3CCQZ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccqZ00
1QVFZ 3CCE1 1VQ61 1VQPZ 3G711 2QA41 1NJI2 1VQNZ 3CCEZ 1YJ9Z 3CCJ1 1QVGZ 1JJ2Y 3CXCZ 3CD6Z 3CCL1 1VQKZ 1W2BY 1M1K2 3CC21 1VQ8Z 1YHQZ 1QVFY 2OTL1 3CD61 1VQ41 3CCLZ 1Q822 1VQ6Z 3CC41 1VQP1 1K8A1 2OTJZ 3G4SZ 1KC82 1YITZ 1K732 3CPWY 1K9M2 2OTLZ 1QVGY 1Q862 1VQ4Z 1KD11 3G4S1 1K8A2 1M1K1 1VQK1 3G71Z 1Q811 1M902 1VQN1 3CCJZ 1VQO1 3CC4Z 2OTJ1 1KQSY 3CPWZ 1VQOZ 3OW2Y 1VQLZ 3CC2Z 3I561 3CMA1 1N8R2 3CCMZ 3I56Z 1KC81 1YIT1 3CCS1 1VQ51 1KD12 3CCR1 3CCSZ 3CXCY 1W2BZ 1K731 3OW2Z 3CCRZ 1VQL1 3CCQ1 3CCV1 1YJNZ 1VQ7Z 1Q812 3CCU1 1M901 3CMAZ 3CCM1 1VQ9Z 3I551 1Q861 1YIJ1 3CCQZ 3CCVZ 1N8R1 1VQ5Z 1YIJZ 1S72Z 2QEXZ 1VQ91 1YJW1 2QEX1 3CME1 3CCUZ 1S721 2QA4Z 3CMEZ 3G6EZ 3CC7Z 1YJ91 1YJN1 1VQ71 1Q7Y1 3I55Z 1Q7Y2 3CC71 1YI21 1NJI1 1YHQ1 1K9M1 1JJ2Z 1YI2Z 1YJWZ 1VQM1 1Q821 1KQSZ 3G6E1 1VQMZ 1VQ81
chains in the Genus database with same CATH superfamily
2JS4A 1VQPZ 3GCFA 1Z03A 3F3FC 4NBAA 5D1OB 2RBLA 3CCEZ 1QVGZ 3CCJ1 2YU9I 4BXXI 1VLAA 3CXCZ 3CCL1 3NDIA 2NVXI 1NP6A 2HF1A 2M6NA 1Q822 1X3WA 3D9XA 1FDOA 4DGLA 3CC41 1VQP1 1KC82 1K732 4NBBA 1K9M2 2E9HA 1VQ4Z 2VUGA 1KD11 2RT9A 1M1K1 1ZB9A 5C3EI 1TWHI 1VQN1 3VB9A 3CC4Z 3IFUA 3CPWZ 1VQOZ 2E2HI 2KPIA 3OW2Y 2JIPA 3VMHA 1N8R2 3CCMZ 5C4XI 3I56Z 4TNUA 4HGZA 3S1NI 1X0TA 2VF1A 4BY7I 3MZKB 4NBGA 2OZKA 3KIHA 1VQ7Z 1Q812 3CCU1 2E2JI 4NBEA 1Y1VI 2RHBA 3PO3I 2GTIA 3J80f 2V45A 3GTJI 1N8R1 1VQ5Z 2HU9A 4RVFA 1AA6A 1YIJZ 2QEXZ 1VQ91 1TWCI 1RNIA 3CCUZ 2AKLA 2PK7A 3D2LA 5FLXf 2WB1A 4AYBA 1YJN1 3ESWA 3I4NI 2H85A 2JNYA 1K9M1 3HOZI 1VQM1 4E32A 2F4MA 1Q821 3VTNA 1Y1WI 2DE7A 3Q87A 3IR7A 2IZ4A 3S1MI 3GTMS 1VQ61 2V8KA 2BJOA 2VPYA 5T67A 2QA41 4NBFA 4E2XA 1VQNZ 1JJ2Y 3CQZI 2KI7B 1W2BY 4A93I 2QRDB 3GTKI 2GU2A 3CCLZ 1VQ6Z 1SFOI 3G4SZ 3CPWY 1JWHC 5IP7I 4A3MI 2GTHA 3FQMA 2VPWA 2E2II 3NH5A 1QVGY 2IV2X 1QYPA 3S15I 1WCMI 3NH8A 3G71Z 3EERA 2NVYI 3NH4A 4Y52I 3S2HI 1TWAI 3I07A 2R92I 1I50I 4RV9A 1KRLA 1YIT1 3CCS1 4EWCA 1VQ51 1KD12 3HOUI 2K5RA 1ZB8A 1K731 2NVTI 4QTUA 5FLXb 4NBHA 2JA5I 3OW2Z 3FKII 3S1RI 1YJNZ 2JMOA 3HKZA 3H3VJ 2F4OA 3NFZA 3CMAZ 5AN9F 3M3YI 2VPXA 3I551 1RO2A 3HOYI 4NH1C 1S72Z 4A3EI 2QA4Z 2V8IA 1S7MA 3CMEZ 3CC7Z 4MD8A 3I4MI 3VMIA 4QTTA 3I55Z 1Q7Y2 2R7ZI 1WW9A 4RVDA 4A3KI 3GTMI 1JJ2Z 1USPA 1YI2Z 4A3LI 3JAMb 1ZH1A 3IF8A 1I3QI 3HOVI 1Q16A 3IX0A 4MH4A 1FDIA 4HH4A 3G711 2JA7I 1YJ9Z 3K7AI 3MZLB 2O4HA 2PMZA 3GTPI 1TWFI 3CD6Z 2JA8I 2R6MA 3TDHB 1M1K2 2JIQA 1WZNA 4E30A 3F3PC 1Z02A 1QVFY 2OTL1 1USPB 2OTJZ 2DE5A 3KIFA 1YITZ 2QRCB 2Y0SA 2O53A 5T64A 3G4S1 1K8A2 1RQFA 2QREB 4NB8A 1QF8A 3BG0B 4A3JI 4MRIA 2RPRA 4BBRI 4XX2A 3J7A4 1VQO1 2OTJ1 1KQSY 4RVGA 3CC2Z 3I561 2Q4ZA 3CMA1 1L1OC 3VMGA 4Y7NI 4E31A 4NBCA 4NOZA 2JIOA 3CCR1 3CXCY 5IT9b 4S1TA 2OOXB 2LIYA 5A2Qf 2I3CA 3CCQ1 3CCV1 2P3YA 3MONA 3RZOI 2JA6I 3J81b 5C4JI 2JIMA 1ML8A 4NB9A 3S2DI 3U50C 2E7ZA 4A3DI 1YIJ1 4RVHA 3CCQZ 4RS4A 3CCVZ 4NBDA 4CL1A 1WJ2A 2NAPA 5D1PA 1P9NA 2AYDA 5D1OA 1YJW1 2QEX1 2JR6A 3D6WA 2K3RA 3GTOI 1YJ91 1QXFA 3S16I 3PO3S 3J81f 4DQYB 3CC71 3NDJA 4HGYA 3FQQA 5T6BA 1YJWZ 1RLYA 2QKDA 3LUSA 1VQMZ 2VPZA 3HOXI 5C44I 1VQ81 4MXUA 1QVFZ 1N2FA 2Q51A 3CCE1 2QR1B 1WIIA 2JIRA 1YUKA 1NJI2 2PM9A 3GKQA 5LL6f 3EEDA 3HOWI 4E2ZA 3TE5B 1VQKZ 3CC21 2VUMI 1VQ8Z 1YHQZ 3CD61 1VQ41 4X6AI 1K8A1 1I6HI 4A3II 2V3VA 2OTLZ 1Q862 3P5JB 5A2Qb 3S17I 2IZ3A 1VQK1 1RO0A 4MONA 1Q811 4A3FI 2YADA 3GTGI 4MD7A 1M902 1K83I 4E2WA 3CCJZ 3S1QI 2RIQA 2W03A 4BY1I 4DK1A 2EGTA 3S14I 1VQLZ 5FLMI 3PO2I 2QLVB 2R93I 1KC81 5CM2M 2LFUA 3BG1B 1TFIA 3QWUA 2J6AA 3CCSZ 3H0GI 1W2BZ 1Y1VS 3JAMf 3CCRZ 5IP9I 1VQL1 4A3BI 2OOYB 1RO4A 1M901 1Y8CA 3T4NB 3CCM1 4BBSI 4A3CI 2WAQA 2M48A 1VQ9Z 1YUAA 1Q861 2W04A 1X3ZA 3GTQI 4MD9A 4E33A 3GTLI 1Z01A 3M4OI 1PFTA 3CME1 1S721 1TWGI 3G6EZ 2DE6A 2P28A 1NUIA 5IT9f 2ZAEB 1Q7Y1 1VQ71 3J80b 1DL6A 1R9TI 1YI21 4E2YA 2JUBA 1YHQ1 1NJI1 4NFRA 2G2KA 3RZDI 2NVQI 1KQSZ 3G6E1 2V8JA 1LQLA 2LEXA 2B63I 1SIWA 4A3GI
chains in the Genus database with same CATH topology
2JS4A 1VQPZ 3GCFA 1Z03A 3F3FC 4NBAA 5D1OB 2RBLA 3CCEZ 1QVGZ 3CCJ1 2YU9I 4BXXI 1VLAA 3CXCZ 3CCL1 3NDIA 2NVXI 1NP6A 2HF1A 2M6NA 1Q822 1X3WA 3D9XA 4DGLA 3CC41 1VQP1 1KC82 1K732 4NBBA 1K9M2 2E9HA 1VQ4Z 2VUGA 1KD11 2RT9A 1M1K1 1ZB9A 5C3EI 1TWHI 1VQN1 3VB9A 3CC4Z 3IFUA 3CPWZ 1VQOZ 2E2HI 2KPIA 3OW2Y 3VMHA 1N8R2 3CCMZ 5C4XI 3I56Z 4TNUA 4HGZA 3S1NI 1X0TA 2VF1A 4BY7I 3MZKB 4NBGA 2OZKA 3KIHA 1VQ7Z 1Q812 3CCU1 2E2JI 4NBEA 1Y1VI 2RHBA 3PO3I 2GTIA 3J80f 3GTJI 1N8R1 1VQ5Z 2HU9A 4RVFA 1YIJZ 2QEXZ 1VQ91 1TWCI 1RNIA 3CCUZ 2AKLA 2PK7A 5FLXf 2WB1A 4AYBA 1YJN1 3ESWA 3I4NI 2H85A 2JNYA 1K9M1 3HOZI 1VQM1 4E32A 2F4MA 1Q821 3VTNA 1Y1WI 2DE7A 3Q87A 2IZ4A 3S1MI 3GTMS 1VQ61 2V8KA 2BJOA 5T67A 2QA41 4NBFA 4E2XA 1VQNZ 1JJ2Y 3CQZI 2KI7B 1W2BY 4A93I 2QRDB 3GTKI 2GU2A 3CCLZ 1VQ6Z 1SFOI 3G4SZ 3CPWY 1JWHC 5IP7I 4A3MI 2GTHA 3FQMA 2E2II 1QVGY 3NH5A 1QYPA 3S15I 1WCMI 3NH8A 3G71Z 3EERA 2NVYI 3NH4A 4Y52I 3S2HI 1TWAI 3I07A 2R92I 1I50I 4RV9A 1KRLA 1YIT1 3CCS1 4EWCA 1VQ51 1KD12 3HOUI 2K5RA 1ZB8A 1K731 2NVTI 4QTUA 5FLXb 4NBHA 2JA5I 3OW2Z 3FKII 3S1RI 1YJNZ 2JMOA 3HKZA 3H3VJ 2F4OA 3NFZA 3CMAZ 5AN9F 3M3YI 3I551 1RO2A 3HOYI 4NH1C 1S72Z 4A3EI 2QA4Z 2V8IA 1S7MA 3CMEZ 3CC7Z 4MD8A 3I4MI 3VMIA 4QTTA 3I55Z 1Q7Y2 2R7ZI 1WW9A 4RVDA 4A3KI 3GTMI 1JJ2Z 1USPA 1YI2Z 4A3LI 3JAMb 1ZH1A 3IF8A 1I3QI 3HOVI 3IX0A 4MH4A 4HH4A 3G711 2JA7I 1YJ9Z 3K7AI 3MZLB 2O4HA 2PMZA 3GTPI 1TWFI 3CD6Z 2JA8I 2R6MA 3TDHB 1M1K2 4E30A 3F3PC 1Z02A 1QVFY 2OTL1 1USPB 2OTJZ 2DE5A 3KIFA 1YITZ 2QRCB 2Y0SA 2O53A 5T64A 3G4S1 1K8A2 1RQFA 2QREB 4NB8A 1QF8A 3BG0B 4A3JI 4MRIA 2RPRA 4BBRI 4XX2A 3J7A4 1VQO1 2OTJ1 1KQSY 4RVGA 3CC2Z 3I561 2Q4ZA 3CMA1 1L1OC 3VMGA 4Y7NI 4E31A 4NBCA 4NOZA 3CCR1 3CXCY 5IT9b 4S1TA 2OOXB 2LIYA 5A2Qf 2I3CA 3CCQ1 3CCV1 2P3YA 3MONA 3RZOI 2JA6I 3J81b 5C4JI 1ML8A 4NB9A 3S2DI 3U50C 4A3DI 4RVHA 3CCQZ 1YIJ1 4RS4A 3CCVZ 4NBDA 4CL1A 5D1PA 1P9NA 5D1OA 1YJW1 2QEX1 2JR6A 3D6WA 2K3RA 3GTOI 1YJ91 3S16I 3PO3S 3J81f 4DQYB 3CC71 3NDJA 4HGYA 3FQQA 5T6BA 1YJWZ 1RLYA 2QKDA 3LUSA 1VQMZ 3HOXI 5C44I 1VQ81 4MXUA 1QVFZ 1N2FA 2Q51A 3CCE1 2QR1B 1WIIA 1YUKA 1NJI2 2PM9A 3GKQA 5LL6f 3EEDA 3HOWI 4E2ZA 3TE5B 1VQKZ 3CC21 2VUMI 1VQ8Z 1YHQZ 3CD61 1VQ41 4X6AI 1K8A1 1I6HI 4A3II 2OTLZ 1Q862 3P5JB 5A2Qb 3S17I 2IZ3A 1VQK1 1RO0A 4MONA 1Q811 4A3FI 2YADA 3GTGI 4MD7A 1M902 1K83I 4E2WA 3CCJZ 3S1QI 2RIQA 2W03A 4BY1I 4DK1A 2EGTA 3S14I 1VQLZ 5FLMI 3PO2I 2QLVB 2R93I 1KC81 5CM2M 2LFUA 3BG1B 1TFIA 3QWUA 2J6AA 3CCSZ 3H0GI 1W2BZ 1Y1VS 3JAMf 3CCRZ 5IP9I 1VQL1 4A3BI 2OOYB 1RO4A 1M901 3T4NB 3CCM1 4BBSI 4A3CI 2WAQA 2M48A 1VQ9Z 1YUAA 1Q861 2W04A 1X3ZA 3GTQI 4MD9A 4E33A 3GTLI 1Z01A 3M4OI 1S721 1PFTA 3CME1 1TWGI 3G6EZ 2DE6A 2P28A 1NUIA 5IT9f 2ZAEB 1Q7Y1 1VQ71 3J80b 1DL6A 1R9TI 1YI21 4E2YA 2JUBA 1YHQ1 1NJI1 4NFRA 2G2KA 3RZDI 2NVQI 1KQSZ 3G6E1 2V8JA 1LQLA 2B63I 4A3GI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVF Z;  3CCE 1;  1VQ6 1;  1VQP Z;  3G71 1;  2QA4 1;  1NJI 2;  1VQN Z;  3CCE Z;  1YJ9 Z;  3CCJ 1;  1QVG Z;  1JJ2 Y;  3CXC Z;  3CD6 Z;  3CCL 1;  1VQK Z;  1W2B Y;  1M1K 2;  3CC2 1;  1VQ8 Z;  1YHQ Z;  1QVF Y;  2OTL 1;  3CD6 1;  1VQ4 1;  3CCL Z;  1Q82 2;  1VQ6 Z;  3CC4 1;  1VQP 1;  1K8A 1;  2OTJ Z;  3G4S Z;  1KC8 2;  1YIT Z;  1K73 2;  3CPW Y;  1K9M 2;  2OTL Z;  1QVG Y;  1Q86 2;  1VQ4 Z;  1KD1 1;  3G4S 1;  1K8A 2;  1M1K 1;  1VQK 1;  3G71 Z;  1Q81 1;  1M90 2;  1VQN 1;  3CCJ Z;  1VQO 1;  3CC4 Z;  2OTJ 1;  1KQS Y;  3CPW Z;  1VQO Z;  3OW2 Y;  1VQL Z;  3CC2 Z;  3I56 1;  3CMA 1;  1N8R 2;  3CCM Z;  3I56 Z;  1KC8 1;  1YIT 1;  3CCS 1;  1VQ5 1;  1KD1 2;  3CCR 1;  3CCS Z;  3CXC Y;  1W2B Z;  1K73 1;  3OW2 Z;  3CCR Z;  1VQL 1;  3CCQ 1;  3CCV 1;  1YJN Z;  1VQ7 Z;  1Q81 2;  3CCU 1;  1M90 1;  3CMA Z;  3CCM 1;  1VQ9 Z;  3I55 1;  1Q86 1;  1YIJ 1;  3CCQ Z;  3CCV Z;  1N8R 1;  1VQ5 Z;  1YIJ Z;  1S72 Z;  2QEX Z;  1VQ9 1;  1YJW 1;  2QEX 1;  3CME 1;  3CCU Z;  1S72 1;  2QA4 Z;  3CME Z;  3G6E Z;  3CC7 Z;  1YJ9 1;  1YJN 1;  1VQ7 1;  1Q7Y 1;  3I55 Z;  1Q7Y 2;  3CC7 1;  1YI2 1;  1NJI 1;  1YHQ 1;  1K9M 1;  1JJ2 Z;  1YI2 Z;  1YJW Z;  1VQM 1;  1Q82 1;  1KQS Z;  3G6E 1;  1VQM Z;  1VQ8 1; 
#chains in the Genus database with same CATH topology
 2JS4 A;  1VQP Z;  3GCF A;  1Z03 A;  3F3F C;  4NBA A;  5D1O B;  2RBL A;  3CCE Z;  1QVG Z;  3CCJ 1;  2YU9 I;  4BXX I;  1VLA A;  3CXC Z;  3CCL 1;  3NDI A;  2NVX I;  1NP6 A;  2HF1 A;  2M6N A;  1Q82 2;  1X3W A;  3D9X A;  1FDO A;  4DGL A;  3CC4 1;  1VQP 1;  1KC8 2;  1K73 2;  4NBB A;  1K9M 2;  2E9H A;  1VQ4 Z;  2VUG A;  1KD1 1;  2RT9 A;  1M1K 1;  1ZB9 A;  5C3E I;  1TWH I;  1VQN 1;  3VB9 A;  3CC4 Z;  3IFU A;  3CPW Z;  1VQO Z;  2E2H I;  2KPI A;  3OW2 Y;  2JIP A;  3VMH A;  1N8R 2;  3CCM Z;  5C4X I;  3I56 Z;  4TNU A;  4HGZ A;  3S1N I;  1X0T A;  2VF1 A;  4BY7 I;  3MZK B;  4NBG A;  2OZK A;  3KIH A;  1VQ7 Z;  1Q81 2;  3CCU 1;  2E2J I;  4NBE A;  1Y1V I;  2RHB A;  3PO3 I;  2GTI A;  3J80 f;  2V45 A;  3GTJ I;  1N8R 1;  1VQ5 Z;  2HU9 A;  4RVF A;  1AA6 A;  1YIJ Z;  2QEX Z;  1VQ9 1;  1TWC I;  1RNI A;  3CCU Z;  2AKL A;  2PK7 A;  3D2L A;  5FLX f;  2WB1 A;  4AYB A;  1YJN 1;  3ESW A;  3I4N I;  2H85 A;  2JNY A;  1K9M 1;  3HOZ I;  1VQM 1;  4E32 A;  2F4M A;  1Q82 1;  3VTN A;  1Y1W I;  2DE7 A;  3Q87 A;  3IR7 A;  2IZ4 A;  3S1M I;  3GTM S;  1VQ6 1;  2V8K A;  2BJO A;  2VPY A;  5T67 A;  2QA4 1;  4NBF A;  4E2X A;  1VQN Z;  1JJ2 Y;  3CQZ I;  2KI7 B;  1W2B Y;  4A93 I;  2QRD B;  3GTK I;  2GU2 A;  3CCL Z;  1VQ6 Z;  1SFO I;  3G4S Z;  3CPW Y;  1JWH C;  5IP7 I;  4A3M I;  2GTH A;  3FQM A;  2VPW A;  2E2I I;  3NH5 A;  1QVG Y;  2IV2 X;  1QYP A;  3S15 I;  1WCM I;  3NH8 A;  3G71 Z;  3EER A;  2NVY I;  3NH4 A;  4Y52 I;  3S2H I;  1TWA I;  3I07 A;  2R92 I;  1I50 I;  4RV9 A;  1KRL A;  1YIT 1;  3CCS 1;  4EWC A;  1VQ5 1;  1KD1 2;  3HOU I;  2K5R A;  1ZB8 A;  1K73 1;  2NVT I;  4QTU A;  5FLX b;  4NBH A;  2JA5 I;  3OW2 Z;  3FKI I;  3S1R I;  1YJN Z;  2JMO A;  3HKZ A;  3H3V J;  2F4O A;  3NFZ A;  3CMA Z;  5AN9 F;  3M3Y I;  2VPX A;  3I55 1;  1RO2 A;  3HOY I;  4NH1 C;  1S72 Z;  4A3E I;  2QA4 Z;  2V8I A;  1S7M A;  3CME Z;  3CC7 Z;  4MD8 A;  3I4M I;  3VMI A;  4QTT A;  3I55 Z;  1Q7Y 2;  2R7Z I;  1WW9 A;  4RVD A;  4A3K I;  3GTM I;  1JJ2 Z;  1USP A;  1YI2 Z;  4A3L I;  3JAM b;  1ZH1 A;  3IF8 A;  1I3Q I;  3HOV I;  1Q16 A;  3IX0 A;  4MH4 A;  1FDI A;  4HH4 A;  3G71 1;  2JA7 I;  1YJ9 Z;  3K7A I;  3MZL B;  2O4H A;  2PMZ A;  3GTP I;  1TWF I;  3CD6 Z;  2JA8 I;  2R6M A;  3TDH B;  1M1K 2;  2JIQ A;  1WZN A;  4E30 A;  3F3P C;  1Z02 A;  1QVF Y;  2OTL 1;  1USP B;  2OTJ Z;  2DE5 A;  3KIF A;  1YIT Z;  2QRC B;  2Y0S A;  2O53 A;  5T64 A;  3G4S 1;  1K8A 2;  1RQF A;  2QRE B;  4NB8 A;  1QF8 A;  3BG0 B;  4A3J I;  4MRI A;  2RPR A;  4BBR I;  4XX2 A;  3J7A 4;  1VQO 1;  2OTJ 1;  1KQS Y;  4RVG A;  3CC2 Z;  3I56 1;  2Q4Z A;  3CMA 1;  1L1O C;  3VMG A;  4Y7N I;  4E31 A;  4NBC A;  4NOZ A;  2JIO A;  3CCR 1;  3CXC Y;  5IT9 b;  4S1T A;  2OOX B;  2LIY A;  5A2Q f;  2I3C A;  3CCQ 1;  3CCV 1;  2P3Y A;  3MON A;  3RZO I;  2JA6 I;  3J81 b;  5C4J I;  2JIM A;  1ML8 A;  4NB9 A;  3S2D I;  3U50 C;  2E7Z A;  4A3D I;  1YIJ 1;  4RVH A;  3CCQ Z;  4RS4 A;  3CCV Z;  4NBD A;  4CL1 A;  1WJ2 A;  2NAP A;  5D1P A;  1P9N A;  2AYD A;  5D1O A;  1YJW 1;  2QEX 1;  2JR6 A;  3D6W A;  2K3R A;  3GTO I;  1YJ9 1;  1QXF A;  3S16 I;  3PO3 S;  3J81 f;  4DQY B;  3CC7 1;  3NDJ A;  4HGY A;  3FQQ A;  5T6B A;  1YJW Z;  1RLY A;  2QKD A;  3LUS A;  1VQM Z;  2VPZ A;  3HOX I;  5C44 I;  1VQ8 1;  4MXU A;  1QVF Z;  1N2F A;  2Q51 A;  3CCE 1;  2QR1 B;  1WII A;  2JIR A;  1YUK A;  1NJI 2;  2PM9 A;  3GKQ A;  5LL6 f;  3EED A;  3HOW I;  4E2Z A;  3TE5 B;  1VQK Z;  3CC2 1;  2VUM I;  1VQ8 Z;  1YHQ Z;  3CD6 1;  1VQ4 1;  4X6A I;  1K8A 1;  1I6H I;  4A3I I;  2V3V A;  2OTL Z;  1Q86 2;  3P5J B;  5A2Q b;  3S17 I;  2IZ3 A;  1VQK 1;  1RO0 A;  4MON A;  1Q81 1;  4A3F I;  2YAD A;  3GTG I;  4MD7 A;  1M90 2;  1K83 I;  4E2W A;  3CCJ Z;  3S1Q I;  2RIQ A;  2W03 A;  4BY1 I;  4DK1 A;  2EGT A;  3S14 I;  1VQL Z;  5FLM I;  3PO2 I;  2QLV B;  2R93 I;  1KC8 1;  5CM2 M;  2LFU A;  3BG1 B;  1TFI A;  3QWU A;  2J6A A;  3CCS Z;  3H0G I;  1W2B Z;  1Y1V S;  3JAM f;  3CCR Z;  5IP9 I;  1VQL 1;  4A3B I;  2OOY B;  1RO4 A;  1M90 1;  1Y8C A;  3T4N B;  3CCM 1;  4BBS I;  4A3C I;  2WAQ A;  2M48 A;  1VQ9 Z;  1YUA A;  1Q86 1;  2W04 A;  1X3Z A;  3GTQ I;  4MD9 A;  4E33 A;  3GTL I;  1Z01 A;  3M4O I;  1PFT A;  3CME 1;  1S72 1;  1TWG I;  3G6E Z;  2DE6 A;  2P28 A;  1NUI A;  5IT9 f;  2ZAE B;  1Q7Y 1;  1VQ7 1;  3J80 b;  1DL6 A;  1R9T I;  1YI2 1;  4E2Y A;  2JUB A;  1YHQ 1;  1NJI 1;  4NFR A;  2G2K A;  3RZD I;  2NVQ I;  1KQS Z;  3G6E 1;  2V8J A;  1LQL A;  2LEX A;  2B63 I;  1SIW A;  4A3G I; 
#chains in the Genus database with same CATH homology
 2JS4 A;  1VQP Z;  3GCF A;  1Z03 A;  3F3F C;  4NBA A;  5D1O B;  2RBL A;  3CCE Z;  1QVG Z;  3CCJ 1;  2YU9 I;  4BXX I;  1VLA A;  3CXC Z;  3CCL 1;  3NDI A;  2NVX I;  1NP6 A;  2HF1 A;  2M6N A;  1Q82 2;  1X3W A;  3D9X A;  4DGL A;  3CC4 1;  1VQP 1;  1KC8 2;  1K73 2;  4NBB A;  1K9M 2;  2E9H A;  1VQ4 Z;  2VUG A;  1KD1 1;  2RT9 A;  1M1K 1;  1ZB9 A;  5C3E I;  1TWH I;  1VQN 1;  3VB9 A;  3CC4 Z;  3IFU A;  3CPW Z;  1VQO Z;  2E2H I;  2KPI A;  3OW2 Y;  3VMH A;  1N8R 2;  3CCM Z;  5C4X I;  3I56 Z;  4TNU A;  4HGZ A;  3S1N I;  1X0T A;  2VF1 A;  4BY7 I;  3MZK B;  4NBG A;  2OZK A;  3KIH A;  1VQ7 Z;  1Q81 2;  3CCU 1;  2E2J I;  4NBE A;  1Y1V I;  2RHB A;  3PO3 I;  2GTI A;  3J80 f;  3GTJ I;  1N8R 1;  1VQ5 Z;  2HU9 A;  4RVF A;  1YIJ Z;  2QEX Z;  1VQ9 1;  1TWC I;  1RNI A;  3CCU Z;  2AKL A;  2PK7 A;  5FLX f;  2WB1 A;  4AYB A;  1YJN 1;  3ESW A;  3I4N I;  2H85 A;  2JNY A;  1K9M 1;  3HOZ I;  1VQM 1;  4E32 A;  2F4M A;  1Q82 1;  3VTN A;  1Y1W I;  2DE7 A;  3Q87 A;  2IZ4 A;  3S1M I;  3GTM S;  1VQ6 1;  2V8K A;  2BJO A;  5T67 A;  2QA4 1;  4NBF A;  4E2X A;  1VQN Z;  1JJ2 Y;  3CQZ I;  2KI7 B;  1W2B Y;  4A93 I;  2QRD B;  3GTK I;  2GU2 A;  3CCL Z;  1VQ6 Z;  1SFO I;  3G4S Z;  3CPW Y;  1JWH C;  5IP7 I;  4A3M I;  2GTH A;  3FQM A;  2E2I I;  1QVG Y;  3NH5 A;  1QYP A;  3S15 I;  1WCM I;  3NH8 A;  3G71 Z;  3EER A;  2NVY I;  3NH4 A;  4Y52 I;  3S2H I;  1TWA I;  3I07 A;  2R92 I;  1I50 I;  4RV9 A;  1KRL A;  1YIT 1;  3CCS 1;  4EWC A;  1VQ5 1;  1KD1 2;  3HOU I;  2K5R A;  1ZB8 A;  1K73 1;  2NVT I;  4QTU A;  5FLX b;  4NBH A;  2JA5 I;  3OW2 Z;  3FKI I;  3S1R I;  1YJN Z;  2JMO A;  3HKZ A;  3H3V J;  2F4O A;  3NFZ A;  3CMA Z;  5AN9 F;  3M3Y I;  3I55 1;  1RO2 A;  3HOY I;  4NH1 C;  1S72 Z;  4A3E I;  2QA4 Z;  2V8I A;  1S7M A;  3CME Z;  3CC7 Z;  4MD8 A;  3I4M I;  3VMI A;  4QTT A;  3I55 Z;  1Q7Y 2;  2R7Z I;  1WW9 A;  4RVD A;  4A3K I;  3GTM I;  1JJ2 Z;  1USP A;  1YI2 Z;  4A3L I;  3JAM b;  1ZH1 A;  3IF8 A;  1I3Q I;  3HOV I;  3IX0 A;  4MH4 A;  4HH4 A;  3G71 1;  2JA7 I;  1YJ9 Z;  3K7A I;  3MZL B;  2O4H A;  2PMZ A;  3GTP I;  1TWF I;  3CD6 Z;  2JA8 I;  2R6M A;  3TDH B;  1M1K 2;  4E30 A;  3F3P C;  1Z02 A;  1QVF Y;  2OTL 1;  1USP B;  2OTJ Z;  2DE5 A;  3KIF A;  1YIT Z;  2QRC B;  2Y0S A;  2O53 A;  5T64 A;  3G4S 1;  1K8A 2;  1RQF A;  2QRE B;  4NB8 A;  1QF8 A;  3BG0 B;  4A3J I;  4MRI A;  2RPR A;  4BBR I;  4XX2 A;  3J7A 4;  1VQO 1;  2OTJ 1;  1KQS Y;  4RVG A;  3CC2 Z;  3I56 1;  2Q4Z A;  3CMA 1;  1L1O C;  3VMG A;  4Y7N I;  4E31 A;  4NBC A;  4NOZ A;  3CCR 1;  3CXC Y;  5IT9 b;  4S1T A;  2OOX B;  2LIY A;  5A2Q f;  2I3C A;  3CCQ 1;  3CCV 1;  2P3Y A;  3MON A;  3RZO I;  2JA6 I;  3J81 b;  5C4J I;  1ML8 A;  4NB9 A;  3S2D I;  3U50 C;  4A3D I;  4RVH A;  3CCQ Z;  1YIJ 1;  4RS4 A;  3CCV Z;  4NBD A;  4CL1 A;  5D1P A;  1P9N A;  5D1O A;  1YJW 1;  2QEX 1;  2JR6 A;  3D6W A;  2K3R A;  3GTO I;  1YJ9 1;  3S16 I;  3PO3 S;  3J81 f;  4DQY B;  3CC7 1;  3NDJ A;  4HGY A;  3FQQ A;  5T6B A;  1YJW Z;  1RLY A;  2QKD A;  3LUS A;  1VQM Z;  3HOX I;  5C44 I;  1VQ8 1;  4MXU A;  1QVF Z;  1N2F A;  2Q51 A;  3CCE 1;  2QR1 B;  1WII A;  1YUK A;  1NJI 2;  2PM9 A;  3GKQ A;  5LL6 f;  3EED A;  3HOW I;  4E2Z A;  3TE5 B;  1VQK Z;  3CC2 1;  2VUM I;  1VQ8 Z;  1YHQ Z;  3CD6 1;  1VQ4 1;  4X6A I;  1K8A 1;  1I6H I;  4A3I I;  2OTL Z;  1Q86 2;  3P5J B;  5A2Q b;  3S17 I;  2IZ3 A;  1VQK 1;  1RO0 A;  4MON A;  1Q81 1;  4A3F I;  2YAD A;  3GTG I;  4MD7 A;  1M90 2;  1K83 I;  4E2W A;  3CCJ Z;  3S1Q I;  2RIQ A;  2W03 A;  4BY1 I;  4DK1 A;  2EGT A;  3S14 I;  1VQL Z;  5FLM I;  3PO2 I;  2QLV B;  2R93 I;  1KC8 1;  5CM2 M;  2LFU A;  3BG1 B;  1TFI A;  3QWU A;  2J6A A;  3CCS Z;  3H0G I;  1W2B Z;  1Y1V S;  3JAM f;  3CCR Z;  5IP9 I;  1VQL 1;  4A3B I;  2OOY B;  1RO4 A;  1M90 1;  3T4N B;  3CCM 1;  4BBS I;  4A3C I;  2WAQ A;  2M48 A;  1VQ9 Z;  1YUA A;  1Q86 1;  2W04 A;  1X3Z A;  3GTQ I;  4MD9 A;  4E33 A;  3GTL I;  1Z01 A;  3M4O I;  1S72 1;  1PFT A;  3CME 1;  1TWG I;  3G6E Z;  2DE6 A;  2P28 A;  1NUI A;  5IT9 f;  2ZAE B;  1Q7Y 1;  1VQ7 1;  3J80 b;  1DL6 A;  1R9T I;  1YI2 1;  4E2Y A;  2JUB A;  1YHQ 1;  1NJI 1;  4NFR A;  2G2K A;  3RZD I;  2NVQ I;  1KQS Z;  3G6E 1;  2V8J A;  1LQL A;  2B63 I;  4A3G I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...