3CCQZ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccqZ00
1Q821 1KD12 1W2BY 1K9M1 3CXCZ 1Q7Y1 3OW2Z 3G6EZ 1YJWZ 1VQM1 3CPWZ 3CCEZ 1VQPZ 3CC21 1YI21 3CMEZ 3CCS1 3G711 3CME1 3CC4Z 1W2BZ 3CC41 3CCQZ 1VQ8Z 3G4SZ 3CCQ1 1Q862 1VQL1 1VQ81 1S721 3G4S1 3CCL1 1QVGY 1YHQ1 3I561 1M1K1 1VQMZ 1VQ71 1M902 1KD11 3CCJZ 3CCRZ 3CC2Z 1JJ2Y 1KQSY 3CCJ1 1YI2Z 3CMA1 3CD61 3CCR1 1K732 3CCSZ 1KC82 1K8A2 1N8R2 3G71Z 1VQN1 3CCUZ 1Q812 2QA4Z 1VQOZ 1YIJ1 3CCU1 1QVFY 3CCV1 1VQLZ 2QA41 1VQO1 1S72Z 2OTL1 1NJI2 3CCLZ 1YIT1 1YHQZ 3I56Z 1QVGZ 1VQK1 1VQ7Z 3CCMZ 1Q822 1VQ91 3CCM1 1YJN1 1YJ9Z 1KQSZ 1JJ2Z 3CMAZ 1K9M2 3CD6Z 1VQ4Z 1YJ91 1Q7Y2 1Q861 1VQNZ 2QEX1 1VQ41 1YIJZ 2OTJZ 1M901 1VQ5Z 1VQ6Z 3CCVZ 1QVFZ 2OTLZ 2OTJ1 1VQ51 1VQ61 1YITZ 3CXCY 1K731 1VQKZ 3I55Z 1KC81 1K8A1 1N8R1 3OW2Y 3I551 1VQ9Z 3G6E1 3CC7Z 1YJNZ 1Q811 1YJW1 3CC71 3CPWY 3CCE1 1VQP1 1NJI1 2QEXZ 1M1K2
chains in the Genus database with same CATH superfamily
3D6WA 3NDJA 2NVQI 3CXCZ 2K3RA 2O4HA 1Q7Y1 1ZB9A 5A2Qf 1N2FA 1X3WA 5FLMI 2LIYA 1WZNA 1NUIA 4BY7I 1YI21 2OOYB 4BXXI 2VF1A 2VUGA 4HH4A 1W2BZ 1USPA 1I50I 1Q862 1VQL1 3FQQA 1QVGY 5D1OB 3I561 1M1K1 3HOYI 1VQMZ 1M902 2K5RA 3NH8A 4AYBA 3CCRZ 2JIPA 2J6AA 3F3FC 3H3VJ 2QRCB 5IP7I 3CCR1 3HOZI 3CCSZ 1KC82 1K8A2 3S1RI 2NAPA 1VQN1 3CCUZ 2NVTI 1VQOZ 3CCU1 1VQO1 4A3KI 2LFUA 2Y0SA 5C4XI 1I6HI 3PO3I 2DE6A 4NFRA 5CM2M 4HGYA 1Q822 2EGTA 1SIWA 2RT9A 3M4OI 3I4NI 3CD6Z 2WB1A 1Q861 2QR1B 2E2II 1QF8A 3GTGI 3PO2I 1JWHC 5AN9F 2OTJZ 1Y1VS 1M901 1VQ5Z 1QVFZ 4BY1I 2OTJ1 1VQ51 2P3YA 3CXCY 5FLXb 1KC81 1K8A1 4E31A 1L1OC 4DGLA 1VQ9Z 3G6E1 4CL1A 2E7ZA 2QEXZ 1SFOI 3GKQA 3MZLB 1Q821 4A3MI 1W2BY 2OZKA 2E2HI 2R93I 3QWUA 3S14I 3J80b 4A3II 3S1MI 3S15I 3EERA 2W03A 1WW9A 1WIIA 3FKII 2DE5A 2RHBA 4RVFA 3HKZA 4X6AI 2V3VA 3CC4Z 3CC41 3HOWI 1VQ8Z 3G4SZ 4E33A 3S16I 1VQ81 2KI7B 2JIMA 3G4S1 1S721 1NP6A 3CCL1 2R92I 4BBSI 3J81b 4MD9A 3NFZA 1YI2Z 4NBCA 3GTMI 1WJ2A 1K732 1FDIA 1USPB 2YU9I 3NH5A 4A3LI 2IZ4A 1I3QI 1P9NA 3S1NI 3IFUA 3F3PC 1QVFY 1VQLZ 4A3DI 2OTL1 4MH4A 1NJI2 3I56Z 2JNYA 1VQK1 1TWGI 3CCMZ 3CQZI 3HOUI 2HU9A 3CCM1 3HOVI 3H0GI 1YJN1 4RVGA 4S1TA 1YJ9Z 3T4NB 3K7AI 1K9M2 2W04A 4NB8A 1YJ91 2RBLA 1VQNZ 4NBDA 5FLXf 1RO4A 1RLYA 1TWCI 2JIQA 4A3CI 3P5JB 1RQFA 3EEDA 1VQ6Z 3KIFA 2VPZA 1TFIA 2O53A 1VQ61 1TWHI 1S7MA 2PMZA 1K731 3Q87A 4NB9A 1YJW1 3ESWA 5D1OA 4NBGA 3CCE1 1VQP1 1NJI1 3RZDI 4RVHA 1Q16A 4MXUA 4Y7NI 2VPWA 2JS4A 3GTLI 1Z02A 2WAQA 1KD12 3NH4A 1K9M1 4NH1C 4E2YA 2JR6A 1TWAI 2VPXA 2IV2X 3G6EZ 2OOXB 4RS4A 1ML8A 3IF8A 2E2JI 2QREB 5T64A 4DQYB 3CPWZ 2GTHA 4MONA 5IP9I 3CC21 3NDIA 2YADA 4RV9A 5T6BA 3J81f 3G711 1RO0A 1QXFA 3GTMS 2RIQA 2NVYI 2IZ3A 3GTPI 4A3BI 2F4MA 4E2ZA 4A3JI 3D2LA 1YHQ1 2H85A 1VQ71 3VTNA 3FQMA 2G2KA 3I07A 4TNUA 1KD11 3CCJZ 2JIRA 4NBFA 4NBAA 3CCJ1 3CMA1 3GCFA 2ZAEB 2JA7I 3LUSA 2F4OA 2PM9A 2JA6I 1Y1WI 1Q812 5C44I 3VMGA 1YIJ1 3S2HI 3CCV1 5IT9b 2JA8I 1S72Z 1TWFI 3CCLZ 1YIT1 2M48A 2AKLA 2VPYA 3GTQI 2M6NA 3HOXI 2JA5I 2HF1A 1Y1VI 1JJ2Z 1KQSZ 4EWCA 2JUBA 1K83I 1R9TI 2QRDB 3PO3S 3JAMb 3VB9A 2DE7A 1X3ZA 2QLVB 2RPRA 2QKDA 4XX2A 3TDHB 4E30A 3D9XA 2OTLZ 3S17I 3VMIA 2Q51A 2V8IA 1VQKZ 2B63I 4E2WA 4RVDA 5LL6f 1ZB8A 2I3CA 3CC7Z 3S2DI 2E9HA 4HGZA 3GTJI 1YJNZ 5C3EI 1Q811 4A3FI 2V8KA 3CC71 3CPWY 1RNIA 3BG1B 2BJOA 1AA6A 3IR7A 2GU2A 3U50C 2Q4ZA 3J7A4 2GTIA 4A3GI 3OW2Z 2NVXI 3RZOI 4MD7A 3MZKB 1VLAA 1YJWZ 1VQM1 2VUMI 3I4MI 3IX0A 3MONA 3CCEZ 1VQPZ 4BBRI 3GTOI 3CMEZ 1KRLA 1Z03A 3CCS1 5A2Qb 3J80f 1Z01A 3CME1 4NOZA 1RO2A 1Y8CA 5D1PA 2JMOA 3CCQZ 1FDOA 3CCQ1 4A93I 4DK1A 4QTUA 1WCMI 3TE5B 4NBHA 3CC2Z 4MRIA 5IT9f 1KQSY 1JJ2Y 3CD61 2R7ZI 1N8R2 3G71Z 5C4JI 2LEXA 2QA4Z 4QTTA 2QA41 1YHQZ 1QVGZ 3S1QI 1VQ7Z 3JAMf 4A3EI 3VMHA 1VQ91 2P28A 3CMAZ 1PFTA 1VQ4Z 1Q7Y2 4MD8A 2QEX1 1VQ41 2JIOA 2PK7A 4E32A 4Y52I 4NBEA 1YIJZ 2V8JA 4E2XA 2R6MA 3CCVZ 3GTKI 2V45A 1QYPA 5T67A 4NBBA 1YITZ 2KPIA 1LQLA 1ZH1A 3I55Z 3M3YI 1N8R1 3OW2Y 3I551 2AYDA 1YUAA 1DL6A 1YUKA 1X0TA 3BG0B 3KIHA 1M1K2
chains in the Genus database with same CATH topology
3D6WA 3NDJA 2NVQI 3CXCZ 2K3RA 2O4HA 1Q7Y1 1ZB9A 5A2Qf 1N2FA 1X3WA 5FLMI 2LIYA 1NUIA 4BY7I 1YI21 2OOYB 4BXXI 2VF1A 2VUGA 4HH4A 1W2BZ 1USPA 1I50I 1Q862 1VQL1 3FQQA 1QVGY 5D1OB 3I561 1M1K1 3HOYI 1VQMZ 1M902 2K5RA 3NH8A 4AYBA 3CCRZ 2J6AA 3F3FC 3H3VJ 2QRCB 5IP7I 3CCR1 3HOZI 3CCSZ 1KC82 1K8A2 3S1RI 1VQN1 3CCUZ 2NVTI 1VQOZ 3CCU1 1VQO1 4A3KI 2LFUA 2Y0SA 5C4XI 1I6HI 3PO3I 2DE6A 4NFRA 5CM2M 4HGYA 1Q822 2EGTA 2RT9A 3M4OI 3I4NI 3CD6Z 2WB1A 1Q861 2QR1B 2E2II 1QF8A 3GTGI 3PO2I 1JWHC 5AN9F 2OTJZ 1Y1VS 1M901 1VQ5Z 1QVFZ 4BY1I 2OTJ1 1VQ51 2P3YA 3CXCY 5FLXb 1KC81 1K8A1 4E31A 1L1OC 4DGLA 1VQ9Z 3G6E1 4CL1A 2QEXZ 1SFOI 3GKQA 3MZLB 1Q821 4A3MI 1W2BY 2OZKA 2E2HI 2R93I 3QWUA 3S14I 3J80b 4A3II 3S1MI 3S15I 3EERA 2W03A 1WW9A 1WIIA 3FKII 2DE5A 2RHBA 4RVFA 3HKZA 4X6AI 3CC4Z 3CC41 3HOWI 1VQ8Z 3G4SZ 4E33A 3S16I 1VQ81 2KI7B 1S721 3G4S1 1NP6A 3CCL1 2R92I 4BBSI 3J81b 4MD9A 3NFZA 1YI2Z 4NBCA 3GTMI 1K732 1USPB 2YU9I 3NH5A 4A3LI 2IZ4A 1I3QI 1P9NA 3S1NI 3IFUA 3F3PC 1QVFY 1VQLZ 4A3DI 2OTL1 4MH4A 1NJI2 3I56Z 2JNYA 1VQK1 1TWGI 3CCMZ 3CQZI 3HOUI 2HU9A 3CCM1 3HOVI 3H0GI 1YJN1 4RVGA 4S1TA 1YJ9Z 3T4NB 3K7AI 1K9M2 2W04A 4NB8A 1YJ91 2RBLA 1VQNZ 4NBDA 5FLXf 1RO4A 1RLYA 1TWCI 4A3CI 3P5JB 1RQFA 3EEDA 1VQ6Z 3KIFA 1TFIA 2O53A 1VQ61 1TWHI 1S7MA 2PMZA 1K731 3Q87A 4NB9A 1YJW1 3ESWA 5D1OA 4NBGA 3CCE1 1VQP1 1NJI1 3RZDI 4RVHA 4MXUA 4Y7NI 2JS4A 3GTLI 1Z02A 2WAQA 1KD12 3NH4A 1K9M1 4NH1C 4E2YA 2JR6A 1TWAI 3G6EZ 2OOXB 4RS4A 1ML8A 3IF8A 2E2JI 2QREB 5T64A 4DQYB 3CPWZ 2GTHA 4MONA 5IP9I 3CC21 3NDIA 2YADA 4RV9A 5T6BA 3J81f 3G711 1RO0A 3GTMS 2RIQA 2NVYI 2IZ3A 3GTPI 4A3BI 2F4MA 4E2ZA 4A3JI 1YHQ1 2H85A 1VQ71 3VTNA 3FQMA 2G2KA 3I07A 4TNUA 1KD11 3CCJZ 4NBFA 4NBAA 3CCJ1 3CMA1 3GCFA 2ZAEB 2JA7I 3LUSA 2F4OA 2PM9A 2JA6I 1Y1WI 1Q812 5C44I 3VMGA 1YIJ1 3S2HI 3CCV1 5IT9b 2JA8I 1S72Z 1TWFI 3CCLZ 1YIT1 2M48A 2AKLA 3GTQI 2M6NA 3HOXI 2JA5I 2HF1A 1Y1VI 1JJ2Z 1KQSZ 4EWCA 2JUBA 1K83I 1R9TI 2QRDB 3PO3S 3JAMb 3VB9A 2DE7A 1X3ZA 2QLVB 2RPRA 2QKDA 4XX2A 3TDHB 4E30A 3D9XA 2OTLZ 3S17I 3VMIA 2Q51A 2V8IA 1VQKZ 2B63I 4E2WA 4RVDA 5LL6f 1ZB8A 2I3CA 3CC7Z 3S2DI 2E9HA 4HGZA 3GTJI 1YJNZ 5C3EI 1Q811 4A3FI 2V8KA 3CC71 3CPWY 1RNIA 3BG1B 2BJOA 2GU2A 3U50C 2Q4ZA 3J7A4 2GTIA 4A3GI 3OW2Z 2NVXI 3RZOI 4MD7A 3MZKB 1VLAA 1YJWZ 1VQM1 2VUMI 3I4MI 3IX0A 3MONA 3CCEZ 1VQPZ 4BBRI 3GTOI 3CMEZ 1KRLA 1Z03A 3CCS1 5A2Qb 3J80f 1Z01A 3CME1 4NOZA 1RO2A 5D1PA 2JMOA 3CCQZ 3CCQ1 4A93I 4DK1A 4QTUA 1WCMI 3TE5B 4NBHA 3CC2Z 4MRIA 5IT9f 1KQSY 1JJ2Y 3CD61 2R7ZI 1N8R2 3G71Z 5C4JI 2QA4Z 4QTTA 2QA41 1YHQZ 1QVGZ 3S1QI 1VQ7Z 3JAMf 4A3EI 3VMHA 1VQ91 2P28A 3CMAZ 1PFTA 1VQ4Z 1Q7Y2 4MD8A 2QEX1 1VQ41 2PK7A 4E32A 4Y52I 4NBEA 1YIJZ 2V8JA 4E2XA 2R6MA 3CCVZ 3GTKI 1QYPA 5T67A 4NBBA 1YITZ 2KPIA 1LQLA 1ZH1A 3I55Z 3M3YI 1N8R1 3OW2Y 3I551 1YUAA 1DL6A 1YUKA 1X0TA 3BG0B 3KIHA 1M1K2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q82 1;  1KD1 2;  1W2B Y;  1K9M 1;  3CXC Z;  1Q7Y 1;  3OW2 Z;  3G6E Z;  1YJW Z;  1VQM 1;  3CPW Z;  3CCE Z;  1VQP Z;  3CC2 1;  1YI2 1;  3CME Z;  3CCS 1;  3G71 1;  3CME 1;  3CC4 Z;  1W2B Z;  3CC4 1;  3CCQ Z;  1VQ8 Z;  3G4S Z;  3CCQ 1;  1Q86 2;  1VQL 1;  1VQ8 1;  1S72 1;  3G4S 1;  3CCL 1;  1QVG Y;  1YHQ 1;  3I56 1;  1M1K 1;  1VQM Z;  1VQ7 1;  1M90 2;  1KD1 1;  3CCJ Z;  3CCR Z;  3CC2 Z;  1JJ2 Y;  1KQS Y;  3CCJ 1;  1YI2 Z;  3CMA 1;  3CD6 1;  3CCR 1;  1K73 2;  3CCS Z;  1KC8 2;  1K8A 2;  1N8R 2;  3G71 Z;  1VQN 1;  3CCU Z;  1Q81 2;  2QA4 Z;  1VQO Z;  1YIJ 1;  3CCU 1;  1QVF Y;  3CCV 1;  1VQL Z;  2QA4 1;  1VQO 1;  1S72 Z;  2OTL 1;  1NJI 2;  3CCL Z;  1YIT 1;  1YHQ Z;  3I56 Z;  1QVG Z;  1VQK 1;  1VQ7 Z;  3CCM Z;  1Q82 2;  1VQ9 1;  3CCM 1;  1YJN 1;  1YJ9 Z;  1KQS Z;  1JJ2 Z;  3CMA Z;  1K9M 2;  3CD6 Z;  1VQ4 Z;  1YJ9 1;  1Q7Y 2;  1Q86 1;  1VQN Z;  2QEX 1;  1VQ4 1;  1YIJ Z;  2OTJ Z;  1M90 1;  1VQ5 Z;  1VQ6 Z;  3CCV Z;  1QVF Z;  2OTL Z;  2OTJ 1;  1VQ5 1;  1VQ6 1;  1YIT Z;  3CXC Y;  1K73 1;  1VQK Z;  3I55 Z;  1KC8 1;  1K8A 1;  1N8R 1;  3OW2 Y;  3I55 1;  1VQ9 Z;  3G6E 1;  3CC7 Z;  1YJN Z;  1Q81 1;  1YJW 1;  3CC7 1;  3CPW Y;  3CCE 1;  1VQP 1;  1NJI 1;  2QEX Z;  1M1K 2; 
#chains in the Genus database with same CATH topology
 3D6W A;  3NDJ A;  2NVQ I;  3CXC Z;  2K3R A;  2O4H A;  1Q7Y 1;  1ZB9 A;  5A2Q f;  1N2F A;  1X3W A;  5FLM I;  2LIY A;  1WZN A;  1NUI A;  4BY7 I;  1YI2 1;  2OOY B;  4BXX I;  2VF1 A;  2VUG A;  4HH4 A;  1W2B Z;  1USP A;  1I50 I;  1Q86 2;  1VQL 1;  3FQQ A;  1QVG Y;  5D1O B;  3I56 1;  1M1K 1;  3HOY I;  1VQM Z;  1M90 2;  2K5R A;  3NH8 A;  4AYB A;  3CCR Z;  2JIP A;  2J6A A;  3F3F C;  3H3V J;  2QRC B;  5IP7 I;  3CCR 1;  3HOZ I;  3CCS Z;  1KC8 2;  1K8A 2;  3S1R I;  2NAP A;  1VQN 1;  3CCU Z;  2NVT I;  1VQO Z;  3CCU 1;  1VQO 1;  4A3K I;  2LFU A;  2Y0S A;  5C4X I;  1I6H I;  3PO3 I;  2DE6 A;  4NFR A;  5CM2 M;  4HGY A;  1Q82 2;  2EGT A;  1SIW A;  2RT9 A;  3M4O I;  3I4N I;  3CD6 Z;  2WB1 A;  1Q86 1;  2QR1 B;  2E2I I;  1QF8 A;  3GTG I;  3PO2 I;  1JWH C;  5AN9 F;  2OTJ Z;  1Y1V S;  1M90 1;  1VQ5 Z;  1QVF Z;  4BY1 I;  2OTJ 1;  1VQ5 1;  2P3Y A;  3CXC Y;  5FLX b;  1KC8 1;  1K8A 1;  4E31 A;  1L1O C;  4DGL A;  1VQ9 Z;  3G6E 1;  4CL1 A;  2E7Z A;  2QEX Z;  1SFO I;  3GKQ A;  3MZL B;  1Q82 1;  4A3M I;  1W2B Y;  2OZK A;  2E2H I;  2R93 I;  3QWU A;  3S14 I;  3J80 b;  4A3I I;  3S1M I;  3S15 I;  3EER A;  2W03 A;  1WW9 A;  1WII A;  3FKI I;  2DE5 A;  2RHB A;  4RVF A;  3HKZ A;  4X6A I;  2V3V A;  3CC4 Z;  3CC4 1;  3HOW I;  1VQ8 Z;  3G4S Z;  4E33 A;  3S16 I;  1VQ8 1;  2KI7 B;  2JIM A;  3G4S 1;  1S72 1;  1NP6 A;  3CCL 1;  2R92 I;  4BBS I;  3J81 b;  4MD9 A;  3NFZ A;  1YI2 Z;  4NBC A;  3GTM I;  1WJ2 A;  1K73 2;  1FDI A;  1USP B;  2YU9 I;  3NH5 A;  4A3L I;  2IZ4 A;  1I3Q I;  1P9N A;  3S1N I;  3IFU A;  3F3P C;  1QVF Y;  1VQL Z;  4A3D I;  2OTL 1;  4MH4 A;  1NJI 2;  3I56 Z;  2JNY A;  1VQK 1;  1TWG I;  3CCM Z;  3CQZ I;  3HOU I;  2HU9 A;  3CCM 1;  3HOV I;  3H0G I;  1YJN 1;  4RVG A;  4S1T A;  1YJ9 Z;  3T4N B;  3K7A I;  1K9M 2;  2W04 A;  4NB8 A;  1YJ9 1;  2RBL A;  1VQN Z;  4NBD A;  5FLX f;  1RO4 A;  1RLY A;  1TWC I;  2JIQ A;  4A3C I;  3P5J B;  1RQF A;  3EED A;  1VQ6 Z;  3KIF A;  2VPZ A;  1TFI A;  2O53 A;  1VQ6 1;  1TWH I;  1S7M A;  2PMZ A;  1K73 1;  3Q87 A;  4NB9 A;  1YJW 1;  3ESW A;  5D1O A;  4NBG A;  3CCE 1;  1VQP 1;  1NJI 1;  3RZD I;  4RVH A;  1Q16 A;  4MXU A;  4Y7N I;  2VPW A;  2JS4 A;  3GTL I;  1Z02 A;  2WAQ A;  1KD1 2;  3NH4 A;  1K9M 1;  4NH1 C;  4E2Y A;  2JR6 A;  1TWA I;  2VPX A;  2IV2 X;  3G6E Z;  2OOX B;  4RS4 A;  1ML8 A;  3IF8 A;  2E2J I;  2QRE B;  5T64 A;  4DQY B;  3CPW Z;  2GTH A;  4MON A;  5IP9 I;  3CC2 1;  3NDI A;  2YAD A;  4RV9 A;  5T6B A;  3J81 f;  3G71 1;  1RO0 A;  1QXF A;  3GTM S;  2RIQ A;  2NVY I;  2IZ3 A;  3GTP I;  4A3B I;  2F4M A;  4E2Z A;  4A3J I;  3D2L A;  1YHQ 1;  2H85 A;  1VQ7 1;  3VTN A;  3FQM A;  2G2K A;  3I07 A;  4TNU A;  1KD1 1;  3CCJ Z;  2JIR A;  4NBF A;  4NBA A;  3CCJ 1;  3CMA 1;  3GCF A;  2ZAE B;  2JA7 I;  3LUS A;  2F4O A;  2PM9 A;  2JA6 I;  1Y1W I;  1Q81 2;  5C44 I;  3VMG A;  1YIJ 1;  3S2H I;  3CCV 1;  5IT9 b;  2JA8 I;  1S72 Z;  1TWF I;  3CCL Z;  1YIT 1;  2M48 A;  2AKL A;  2VPY A;  3GTQ I;  2M6N A;  3HOX I;  2JA5 I;  2HF1 A;  1Y1V I;  1JJ2 Z;  1KQS Z;  4EWC A;  2JUB A;  1K83 I;  1R9T I;  2QRD B;  3PO3 S;  3JAM b;  3VB9 A;  2DE7 A;  1X3Z A;  2QLV B;  2RPR A;  2QKD A;  4XX2 A;  3TDH B;  4E30 A;  3D9X A;  2OTL Z;  3S17 I;  3VMI A;  2Q51 A;  2V8I A;  1VQK Z;  2B63 I;  4E2W A;  4RVD A;  5LL6 f;  1ZB8 A;  2I3C A;  3CC7 Z;  3S2D I;  2E9H A;  4HGZ A;  3GTJ I;  1YJN Z;  5C3E I;  1Q81 1;  4A3F I;  2V8K A;  3CC7 1;  3CPW Y;  1RNI A;  3BG1 B;  2BJO A;  1AA6 A;  3IR7 A;  2GU2 A;  3U50 C;  2Q4Z A;  3J7A 4;  2GTI A;  4A3G I;  3OW2 Z;  2NVX I;  3RZO I;  4MD7 A;  3MZK B;  1VLA A;  1YJW Z;  1VQM 1;  2VUM I;  3I4M I;  3IX0 A;  3MON A;  3CCE Z;  1VQP Z;  4BBR I;  3GTO I;  3CME Z;  1KRL A;  1Z03 A;  3CCS 1;  5A2Q b;  3J80 f;  1Z01 A;  3CME 1;  4NOZ A;  1RO2 A;  1Y8C A;  5D1P A;  2JMO A;  3CCQ Z;  1FDO A;  3CCQ 1;  4A93 I;  4DK1 A;  4QTU A;  1WCM I;  3TE5 B;  4NBH A;  3CC2 Z;  4MRI A;  5IT9 f;  1KQS Y;  1JJ2 Y;  3CD6 1;  2R7Z I;  1N8R 2;  3G71 Z;  5C4J I;  2LEX A;  2QA4 Z;  4QTT A;  2QA4 1;  1YHQ Z;  1QVG Z;  3S1Q I;  1VQ7 Z;  3JAM f;  4A3E I;  3VMH A;  1VQ9 1;  2P28 A;  3CMA Z;  1PFT A;  1VQ4 Z;  1Q7Y 2;  4MD8 A;  2QEX 1;  1VQ4 1;  2JIO A;  2PK7 A;  4E32 A;  4Y52 I;  4NBE A;  1YIJ Z;  2V8J A;  4E2X A;  2R6M A;  3CCV Z;  3GTK I;  2V45 A;  1QYP A;  5T67 A;  4NBB A;  1YIT Z;  2KPI A;  1LQL A;  1ZH1 A;  3I55 Z;  3M3Y I;  1N8R 1;  3OW2 Y;  3I55 1;  2AYD A;  1YUA A;  1DL6 A;  1YUK A;  1X0T A;  3BG0 B;  3KIH A;  1M1K 2; 
#chains in the Genus database with same CATH homology
 3D6W A;  3NDJ A;  2NVQ I;  3CXC Z;  2K3R A;  2O4H A;  1Q7Y 1;  1ZB9 A;  5A2Q f;  1N2F A;  1X3W A;  5FLM I;  2LIY A;  1NUI A;  4BY7 I;  1YI2 1;  2OOY B;  4BXX I;  2VF1 A;  2VUG A;  4HH4 A;  1W2B Z;  1USP A;  1I50 I;  1Q86 2;  1VQL 1;  3FQQ A;  1QVG Y;  5D1O B;  3I56 1;  1M1K 1;  3HOY I;  1VQM Z;  1M90 2;  2K5R A;  3NH8 A;  4AYB A;  3CCR Z;  2J6A A;  3F3F C;  3H3V J;  2QRC B;  5IP7 I;  3CCR 1;  3HOZ I;  3CCS Z;  1KC8 2;  1K8A 2;  3S1R I;  1VQN 1;  3CCU Z;  2NVT I;  1VQO Z;  3CCU 1;  1VQO 1;  4A3K I;  2LFU A;  2Y0S A;  5C4X I;  1I6H I;  3PO3 I;  2DE6 A;  4NFR A;  5CM2 M;  4HGY A;  1Q82 2;  2EGT A;  2RT9 A;  3M4O I;  3I4N I;  3CD6 Z;  2WB1 A;  1Q86 1;  2QR1 B;  2E2I I;  1QF8 A;  3GTG I;  3PO2 I;  1JWH C;  5AN9 F;  2OTJ Z;  1Y1V S;  1M90 1;  1VQ5 Z;  1QVF Z;  4BY1 I;  2OTJ 1;  1VQ5 1;  2P3Y A;  3CXC Y;  5FLX b;  1KC8 1;  1K8A 1;  4E31 A;  1L1O C;  4DGL A;  1VQ9 Z;  3G6E 1;  4CL1 A;  2QEX Z;  1SFO I;  3GKQ A;  3MZL B;  1Q82 1;  4A3M I;  1W2B Y;  2OZK A;  2E2H I;  2R93 I;  3QWU A;  3S14 I;  3J80 b;  4A3I I;  3S1M I;  3S15 I;  3EER A;  2W03 A;  1WW9 A;  1WII A;  3FKI I;  2DE5 A;  2RHB A;  4RVF A;  3HKZ A;  4X6A I;  3CC4 Z;  3CC4 1;  3HOW I;  1VQ8 Z;  3G4S Z;  4E33 A;  3S16 I;  1VQ8 1;  2KI7 B;  1S72 1;  3G4S 1;  1NP6 A;  3CCL 1;  2R92 I;  4BBS I;  3J81 b;  4MD9 A;  3NFZ A;  1YI2 Z;  4NBC A;  3GTM I;  1K73 2;  1USP B;  2YU9 I;  3NH5 A;  4A3L I;  2IZ4 A;  1I3Q I;  1P9N A;  3S1N I;  3IFU A;  3F3P C;  1QVF Y;  1VQL Z;  4A3D I;  2OTL 1;  4MH4 A;  1NJI 2;  3I56 Z;  2JNY A;  1VQK 1;  1TWG I;  3CCM Z;  3CQZ I;  3HOU I;  2HU9 A;  3CCM 1;  3HOV I;  3H0G I;  1YJN 1;  4RVG A;  4S1T A;  1YJ9 Z;  3T4N B;  3K7A I;  1K9M 2;  2W04 A;  4NB8 A;  1YJ9 1;  2RBL A;  1VQN Z;  4NBD A;  5FLX f;  1RO4 A;  1RLY A;  1TWC I;  4A3C I;  3P5J B;  1RQF A;  3EED A;  1VQ6 Z;  3KIF A;  1TFI A;  2O53 A;  1VQ6 1;  1TWH I;  1S7M A;  2PMZ A;  1K73 1;  3Q87 A;  4NB9 A;  1YJW 1;  3ESW A;  5D1O A;  4NBG A;  3CCE 1;  1VQP 1;  1NJI 1;  3RZD I;  4RVH A;  4MXU A;  4Y7N I;  2JS4 A;  3GTL I;  1Z02 A;  2WAQ A;  1KD1 2;  3NH4 A;  1K9M 1;  4NH1 C;  4E2Y A;  2JR6 A;  1TWA I;  3G6E Z;  2OOX B;  4RS4 A;  1ML8 A;  3IF8 A;  2E2J I;  2QRE B;  5T64 A;  4DQY B;  3CPW Z;  2GTH A;  4MON A;  5IP9 I;  3CC2 1;  3NDI A;  2YAD A;  4RV9 A;  5T6B A;  3J81 f;  3G71 1;  1RO0 A;  3GTM S;  2RIQ A;  2NVY I;  2IZ3 A;  3GTP I;  4A3B I;  2F4M A;  4E2Z A;  4A3J I;  1YHQ 1;  2H85 A;  1VQ7 1;  3VTN A;  3FQM A;  2G2K A;  3I07 A;  4TNU A;  1KD1 1;  3CCJ Z;  4NBF A;  4NBA A;  3CCJ 1;  3CMA 1;  3GCF A;  2ZAE B;  2JA7 I;  3LUS A;  2F4O A;  2PM9 A;  2JA6 I;  1Y1W I;  1Q81 2;  5C44 I;  3VMG A;  1YIJ 1;  3S2H I;  3CCV 1;  5IT9 b;  2JA8 I;  1S72 Z;  1TWF I;  3CCL Z;  1YIT 1;  2M48 A;  2AKL A;  3GTQ I;  2M6N A;  3HOX I;  2JA5 I;  2HF1 A;  1Y1V I;  1JJ2 Z;  1KQS Z;  4EWC A;  2JUB A;  1K83 I;  1R9T I;  2QRD B;  3PO3 S;  3JAM b;  3VB9 A;  2DE7 A;  1X3Z A;  2QLV B;  2RPR A;  2QKD A;  4XX2 A;  3TDH B;  4E30 A;  3D9X A;  2OTL Z;  3S17 I;  3VMI A;  2Q51 A;  2V8I A;  1VQK Z;  2B63 I;  4E2W A;  4RVD A;  5LL6 f;  1ZB8 A;  2I3C A;  3CC7 Z;  3S2D I;  2E9H A;  4HGZ A;  3GTJ I;  1YJN Z;  5C3E I;  1Q81 1;  4A3F I;  2V8K A;  3CC7 1;  3CPW Y;  1RNI A;  3BG1 B;  2BJO A;  2GU2 A;  3U50 C;  2Q4Z A;  3J7A 4;  2GTI A;  4A3G I;  3OW2 Z;  2NVX I;  3RZO I;  4MD7 A;  3MZK B;  1VLA A;  1YJW Z;  1VQM 1;  2VUM I;  3I4M I;  3IX0 A;  3MON A;  3CCE Z;  1VQP Z;  4BBR I;  3GTO I;  3CME Z;  1KRL A;  1Z03 A;  3CCS 1;  5A2Q b;  3J80 f;  1Z01 A;  3CME 1;  4NOZ A;  1RO2 A;  5D1P A;  2JMO A;  3CCQ Z;  3CCQ 1;  4A93 I;  4DK1 A;  4QTU A;  1WCM I;  3TE5 B;  4NBH A;  3CC2 Z;  4MRI A;  5IT9 f;  1KQS Y;  1JJ2 Y;  3CD6 1;  2R7Z I;  1N8R 2;  3G71 Z;  5C4J I;  2QA4 Z;  4QTT A;  2QA4 1;  1YHQ Z;  1QVG Z;  3S1Q I;  1VQ7 Z;  3JAM f;  4A3E I;  3VMH A;  1VQ9 1;  2P28 A;  3CMA Z;  1PFT A;  1VQ4 Z;  1Q7Y 2;  4MD8 A;  2QEX 1;  1VQ4 1;  2PK7 A;  4E32 A;  4Y52 I;  4NBE A;  1YIJ Z;  2V8J A;  4E2X A;  2R6M A;  3CCV Z;  3GTK I;  1QYP A;  5T67 A;  4NBB A;  1YIT Z;  2KPI A;  1LQL A;  1ZH1 A;  3I55 Z;  3M3Y I;  1N8R 1;  3OW2 Y;  3I55 1;  1YUA A;  1DL6 A;  1YUK A;  1X0T A;  3BG0 B;  3KIH A;  1M1K 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...