3CCQZ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccqZ00
1VQP1 1VQLZ 2OTLZ 3CCM1 1KQSY 2OTJZ 1K9M1 3CCS1 3CD61 1VQPZ 1VQO1 1VQN1 3CCMZ 3CME1 1VQMZ 1Q862 3CD6Z 1VQOZ 1M901 1Q7Y2 1N8R1 1K8A1 1VQKZ 1VQ51 1QVFZ 1Q821 1VQ41 3CCQ1 2QEX1 3CC71 1W2BY 1KD11 1QVGZ 3CCQZ 1K9M2 2QEXZ 3CC7Z 3CCSZ 1VQNZ 1W2BZ 1YJN1 3G6E1 3CMEZ 3G4S1 1QVFY 1KC81 1YJ91 1M1K2 1VQ61 3I561 3I551 1NJI1 1M902 1YJNZ 1Q811 3G6EZ 3G4SZ 1KC82 1VQ6Z 3I56Z 1N8R2 1JJ2Y 1S721 3CCE1 1VQ71 1K8A2 3CCV1 1QVGY 1VQ5Z 3CCL1 1S72Z 3CCEZ 3CCJ1 3CC41 1JJ2Z 1YJW1 3CCVZ 1Q822 1VQ4Z 1YIJ1 3CXCZ 1VQ91 1YIT1 3CCLZ 1K731 1M1K1 1VQ81 3CCJZ 3CMA1 3CCU1 1YIJZ 1KD12 1YHQ1 2QA41 3CCR1 1VQ8Z 2OTJ1 3CMAZ 1YHQZ 2QA4Z 1YJ9Z 3CCRZ 3OW2Z 3CPWY 3I55Z 1VQM1 1YI21 1Q861 1NJI2 1Q812 3G711 3CXCY 1YI2Z 3CPWZ 1Q7Y1 1KQSZ 3G71Z 1VQ7Z 3CC21 1VQK1 3CC4Z 3CC2Z 1YJWZ 3OW2Y 1VQL1 2OTL1 1VQ9Z 1YITZ 1K732 3CCUZ
chains in the Genus database with same CATH superfamily
2NVYI 3TDHB 1I3QI 2OTJZ 2PMZA 4NBCA 1VLAA 1S7MA 1SFOI 3Q87A 3CCS1 3M3YI 1VQO1 3CCMZ 5IP7I 2JA6I 1VQMZ 2VPWA 2IV2X 2K3RA 4NH1C 3NH4A 4RVGA 1NUIA 5D1OA 2E2HI 3PO2I 5D1PA 1Q7Y2 2EGTA 3FQQA 2V8KA 2JA7I 3GKQA 1VQKZ 1VQ51 1QVFZ 3GTPI 1VQ41 1L1OC 2JA5I 4RVHA 3JAMb 1W2BY 4E2YA 1QVGZ 4NB9A 1K9M2 2GTIA 3CC7Z 2R93I 4NBAA 2JNYA 5FLXf 3G6E1 2R6MA 3CMEZ 1I50I 4MONA 1QVFY 2B63I 1KC81 2NAPA 3I561 1VQ61 3I551 3I07A 3MONA 1NJI1 4RS4A 3EEDA 3G4SZ 4HGZA 1KC82 4A3DI 1JJ2Y 1RQFA 3J81b 1S721 3CCE1 2RHBA 1QVGY 3CCJ1 1YJW1 4BBRI 3CCLZ 3CMA1 2IZ4A 3CCU1 1NP6A 1YHQ1 2QLVB 3QWUA 4E33A 1Y8CA 4A3KI 2W03A 4NBFA 4QTUA 2RPRA 2QA4Z 3U50C 1YI21 1Q861 1Q812 3G711 1SIWA 5FLMI 3KIFA 4NBBA 3CPWZ 3CC21 4A3II 5IT9b 3PO3S 2DE6A 2KPIA 4MXUA 1VQL1 1M1K2 4BY1I 2KI7B 3H3VJ 2OTLZ 2JIPA 2OOYB 2DE7A 5T67A 2R7ZI 5CM2M 3CD61 1ZB9A 2PM9A 3IF8A 1VQN1 2HU9A 3I4MI 3S1QI 1VQOZ 2J6AA 4MH4A 2I3CA 2VPYA 1Z02A 1WIIA 1M901 3GTMS 5A2Qf 2NVQI 4RV9A 1TWAI 1Z01A 1ZB8A 3VMHA 3S2HI 1K8A1 5D1OB 3BG0B 2NVTI 4TNUA 2V8IA 3NDIA 2F4MA 3S1RI 3F3PC 3S1MI 4X6AI 3M4OI 4NBEA 5IP9I 1TWCI 3CQZI 4MD7A 1W2BZ 1YJN1 2VUGA 2JUBA 2E9HA 1K83I 2R92I 3IX0A 3G6EZ 4MRIA 1VQ6Z 3I56Z 4A3BI 3S1NI 1RNIA 3D6WA 2QKDA 1S72Z 3CCEZ 1JJ2Z 2RT9A 4E32A 3CXCZ 2E2II 2ZAEB 2VUMI 1VQ91 3ESWA 5FLXb 1K731 3CCJZ 1VQ81 3CCR1 2OTJ1 2M6NA 2VF1A 3CMAZ 4E2XA 4A3EI 1YHQZ 3GTLI 1YJ9Z 3HOWI 1VQM1 1NJI2 2JA8I 4MD9A 3CXCY 3NFZA 2G2KA 3RZDI 3JAMf 2W04A 1YI2Z 2WB1A 3GTOI 3G71Z 1VQ7Z 1Y1VI 1VQK1 3MZKB 3CC2Z 3CC4Z 3S17I 1X0TA 1YITZ 2JIMA 4E30A 4DK1A 4A93I 3MZLB 4DQYB 1VQP1 1VQLZ 4A3LI 3J81f 1USPA 1LQLA 4NOZA 4A3FI 2QRCB 2AKLA 1KRLA 3S14I 3CME1 1Q862 3F3FC 1TWGI 3CD6Z 2K5RA 4MD8A 3HOXI 2F4OA 4NB8A 1RO0A 1AA6A 5LL6f 1N2FA 1N8R1 1RO2A 1WJ2A 3HOVI 1Z03A 1ML8A 3FKII 1RLYA 3P5JB 4RVDA 1PFTA 1Q821 3NDJA 2YU9I 3J80b 1R9TI 4A3JI 3CCQ1 2QEX1 1JWHC 4NBHA 2GTHA 4HH4A 3VMGA 1KD11 4EWCA 3CCSZ 2V8JA 5A2Qb 3J7A4 4NBGA 3LUSA 1M902 1YJNZ 2E7ZA 2PK7A 2O53A 1P9NA 1WZNA 4BY7I 3HOZI 2QREB 3KIHA 1K8A2 3RZOI 3CCV1 4NFRA 1VQ5Z 1YUAA 4E2WA 5C4JI 5C44I 5T64A 1VQ4Z 4E2ZA 5C4XI 1YIJ1 3S2DI 2QRDB 1VQ8Z 2V45A 4A3GI 3CCRZ 3OW2Z 1WCMI 3HOUI 3I55Z 1X3ZA 1DL6A 2JIOA 3HKZA 4XX2A 1WW9A 1Q7Y1 1KQSZ 2NVXI 3VTNA 1RO4A 4BXXI 1Y1WI 2QR1B 4BBSI 3D2LA 4CL1A 2M48A 2JIRA 1YJWZ 1Q16A 2P3YA 3OW2Y 1QXFA 1K732 3CCUZ 2BJOA 3GTKI 3CCM1 1KQSY 3VB9A 3GTJI 4S1TA 1K9M1 1Y1VS 1VQPZ 3NH5A 4E31A 2JR6A 5C3EI 1USPB 2LFUA 2OZKA 3FQMA 1FDOA 2LIYA 2HF1A 3H0GI 1QF8A 4QTTA 1TWHI 2V3VA 2YADA 2Q4ZA 2RBLA 3BG1B 3GCFA 2O4HA 4HGYA 3CC71 4A3CI 4NBDA 1YUKA 3CCQZ 2QEXZ 1VQNZ 2OOXB 4DGLA 3G4S1 2VPXA 1YJ91 2VPZA 3K7AI 1Q811 1N8R2 2LEXA 4AYBA 1VQ71 1TFIA 2Q51A 2RIQA 3S15I 1FDIA 3CCL1 3CC41 2WAQA 3CCVZ 4A3MI 1Q822 3T4NB 3IR7A 1YIT1 5IT9f 1M1K1 2JS4A 2AYDA 2H85A 3TE5B 1YIJZ 2P28A 4RVFA 1KD12 1TWFI 5T6BA 2QA41 4Y7NI 3PO3I 3GTQI 3IFUA 3S16I 5AN9F 1X3WA 3CPWY 4Y52I 1ZH1A 3EERA 3J80f 2Y0SA 2GU2A 2JMOA 3I4NI 1I6HI 2E2JI 3D9XA 3HOYI 2DE5A 1QYPA 3VMIA 3NH8A 2OTL1 3GTMI 1VQ9Z 3GTGI 2IZ3A 2JIQA
chains in the Genus database with same CATH topology
2NVYI 3TDHB 1I3QI 2OTJZ 2PMZA 4NBCA 1VLAA 1S7MA 1SFOI 3Q87A 3CCS1 3M3YI 1VQO1 3CCMZ 5IP7I 2JA6I 1VQMZ 2K3RA 4NH1C 3NH4A 4RVGA 1NUIA 5D1OA 2E2HI 3PO2I 5D1PA 1Q7Y2 2EGTA 3FQQA 2V8KA 2JA7I 3GKQA 1VQKZ 1VQ51 1QVFZ 3GTPI 1VQ41 1L1OC 2JA5I 4RVHA 3JAMb 1W2BY 4E2YA 1QVGZ 4NB9A 1K9M2 2GTIA 3CC7Z 2R93I 4NBAA 2JNYA 5FLXf 3G6E1 2R6MA 3CMEZ 1I50I 4MONA 1QVFY 2B63I 1KC81 1VQ61 3I561 3I551 3I07A 3MONA 1NJI1 4RS4A 3EEDA 3G4SZ 4HGZA 1KC82 4A3DI 1JJ2Y 1RQFA 3J81b 1S721 3CCE1 2RHBA 1QVGY 3CCJ1 1YJW1 4BBRI 3CCLZ 3CMA1 2IZ4A 3CCU1 1NP6A 1YHQ1 2QLVB 3QWUA 4E33A 4A3KI 2W03A 4NBFA 4QTUA 2RPRA 2QA4Z 3U50C 1YI21 1Q861 1Q812 3G711 5FLMI 3KIFA 4NBBA 3CPWZ 3CC21 4A3II 5IT9b 3PO3S 2DE6A 2KPIA 4MXUA 1VQL1 1M1K2 4BY1I 2KI7B 3H3VJ 2OTLZ 2OOYB 2DE7A 5T67A 2R7ZI 5CM2M 3CD61 1ZB9A 2PM9A 3IF8A 1VQN1 2HU9A 3I4MI 3S1QI 1VQOZ 2J6AA 4MH4A 2I3CA 1Z02A 1WIIA 1M901 3GTMS 5A2Qf 2NVQI 4RV9A 1TWAI 1Z01A 1ZB8A 3VMHA 3S2HI 1K8A1 5D1OB 3BG0B 2NVTI 4TNUA 2V8IA 3NDIA 2F4MA 3S1RI 3F3PC 3S1MI 4X6AI 3M4OI 4NBEA 5IP9I 1TWCI 3CQZI 4MD7A 1W2BZ 1YJN1 2VUGA 2JUBA 2E9HA 1K83I 2R92I 3IX0A 3G6EZ 4MRIA 1VQ6Z 3I56Z 4A3BI 3S1NI 1RNIA 3D6WA 2QKDA 1S72Z 3CCEZ 1JJ2Z 2RT9A 4E32A 3CXCZ 2E2II 2ZAEB 2VUMI 1VQ91 3ESWA 5FLXb 1K731 3CCJZ 1VQ81 3CCR1 2OTJ1 2M6NA 2VF1A 3CMAZ 4E2XA 4A3EI 1YHQZ 3GTLI 1YJ9Z 3HOWI 1VQM1 1NJI2 2JA8I 4MD9A 3CXCY 3NFZA 2G2KA 3RZDI 3JAMf 2W04A 1YI2Z 2WB1A 3GTOI 3G71Z 1VQ7Z 1Y1VI 1VQK1 3MZKB 3CC2Z 3CC4Z 3S17I 1X0TA 1YITZ 4E30A 4DK1A 4A93I 3MZLB 4DQYB 1VQP1 1VQLZ 4A3LI 3J81f 1USPA 1LQLA 4NOZA 4A3FI 2QRCB 2AKLA 1KRLA 3S14I 3CME1 1Q862 3F3FC 1TWGI 3CD6Z 2K5RA 4MD8A 3HOXI 2F4OA 4NB8A 1RO0A 5LL6f 1N2FA 1N8R1 1RO2A 3HOVI 1Z03A 1ML8A 3FKII 1RLYA 3P5JB 4RVDA 1PFTA 1Q821 3NDJA 2YU9I 3J80b 1R9TI 4A3JI 3CCQ1 2QEX1 1JWHC 4NBHA 2GTHA 4HH4A 3VMGA 1KD11 4EWCA 3CCSZ 2V8JA 5A2Qb 3J7A4 4NBGA 3LUSA 1M902 1YJNZ 2PK7A 2O53A 1P9NA 4BY7I 3HOZI 2QREB 3KIHA 1K8A2 3RZOI 3CCV1 4NFRA 1VQ5Z 1YUAA 4E2WA 5C4JI 5C44I 5T64A 1VQ4Z 4E2ZA 5C4XI 1YIJ1 3S2DI 2QRDB 1VQ8Z 4A3GI 3CCRZ 3OW2Z 1WCMI 3HOUI 3I55Z 1X3ZA 1DL6A 3HKZA 4XX2A 1WW9A 1Q7Y1 1KQSZ 2NVXI 3VTNA 1RO4A 4BXXI 1Y1WI 2QR1B 4BBSI 4CL1A 2M48A 1YJWZ 2P3YA 3OW2Y 1K732 3CCUZ 2BJOA 3GTKI 3CCM1 1KQSY 3VB9A 3GTJI 4S1TA 1K9M1 1Y1VS 1VQPZ 3NH5A 4E31A 2JR6A 5C3EI 1USPB 2LFUA 2OZKA 3FQMA 2LIYA 2HF1A 3H0GI 1QF8A 4QTTA 1TWHI 2YADA 2Q4ZA 2RBLA 3BG1B 3GCFA 2O4HA 4HGYA 3CC71 4A3CI 4NBDA 1YUKA 3CCQZ 2QEXZ 1VQNZ 2OOXB 4DGLA 3G4S1 1YJ91 3K7AI 1Q811 1N8R2 4AYBA 1VQ71 1TFIA 2Q51A 2RIQA 3S15I 3CCL1 3CC41 2WAQA 3CCVZ 4A3MI 1Q822 3T4NB 1YIT1 5IT9f 1M1K1 2JS4A 2H85A 3TE5B 1YIJZ 2P28A 4RVFA 1KD12 1TWFI 5T6BA 2QA41 4Y7NI 3PO3I 3GTQI 3IFUA 3S16I 5AN9F 1X3WA 3CPWY 4Y52I 1ZH1A 3EERA 3J80f 2Y0SA 2GU2A 2JMOA 3I4NI 1I6HI 2E2JI 3D9XA 3HOYI 2DE5A 1QYPA 3VMIA 3NH8A 2OTL1 3GTMI 1VQ9Z 3GTGI 2IZ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQP 1;  1VQL Z;  2OTL Z;  3CCM 1;  1KQS Y;  2OTJ Z;  1K9M 1;  3CCS 1;  3CD6 1;  1VQP Z;  1VQO 1;  1VQN 1;  3CCM Z;  3CME 1;  1VQM Z;  1Q86 2;  3CD6 Z;  1VQO Z;  1M90 1;  1Q7Y 2;  1N8R 1;  1K8A 1;  1VQK Z;  1VQ5 1;  1QVF Z;  1Q82 1;  1VQ4 1;  3CCQ 1;  2QEX 1;  3CC7 1;  1W2B Y;  1KD1 1;  1QVG Z;  3CCQ Z;  1K9M 2;  2QEX Z;  3CC7 Z;  3CCS Z;  1VQN Z;  1W2B Z;  1YJN 1;  3G6E 1;  3CME Z;  3G4S 1;  1QVF Y;  1KC8 1;  1YJ9 1;  1M1K 2;  1VQ6 1;  3I56 1;  3I55 1;  1NJI 1;  1M90 2;  1YJN Z;  1Q81 1;  3G6E Z;  3G4S Z;  1KC8 2;  1VQ6 Z;  3I56 Z;  1N8R 2;  1JJ2 Y;  1S72 1;  3CCE 1;  1VQ7 1;  1K8A 2;  3CCV 1;  1QVG Y;  1VQ5 Z;  3CCL 1;  1S72 Z;  3CCE Z;  3CCJ 1;  3CC4 1;  1JJ2 Z;  1YJW 1;  3CCV Z;  1Q82 2;  1VQ4 Z;  1YIJ 1;  3CXC Z;  1VQ9 1;  1YIT 1;  3CCL Z;  1K73 1;  1M1K 1;  1VQ8 1;  3CCJ Z;  3CMA 1;  3CCU 1;  1YIJ Z;  1KD1 2;  1YHQ 1;  2QA4 1;  3CCR 1;  1VQ8 Z;  2OTJ 1;  3CMA Z;  1YHQ Z;  2QA4 Z;  1YJ9 Z;  3CCR Z;  3OW2 Z;  3CPW Y;  3I55 Z;  1VQM 1;  1YI2 1;  1Q86 1;  1NJI 2;  1Q81 2;  3G71 1;  3CXC Y;  1YI2 Z;  3CPW Z;  1Q7Y 1;  1KQS Z;  3G71 Z;  1VQ7 Z;  3CC2 1;  1VQK 1;  3CC4 Z;  3CC2 Z;  1YJW Z;  3OW2 Y;  1VQL 1;  2OTL 1;  1VQ9 Z;  1YIT Z;  1K73 2;  3CCU Z; 
#chains in the Genus database with same CATH topology
 2NVY I;  3TDH B;  1I3Q I;  2OTJ Z;  2PMZ A;  4NBC A;  1VLA A;  1S7M A;  1SFO I;  3Q87 A;  3CCS 1;  3M3Y I;  1VQO 1;  3CCM Z;  5IP7 I;  2JA6 I;  1VQM Z;  2VPW A;  2IV2 X;  2K3R A;  4NH1 C;  3NH4 A;  4RVG A;  1NUI A;  5D1O A;  2E2H I;  3PO2 I;  5D1P A;  1Q7Y 2;  2EGT A;  3FQQ A;  2V8K A;  2JA7 I;  3GKQ A;  1VQK Z;  1VQ5 1;  1QVF Z;  3GTP I;  1VQ4 1;  1L1O C;  2JA5 I;  4RVH A;  3JAM b;  1W2B Y;  4E2Y A;  1QVG Z;  4NB9 A;  1K9M 2;  2GTI A;  3CC7 Z;  2R93 I;  4NBA A;  2JNY A;  5FLX f;  3G6E 1;  2R6M A;  3CME Z;  1I50 I;  4MON A;  1QVF Y;  2B63 I;  1KC8 1;  2NAP A;  3I56 1;  1VQ6 1;  3I55 1;  3I07 A;  3MON A;  1NJI 1;  4RS4 A;  3EED A;  3G4S Z;  4HGZ A;  1KC8 2;  4A3D I;  1JJ2 Y;  1RQF A;  3J81 b;  1S72 1;  3CCE 1;  2RHB A;  1QVG Y;  3CCJ 1;  1YJW 1;  4BBR I;  3CCL Z;  3CMA 1;  2IZ4 A;  3CCU 1;  1NP6 A;  1YHQ 1;  2QLV B;  3QWU A;  4E33 A;  1Y8C A;  4A3K I;  2W03 A;  4NBF A;  4QTU A;  2RPR A;  2QA4 Z;  3U50 C;  1YI2 1;  1Q86 1;  1Q81 2;  3G71 1;  1SIW A;  5FLM I;  3KIF A;  4NBB A;  3CPW Z;  3CC2 1;  4A3I I;  5IT9 b;  3PO3 S;  2DE6 A;  2KPI A;  4MXU A;  1VQL 1;  1M1K 2;  4BY1 I;  2KI7 B;  3H3V J;  2OTL Z;  2JIP A;  2OOY B;  2DE7 A;  5T67 A;  2R7Z I;  5CM2 M;  3CD6 1;  1ZB9 A;  2PM9 A;  3IF8 A;  1VQN 1;  2HU9 A;  3I4M I;  3S1Q I;  1VQO Z;  2J6A A;  4MH4 A;  2I3C A;  2VPY A;  1Z02 A;  1WII A;  1M90 1;  3GTM S;  5A2Q f;  2NVQ I;  4RV9 A;  1TWA I;  1Z01 A;  1ZB8 A;  3VMH A;  3S2H I;  1K8A 1;  5D1O B;  3BG0 B;  2NVT I;  4TNU A;  2V8I A;  3NDI A;  2F4M A;  3S1R I;  3F3P C;  3S1M I;  4X6A I;  3M4O I;  4NBE A;  5IP9 I;  1TWC I;  3CQZ I;  4MD7 A;  1W2B Z;  1YJN 1;  2VUG A;  2JUB A;  2E9H A;  1K83 I;  2R92 I;  3IX0 A;  3G6E Z;  4MRI A;  1VQ6 Z;  3I56 Z;  4A3B I;  3S1N I;  1RNI A;  3D6W A;  2QKD A;  1S72 Z;  3CCE Z;  1JJ2 Z;  2RT9 A;  4E32 A;  3CXC Z;  2E2I I;  2ZAE B;  2VUM I;  1VQ9 1;  3ESW A;  5FLX b;  1K73 1;  3CCJ Z;  1VQ8 1;  3CCR 1;  2OTJ 1;  2M6N A;  2VF1 A;  3CMA Z;  4E2X A;  4A3E I;  1YHQ Z;  3GTL I;  1YJ9 Z;  3HOW I;  1VQM 1;  1NJI 2;  2JA8 I;  4MD9 A;  3CXC Y;  3NFZ A;  2G2K A;  3RZD I;  3JAM f;  2W04 A;  1YI2 Z;  2WB1 A;  3GTO I;  3G71 Z;  1VQ7 Z;  1Y1V I;  1VQK 1;  3MZK B;  3CC2 Z;  3CC4 Z;  3S17 I;  1X0T A;  1YIT Z;  2JIM A;  4E30 A;  4DK1 A;  4A93 I;  3MZL B;  4DQY B;  1VQP 1;  1VQL Z;  4A3L I;  3J81 f;  1USP A;  1LQL A;  4NOZ A;  4A3F I;  2QRC B;  2AKL A;  1KRL A;  3S14 I;  3CME 1;  1Q86 2;  3F3F C;  1TWG I;  3CD6 Z;  2K5R A;  4MD8 A;  3HOX I;  2F4O A;  4NB8 A;  1RO0 A;  1AA6 A;  5LL6 f;  1N2F A;  1N8R 1;  1RO2 A;  1WJ2 A;  3HOV I;  1Z03 A;  1ML8 A;  3FKI I;  1RLY A;  3P5J B;  4RVD A;  1PFT A;  1Q82 1;  3NDJ A;  2YU9 I;  3J80 b;  1R9T I;  4A3J I;  3CCQ 1;  2QEX 1;  1JWH C;  4NBH A;  2GTH A;  4HH4 A;  3VMG A;  1KD1 1;  4EWC A;  3CCS Z;  2V8J A;  5A2Q b;  3J7A 4;  4NBG A;  3LUS A;  1M90 2;  1YJN Z;  2E7Z A;  2PK7 A;  2O53 A;  1P9N A;  1WZN A;  4BY7 I;  3HOZ I;  2QRE B;  3KIH A;  1K8A 2;  3RZO I;  3CCV 1;  4NFR A;  1VQ5 Z;  1YUA A;  4E2W A;  5C4J I;  5C44 I;  5T64 A;  1VQ4 Z;  4E2Z A;  5C4X I;  1YIJ 1;  3S2D I;  2QRD B;  1VQ8 Z;  2V45 A;  4A3G I;  3CCR Z;  3OW2 Z;  1WCM I;  3HOU I;  3I55 Z;  1X3Z A;  1DL6 A;  2JIO A;  3HKZ A;  4XX2 A;  1WW9 A;  1Q7Y 1;  1KQS Z;  2NVX I;  3VTN A;  1RO4 A;  4BXX I;  1Y1W I;  2QR1 B;  4BBS I;  3D2L A;  4CL1 A;  2M48 A;  2JIR A;  1YJW Z;  1Q16 A;  2P3Y A;  3OW2 Y;  1QXF A;  1K73 2;  3CCU Z;  2BJO A;  3GTK I;  3CCM 1;  1KQS Y;  3VB9 A;  3GTJ I;  4S1T A;  1K9M 1;  1Y1V S;  1VQP Z;  3NH5 A;  4E31 A;  2JR6 A;  5C3E I;  1USP B;  2LFU A;  2OZK A;  3FQM A;  1FDO A;  2LIY A;  2HF1 A;  3H0G I;  1QF8 A;  4QTT A;  1TWH I;  2V3V A;  2YAD A;  2Q4Z A;  2RBL A;  3BG1 B;  3GCF A;  2O4H A;  4HGY A;  3CC7 1;  4A3C I;  4NBD A;  1YUK A;  3CCQ Z;  2QEX Z;  1VQN Z;  2OOX B;  4DGL A;  3G4S 1;  2VPX A;  1YJ9 1;  2VPZ A;  3K7A I;  1Q81 1;  1N8R 2;  2LEX A;  4AYB A;  1VQ7 1;  1TFI A;  2Q51 A;  2RIQ A;  3S15 I;  1FDI A;  3CCL 1;  3CC4 1;  2WAQ A;  3CCV Z;  4A3M I;  1Q82 2;  3T4N B;  3IR7 A;  1YIT 1;  5IT9 f;  1M1K 1;  2JS4 A;  2AYD A;  2H85 A;  3TE5 B;  1YIJ Z;  2P28 A;  4RVF A;  1KD1 2;  1TWF I;  5T6B A;  2QA4 1;  4Y7N I;  3PO3 I;  3GTQ I;  3IFU A;  3S16 I;  5AN9 F;  1X3W A;  3CPW Y;  4Y52 I;  1ZH1 A;  3EER A;  3J80 f;  2Y0S A;  2GU2 A;  2JMO A;  3I4N I;  1I6H I;  2E2J I;  3D9X A;  3HOY I;  2DE5 A;  1QYP A;  3VMI A;  3NH8 A;  2OTL 1;  3GTM I;  1VQ9 Z;  3GTG I;  2IZ3 A;  2JIQ A; 
#chains in the Genus database with same CATH homology
 2NVY I;  3TDH B;  1I3Q I;  2OTJ Z;  2PMZ A;  4NBC A;  1VLA A;  1S7M A;  1SFO I;  3Q87 A;  3CCS 1;  3M3Y I;  1VQO 1;  3CCM Z;  5IP7 I;  2JA6 I;  1VQM Z;  2K3R A;  4NH1 C;  3NH4 A;  4RVG A;  1NUI A;  5D1O A;  2E2H I;  3PO2 I;  5D1P A;  1Q7Y 2;  2EGT A;  3FQQ A;  2V8K A;  2JA7 I;  3GKQ A;  1VQK Z;  1VQ5 1;  1QVF Z;  3GTP I;  1VQ4 1;  1L1O C;  2JA5 I;  4RVH A;  3JAM b;  1W2B Y;  4E2Y A;  1QVG Z;  4NB9 A;  1K9M 2;  2GTI A;  3CC7 Z;  2R93 I;  4NBA A;  2JNY A;  5FLX f;  3G6E 1;  2R6M A;  3CME Z;  1I50 I;  4MON A;  1QVF Y;  2B63 I;  1KC8 1;  1VQ6 1;  3I56 1;  3I55 1;  3I07 A;  3MON A;  1NJI 1;  4RS4 A;  3EED A;  3G4S Z;  4HGZ A;  1KC8 2;  4A3D I;  1JJ2 Y;  1RQF A;  3J81 b;  1S72 1;  3CCE 1;  2RHB A;  1QVG Y;  3CCJ 1;  1YJW 1;  4BBR I;  3CCL Z;  3CMA 1;  2IZ4 A;  3CCU 1;  1NP6 A;  1YHQ 1;  2QLV B;  3QWU A;  4E33 A;  4A3K I;  2W03 A;  4NBF A;  4QTU A;  2RPR A;  2QA4 Z;  3U50 C;  1YI2 1;  1Q86 1;  1Q81 2;  3G71 1;  5FLM I;  3KIF A;  4NBB A;  3CPW Z;  3CC2 1;  4A3I I;  5IT9 b;  3PO3 S;  2DE6 A;  2KPI A;  4MXU A;  1VQL 1;  1M1K 2;  4BY1 I;  2KI7 B;  3H3V J;  2OTL Z;  2OOY B;  2DE7 A;  5T67 A;  2R7Z I;  5CM2 M;  3CD6 1;  1ZB9 A;  2PM9 A;  3IF8 A;  1VQN 1;  2HU9 A;  3I4M I;  3S1Q I;  1VQO Z;  2J6A A;  4MH4 A;  2I3C A;  1Z02 A;  1WII A;  1M90 1;  3GTM S;  5A2Q f;  2NVQ I;  4RV9 A;  1TWA I;  1Z01 A;  1ZB8 A;  3VMH A;  3S2H I;  1K8A 1;  5D1O B;  3BG0 B;  2NVT I;  4TNU A;  2V8I A;  3NDI A;  2F4M A;  3S1R I;  3F3P C;  3S1M I;  4X6A I;  3M4O I;  4NBE A;  5IP9 I;  1TWC I;  3CQZ I;  4MD7 A;  1W2B Z;  1YJN 1;  2VUG A;  2JUB A;  2E9H A;  1K83 I;  2R92 I;  3IX0 A;  3G6E Z;  4MRI A;  1VQ6 Z;  3I56 Z;  4A3B I;  3S1N I;  1RNI A;  3D6W A;  2QKD A;  1S72 Z;  3CCE Z;  1JJ2 Z;  2RT9 A;  4E32 A;  3CXC Z;  2E2I I;  2ZAE B;  2VUM I;  1VQ9 1;  3ESW A;  5FLX b;  1K73 1;  3CCJ Z;  1VQ8 1;  3CCR 1;  2OTJ 1;  2M6N A;  2VF1 A;  3CMA Z;  4E2X A;  4A3E I;  1YHQ Z;  3GTL I;  1YJ9 Z;  3HOW I;  1VQM 1;  1NJI 2;  2JA8 I;  4MD9 A;  3CXC Y;  3NFZ A;  2G2K A;  3RZD I;  3JAM f;  2W04 A;  1YI2 Z;  2WB1 A;  3GTO I;  3G71 Z;  1VQ7 Z;  1Y1V I;  1VQK 1;  3MZK B;  3CC2 Z;  3CC4 Z;  3S17 I;  1X0T A;  1YIT Z;  4E30 A;  4DK1 A;  4A93 I;  3MZL B;  4DQY B;  1VQP 1;  1VQL Z;  4A3L I;  3J81 f;  1USP A;  1LQL A;  4NOZ A;  4A3F I;  2QRC B;  2AKL A;  1KRL A;  3S14 I;  3CME 1;  1Q86 2;  3F3F C;  1TWG I;  3CD6 Z;  2K5R A;  4MD8 A;  3HOX I;  2F4O A;  4NB8 A;  1RO0 A;  5LL6 f;  1N2F A;  1N8R 1;  1RO2 A;  3HOV I;  1Z03 A;  1ML8 A;  3FKI I;  1RLY A;  3P5J B;  4RVD A;  1PFT A;  1Q82 1;  3NDJ A;  2YU9 I;  3J80 b;  1R9T I;  4A3J I;  3CCQ 1;  2QEX 1;  1JWH C;  4NBH A;  2GTH A;  4HH4 A;  3VMG A;  1KD1 1;  4EWC A;  3CCS Z;  2V8J A;  5A2Q b;  3J7A 4;  4NBG A;  3LUS A;  1M90 2;  1YJN Z;  2PK7 A;  2O53 A;  1P9N A;  4BY7 I;  3HOZ I;  2QRE B;  3KIH A;  1K8A 2;  3RZO I;  3CCV 1;  4NFR A;  1VQ5 Z;  1YUA A;  4E2W A;  5C4J I;  5C44 I;  5T64 A;  1VQ4 Z;  4E2Z A;  5C4X I;  1YIJ 1;  3S2D I;  2QRD B;  1VQ8 Z;  4A3G I;  3CCR Z;  3OW2 Z;  1WCM I;  3HOU I;  3I55 Z;  1X3Z A;  1DL6 A;  3HKZ A;  4XX2 A;  1WW9 A;  1Q7Y 1;  1KQS Z;  2NVX I;  3VTN A;  1RO4 A;  4BXX I;  1Y1W I;  2QR1 B;  4BBS I;  4CL1 A;  2M48 A;  1YJW Z;  2P3Y A;  3OW2 Y;  1K73 2;  3CCU Z;  2BJO A;  3GTK I;  3CCM 1;  1KQS Y;  3VB9 A;  3GTJ I;  4S1T A;  1K9M 1;  1Y1V S;  1VQP Z;  3NH5 A;  4E31 A;  2JR6 A;  5C3E I;  1USP B;  2LFU A;  2OZK A;  3FQM A;  2LIY A;  2HF1 A;  3H0G I;  1QF8 A;  4QTT A;  1TWH I;  2YAD A;  2Q4Z A;  2RBL A;  3BG1 B;  3GCF A;  2O4H A;  4HGY A;  3CC7 1;  4A3C I;  4NBD A;  1YUK A;  3CCQ Z;  2QEX Z;  1VQN Z;  2OOX B;  4DGL A;  3G4S 1;  1YJ9 1;  3K7A I;  1Q81 1;  1N8R 2;  4AYB A;  1VQ7 1;  1TFI A;  2Q51 A;  2RIQ A;  3S15 I;  3CCL 1;  3CC4 1;  2WAQ A;  3CCV Z;  4A3M I;  1Q82 2;  3T4N B;  1YIT 1;  5IT9 f;  1M1K 1;  2JS4 A;  2H85 A;  3TE5 B;  1YIJ Z;  2P28 A;  4RVF A;  1KD1 2;  1TWF I;  5T6B A;  2QA4 1;  4Y7N I;  3PO3 I;  3GTQ I;  3IFU A;  3S16 I;  5AN9 F;  1X3W A;  3CPW Y;  4Y52 I;  1ZH1 A;  3EER A;  3J80 f;  2Y0S A;  2GU2 A;  2JMO A;  3I4N I;  1I6H I;  2E2J I;  3D9X A;  3HOY I;  2DE5 A;  1QYP A;  3VMI A;  3NH8 A;  2OTL 1;  3GTM I;  1VQ9 Z;  3GTG I;  2IZ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...