Y52 I;  2M48 A;  1VQO Z;  2RPR A;  4CL1 A;  2QRE B;  3NDJ A;  2WAQ A;  2NVT I;  1YUA A;  4A93 I;  2RIQ A;  1S7M A;  1YJW Z;  2WB1 A;  2NVQ I;  1K8A 1;  1USP B;  4E33 A;  3CCM 1;  1VQM 1;  5IT9 b;  1RO2 A;  5IP7 I;  5IT9 f;  1ZH1 A;  4HGZ A;  1L1O C;  4E30 A;  1YUK A;  4A3I I;  1QYP A;  3I4M I;  2Q4Z A;  3I56 1;  1P9N A;  3CCM Z;  2QLV B;  1RLY A;  2HF1 A;  3S15 I;  4Y7N I;  4NBH A;  3I55 1;  4NBG A;  1YIT Z;  1Y1V I;  2DE7 A;  1YIJ Z;  4HGY A;  1M90 1;  2AKL A;  1RO0 A;  3GTG I;  3M3Y I;  3G6E 1;  1WII A;  2YU9 I;  3CCJ Z;  3I56 Z;  1TWC I;  3HOU I;  2JNY A;  3GTQ I;  2OOY B;  4RV9 A;  5A2Q b;  1ZB8 A;  3RZO I;  2W04 A;  3I55 Z;  3CXC Z;  1Q82 2;  5T64 A;  4DK1 A;  3G6E Z;  3HOZ I;  1NJI 1;  2B63 I;  1TWH I;  4TNU A;  1LQL A;  3TE5 B;  2Q51 A;  1VQ5 1;  3PO3 I;  3EER A;  3I4N I;  1M1K 1;  5IP9 I;  4BXX I;  2GTI A;  4NB8 A;  3IX0 A;  3BG1 B;  1VQ4 1;  3GTM I;  2NVX I;  5FLM I;  3CCL 1;  4RVG A;  4NBE A;  3S16 I;  4A3J I;  3J80 b;  1I6H I;  1K8A 2;  1VQ5 Z;  3CCR 1;  2QRD B;  1K9M 1;  1VQ8 1;  4E2W A;  1VQL 1;  3VB9 A;  1VQ4 Z;  1I3Q I;  4A3L I;  4XX2 A;  2E2J I;  2O53 A;  3U50 C;  3GKQ A;  3CCL Z;  3EED A;  1TFI A;  2EGT A;  1QVG Z;  1X3Z A;  4BY7 I;  3CCR Z;  1WCM I;  3CC2 Z;  1KD1 2;  1VQL Z;  1YI2 Z;  1Y1W I;  3GTP I;  1YJ9 Z;  2OZK A;  3QWU A;  4DQY B;  3CD6 1;  1K83 I;  1M90 2;  1RQF A;  4NB9 A;  1R9T I;  2LFU A;  3HKZ A;  3PO3 S;  1KC8 1;  1TWA I;  1Z01 A;  1NP6 A;  3CCQ 1;  1VQ7 1;  3CMA Z;  3LUS A;  1WW9 A;  2BJO A;  3NH8 A;  1W2B Z;  3K7A I;  3GTM S;  4A3M I;  2W03 A;  3GTO I;  3S14 I;  1YJN 1;  2M6N A;  1RNI A;  2YAD A;  2JMO A;  2R92 I;  1ZB9 A;  1NJI 2;  2QR1 B;  1VQ7 Z;  3CQZ I;  1X3W A;  1KRL A;  1TWF I;  5D1O A;  5FLX b;  4BBS I;  5C44 I;  2E2H I;  1M1K 2;  1VQM Z;  3GTJ I;  2KI7 B;  3VMI A;  1YHQ 1;  1N8R 1;  4NBD A;  3G4S 1;  3H0G I;  2NVY I;  2JA6 I;  3FQQ A;  3FQM A;  3T4N B;  2DE5 A;  1K9M 2;  3FKI I;  4NH1 C;  1ML8 A;  3CC4 1;  3CXC Y;  5T67 A;  3JAM b;  1YHQ Z;  1VQ6 1;  2QEX 1;  5A2Q f;  3G4S Z;  2PK7 A;  2DE6 A;  2RT9 A;  4MON A;  4BBR I;  2JUB A;  5D1O B;  1VQP 1;  3CC4 Z;  1RO4 A;  3J81 b;  4HH4 A;  3GCF A;  1VQ6 Z;  4NBB A;  2R7Z I;  1VLA A;  3P5J B;  4RVD A;  3IFU A;  2OOX B;  1KC8 2;  3H3V J;  2Y0S A;  3VMH A;  1JJ2 Y;  4MD7 A;  2JR6 A;  1Z02 A;  4MXU A;  1JJ2 Z;  1Y1V S;  3J80 f;  2IZ3 A;  4E2Y A;  3VTN A;  1VQK 1;  2K3R A;  1SFO I;  4AYB A;  4MRI A;  1DL6 A;  1VQN 1;  3TDH B;  3CC7 1;  2R93 I;  2RHB A;  1QVG Y;  2VF1 A;  4BY1 I;  4A3E I;  3CPW Y;  2VUM I;  2RBL A;  3CME 1;  3PO2 I;  3CPW Z;  3S2D I;  1VQ8 Z;  3J7A 4;  2PMZ A;  1VQK Z;  3CCE 1;  2OTL 1;  1I50 I;  1VQN Z;  2JA7 I;  4NBC A;  1N8R 2;  2E2I I;  3IF8 A;  5C4J I;  2V8J A;  4A3C I;  4S1T A;  3CME Z;  1W2B Y;  3S1Q I;  1QVF Z;  5AN9 F;  2E9H A;  5D1P A;  3OW2 Z;  4QTU A;  3CCE Z;  2OTL Z;  3CCV 1;  5C3E I;  2KPI A;  1QF8 A;  1Q81 1;  3CD6 Z;  2I3C A;  2JS4 A;  3G71 1;  3M4O I;  3KIH A;  3Q87 A;  3I07 A;  4DGL A;  1VQ9 1;  2F4M A;  3CCQ Z;  4NBF A;  4E32 A;  3NFZ A;  3KIF A;  1N2F A;  3F3F C;  3VMG A;  3MZK B;  3D9X A;  2ZAE B;  3S17 I;  3CCV Z;  3BG0 B;  1Q7Y 1;  5FLX f;  1YJN Z;  1Q86 1;  3G71 Z;  1TWG I;  2JA8 I;  2K5R A;  1YIT 1;  3RZD I;  1VQ9 Z;  1YIJ 1;  4MD9 A;  3MZL B;  2V8I A;  4NOZ A;  1K73 1;  3CCJ 1;  2GU2 A;  3NH5 A;  4E31 A;  2O4H A;  2J6A A;  1KD1 1;  2P28 A;  3HOX I;  4RVH A;  5T6B A;  2G2K A;  1Z03 A;  3JAM f;  3GTL I;  2R6M A;  3CCU 1;  3S1N I;  4EWC A;  3HOW I;  4A3K I;  2OTJ 1;  3CCS 1;  2JA5 I;  1JWH C;  2QEX Z;  2V8K A;  3J81 f;  5C4X I;  4X6A I;  1S72 1;  3S2H I;  4MD8 A;  3CCU Z;  2VUG A;  2QA4 1;  1X0T A;  4E2X A;  3NH4 A;  2GTH A;  3CCS Z;  2OTJ Z;  4NBA A;  1VQP Z;  4MH4 A;  3S1M I;  3HOY I;  4E2Z A;  4A3B I;  5CM2 M;  5LL6 f;  1Q81 2;  3S1R I;  3HOV I;  1S72 Z;  2QRC B;  1NUI A;  2QA4 Z;  4NFR A;  2P3Y A;  3ESW A;  3GTK I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...