3CCQZ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
b'SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccqZ00
3OW2Z 3CCR1 1VQP1 2QEX1 1M1K1 3CCMZ 3CCQZ 1YJWZ 1YHQZ 1YJN1 1KD12 1VQOZ 1VQ6Z 1Q862 3CCJZ 1VQ41 1KD11 1K9M1 3CC2Z 1Q811 1Q7Y2 3G4SZ 3CMEZ 1Q7Y1 1VQ5Z 3CPWY 3CCQ1 1VQLZ 1M902 3CMA1 1NJI2 1KC82 1VQ8Z 3I56Z 3CCEZ 1NJI1 1YJ9Z 1YIT1 1N8R2 1YI2Z 1VQN1 3CC7Z 1S721 3CCSZ 1VQ51 1N8R1 3CCLZ 3G71Z 1QVFZ 1K732 1Q822 3I561 1Q861 3CCUZ 2OTLZ 1K8A2 3CCM1 1YI21 1YIJZ 3I55Z 1YJW1 3CCS1 1VQKZ 1KQSY 1K8A1 3CC4Z 1YHQ1 1M901 1VQO1 3CXCZ 1VQ61 1KQSZ 1VQ7Z 1KC81 3CCJ1 1VQMZ 1JJ2Z 3CC21 3G4S1 2OTJZ 1QVFY 3CME1 1VQL1 2QEXZ 2QA4Z 1VQ81 1K731 1YJNZ 3CCE1 1Q821 3CD6Z 3CCVZ 1VQM1 1VQ4Z 1YJ91 1W2BY 3CC71 3G6EZ 3CXCY 1VQ9Z 1M1K2 1W2BZ 1QVGZ 1JJ2Y 3CCL1 3G711 2QA41 3CMAZ 3CD61 1K9M2 3CCU1 3CCV1 1Q812 2OTL1 1YITZ 3CCRZ 3G6E1 3I551 1YIJ1 1VQPZ 1VQK1 1VQ91 1VQNZ 1S72Z 3CC41 1VQ71 3CPWZ 1QVGY 3OW2Y 2OTJ1
chains in the Genus database with same CATH superfamily
3MZLB 3S15I 5FLXb 3CCR1 1VQP1 1M1K1 1WZNA 1YHQZ 3BG1B 1VQOZ 2E2JI 3HOVI 3GTOI 3CCJZ 1VQ41 1KD11 3T4NB 1PFTA 1Q811 1Q7Y2 3S14I 3IF8A 1VQLZ 3CMA1 2GTHA 1KC82 3NDJA 2R92I 3CCEZ 2LFUA 4XX2A 4RS4A 3EERA 3J81b 2NVQI 4MD8A 1QXFA 1X0TA 4NH1C 2JA7I 1YI2Z 1S721 1N8R1 1ZH1A 4A93I 5IT9f 1Q822 2JUBA 5D1OB 4DGLA 1FDIA 4E30A 1Q861 5LL6f 1WCMI 1SIWA 2OTLZ 3CCM1 1YI21 4BBRI 1K83I 1VQKZ 2Q4ZA 1AA6A 1KQSY 2QLVB 3S16I 1M901 1WJ2A 1VQ7Z 2M48A 2DE6A 1JJ2Z 2VPXA 3G4S1 1Y1WI 3KIFA 3S1RI 2VUMI 3GTJI 1Y8CA 2K5RA 2RIQA 3VTNA 4RVHA 1JWHC 1FDOA 2IZ4A 3CC71 4NBGA 2P28A 1M1K2 4RVDA 4MXUA 1W2BZ 1JJ2Y 5AN9F 3FKII 1TWHI 2W04A 2F4OA 2EGTA 1N2FA 1Q812 4MD9A 1TWGI 3I551 1TWCI 2KI7B 2E7ZA 2GTIA 2PM9A 4A3JI 3GCFA 3IFUA 4E32A 5FLXf 2JA5I 2NVTI 2HF1A 3D6WA 3OW2Y 3JAMb 2BJOA 2JA6I 2R93I 3IX0A 2VF1A 4RV9A 2QEX1 4A3LI 4A3DI 2RHBA 4MRIA 1VQ6Z 1TFIA 2V45A 1Q862 3CC2Z 3CMEZ 2R6MA 3NFZA 3J81f 1VQ5Z 3I4MI 2IZ3A 2V8KA 4MH4A 5A2Qb 1TWAI 1M902 1Y1VI 3D2LA 1VLAA 2V8IA 1NJI1 1KRLA 1YJ9Z 1YIT1 4NBHA 1VQN1 1X3ZA 1VQ51 3M3YI 4A3CI 3P5JB 3CCLZ 3G71Z 3J7A4 4E2XA 1YUKA 2V8JA 1RLYA 1RO2A 2OOXB 5D1OA 1K8A2 3NH4A 4QTUA 1YIJZ 2G2KA 3CC4Z 1YHQ1 3CXCZ 2PK7A 1VQO1 1KQSZ 1WW9A 3CCJ1 1VQMZ 2K3RA 4BBSI 1USPA 3GTPI 4A3GI 2J6AA 2H85A 4Y7NI 1VQL1 3ESWA 4TNUA 1TWFI 3GKQA 1YJNZ 2I3CA 3CCE1 2ZAEB 3PO3I 1VQM1 3GTQI 3U50C 4NFRA 2YU9I 3G6EZ 3CXCY 3VMGA 2KPIA 3HOYI 2JIOA 1ZB9A 3TE5B 2GU2A 3GTMI 2OTL1 1QF8A 2QRDB 3G6E1 2YADA 3JAMf 1VQK1 2LIYA 5C4XI 3M4OI 2QRCB 2Q51A 1VQ71 3HOXI 1LQLA 3PO3S 3CPWZ 3J80b 5T67A 1ZB8A 4DK1A 3OW2Z 2AYDA 1NP6A 1WIIA 4DQYB 4BY7I 3CCQZ 1YJWZ 4MONA 2OOYB 3RZDI 3H0GI 1KD12 1Q16A 2P3YA 2F4MA 2RPRA 4A3KI 5A2Qf 1K9M1 3GTMS 3TDHB 1RNIA 2M6NA 1Q7Y1 4NB9A 5T64A 3CPWY 3CCQ1 3S2HI 4BY1I 1VQ8Z 3I56Z 3MONA 3F3PC 3VB9A 3I07A 3HOZI 5C3EI 2V3VA 1N8R2 3CCSZ 2DE7A 3RZOI 2QKDA 5C4JI 1QVFZ 3S17I 4HH4A 3F3FC 3I561 3D9XA 4E2ZA 4AYBA 3CCUZ 3QWUA 2Y0SA 1QYPA 1RO4A 3CCS1 4NBDA 4NBFA 3S1QI 1VQ61 3NH8A 2O4HA 3HOUI 4E31A 4A3II 3GTKI 4NBCA 2E9HA 4RVFA 5IP7I 3CC21 2OTJZ 1QVFY 3CME1 4A3BI 2VPZA 5IP9I 3IR7A 1R9TI 1K731 1X3WA 1Z01A 2AKLA 4E33A 3NH5A 1NUIA 4S1TA 1YJ91 1VQ4Z 4A3MI 4EWCA 3S2DI 2WAQA 1Y1VS 3CCL1 3G711 2NVXI 4NB8A 1S7MA 3CMAZ 4HGYA 3VMIA 1K9M2 2QR1B 4A3FI 2JNYA 1YIJ1 1I6HI 1RO0A 1S72Z 3J80f 3CC41 5FLMI 5D1PA 2PMZA 4QTTA 2NAPA 1RQFA 2JR6A 1P9NA 3GTLI 5C44I 3S1NI 4NBAA 3CCMZ 3I4NI 5T6BA 1YJN1 2DE5A 3BG0B 3HKZA 2WB1A 2JA8I 2JIQA 2VUGA 3G4SZ 1SFOI 3K7AI 3EEDA 3CQZI 1NJI2 1USPB 4MD7A 2OZKA 3CC7Z 1Z03A 1Z02A 2E2II 4NBBA 2JIMA 1K732 4A3EI 4NBEA 2B63I 1I3QI 4HGZA 2QREB 1I50I 3LUSA 2LEXA 5IT9b 2JIRA 3I55Z 2R7ZI 1YJW1 2E2HI 1K8A1 2RT9A 4Y52I 2VPYA 3NDIA 3GTGI 1KC81 4E2YA 4BXXI 4NOZA 3FQMA 3VMHA 4RVGA 3S1MI 2JMOA 2QEXZ 3KIHA 2JS4A 4E2WA 2QA4Z 2O53A 1VQ81 5CM2M 1ML8A 1Q821 3CD6Z 3CCVZ 4X6AI 3H3VJ 2VPWA 3PO2I 1W2BY 3Q87A 1VQ9Z 1QVGZ 2QA41 2W03A 3FQQA 1L1OC 3CD61 2JIPA 3CCU1 3CCV1 3HOWI 1YITZ 3CCRZ 1VQPZ 3MZKB 1VQ91 1VQNZ 2RBLA 4CL1A 2IV2X 1DL6A 2HU9A 1YUAA 2NVYI 1QVGY 2OTJ1
chains in the Genus database with same CATH topology
3MZLB 3S15I 5FLXb 3CCR1 1VQP1 1M1K1 1YHQZ 3BG1B 1VQOZ 2E2JI 3HOVI 3GTOI 3CCJZ 1VQ41 1KD11 3T4NB 1PFTA 1Q811 1Q7Y2 3S14I 3IF8A 1VQLZ 3CMA1 2GTHA 1KC82 3NDJA 2R92I 3CCEZ 2LFUA 4XX2A 4RS4A 3EERA 3J81b 2NVQI 4MD8A 1X0TA 4NH1C 2JA7I 1YI2Z 1S721 1N8R1 1ZH1A 4A93I 5IT9f 1Q822 2JUBA 5D1OB 4DGLA 4E30A 1Q861 5LL6f 1WCMI 2OTLZ 3CCM1 1YI21 4BBRI 1K83I 1VQKZ 2Q4ZA 3S16I 1KQSY 2QLVB 1M901 1VQ7Z 2M48A 2DE6A 1JJ2Z 3G4S1 1Y1WI 3KIFA 3S1RI 2VUMI 3GTJI 2K5RA 2RIQA 3VTNA 4RVHA 1JWHC 2IZ4A 3CC71 4NBGA 2P28A 1M1K2 4RVDA 4MXUA 1W2BZ 1JJ2Y 5AN9F 3FKII 1TWHI 2W04A 2F4OA 2EGTA 1N2FA 1Q812 4MD9A 1TWGI 3I551 1TWCI 2KI7B 2GTIA 2PM9A 4A3JI 3GCFA 3IFUA 4E32A 5FLXf 2JA5I 2NVTI 2HF1A 3D6WA 3OW2Y 3JAMb 2BJOA 2JA6I 2R93I 3IX0A 2VF1A 4RV9A 2QEX1 4A3LI 4A3DI 2RHBA 4MRIA 1VQ6Z 1TFIA 1Q862 3CC2Z 3CMEZ 2R6MA 3NFZA 3J81f 1VQ5Z 3I4MI 2IZ3A 2V8KA 4MH4A 5A2Qb 1TWAI 1M902 1Y1VI 1VLAA 2V8IA 1NJI1 1KRLA 1YJ9Z 1YIT1 4NBHA 1VQN1 1X3ZA 1VQ51 3M3YI 4A3CI 3P5JB 3CCLZ 3G71Z 3J7A4 4E2XA 1YUKA 2V8JA 1RLYA 1RO2A 2OOXB 5D1OA 1K8A2 3NH4A 4QTUA 1YIJZ 2G2KA 3CC4Z 1YHQ1 3CXCZ 2PK7A 1VQO1 1KQSZ 1WW9A 3CCJ1 1VQMZ 2K3RA 4BBSI 1USPA 3GTPI 4A3GI 2J6AA 2H85A 4Y7NI 1VQL1 3ESWA 4TNUA 1TWFI 3GKQA 1YJNZ 2I3CA 3CCE1 2ZAEB 3PO3I 1VQM1 3GTQI 3U50C 4NFRA 2YU9I 3G6EZ 3CXCY 3VMGA 2KPIA 3HOYI 1ZB9A 3TE5B 2GU2A 3GTMI 2OTL1 1QF8A 2QRDB 3G6E1 2YADA 3JAMf 1VQK1 2LIYA 5C4XI 3M4OI 2QRCB 2Q51A 1VQ71 3HOXI 1LQLA 3PO3S 3CPWZ 3J80b 5T67A 1ZB8A 4DK1A 3OW2Z 1NP6A 1WIIA 4DQYB 4BY7I 3CCQZ 1YJWZ 4MONA 2OOYB 3RZDI 3H0GI 1KD12 2P3YA 2F4MA 2RPRA 4A3KI 5A2Qf 1K9M1 3GTMS 3TDHB 1RNIA 2M6NA 1Q7Y1 4NB9A 5T64A 3CPWY 3CCQ1 3S2HI 4BY1I 1VQ8Z 3I56Z 3MONA 3F3PC 3VB9A 3I07A 3HOZI 5C3EI 1N8R2 3CCSZ 2DE7A 3RZOI 2QKDA 5C4JI 1QVFZ 3S17I 4HH4A 3F3FC 3I561 3D9XA 4E2ZA 4AYBA 3CCUZ 3QWUA 2Y0SA 1QYPA 1RO4A 3CCS1 4NBDA 4NBFA 3S1QI 1VQ61 3NH8A 2O4HA 3HOUI 4E31A 4A3II 3GTKI 4NBCA 2E9HA 4RVFA 5IP7I 3CC21 2OTJZ 1QVFY 3CME1 4A3BI 5IP9I 1R9TI 1K731 1X3WA 1Z01A 2AKLA 4E33A 3NH5A 1NUIA 4S1TA 1YJ91 1VQ4Z 4A3MI 4EWCA 3S2DI 2WAQA 1Y1VS 3CCL1 3G711 2NVXI 4NB8A 1S7MA 3CMAZ 4HGYA 3VMIA 1K9M2 2QR1B 4A3FI 2JNYA 1YIJ1 1I6HI 1RO0A 1S72Z 3J80f 3CC41 5FLMI 5D1PA 2PMZA 4QTTA 1RQFA 2JR6A 1P9NA 3GTLI 5C44I 3S1NI 4NBAA 3CCMZ 3I4NI 5T6BA 1YJN1 2DE5A 3BG0B 3HKZA 2WB1A 2JA8I 2VUGA 3G4SZ 1SFOI 3K7AI 3EEDA 3CQZI 1NJI2 1USPB 4MD7A 2OZKA 3CC7Z 1Z03A 1Z02A 2E2II 4NBBA 1K732 4A3EI 4NBEA 2B63I 1I3QI 4HGZA 2QREB 1I50I 3LUSA 5IT9b 3I55Z 2R7ZI 1YJW1 2E2HI 1K8A1 2RT9A 4Y52I 3NDIA 3GTGI 1KC81 4E2YA 4BXXI 4NOZA 3FQMA 3VMHA 4RVGA 3S1MI 2JMOA 2QEXZ 3KIHA 2JS4A 4E2WA 2QA4Z 2O53A 1VQ81 5CM2M 1ML8A 1Q821 3CD6Z 3CCVZ 4X6AI 3H3VJ 3PO2I 1W2BY 3Q87A 1VQ9Z 1QVGZ 2QA41 2W03A 3FQQA 1L1OC 3CD61 3CCU1 3CCV1 3HOWI 1YITZ 3CCRZ 1VQPZ 3MZKB 1VQ91 1VQNZ 2RBLA 4CL1A 1DL6A 2HU9A 1YUAA 2NVYI 1QVGY 2OTJ1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW2 Z;  3CCR 1;  1VQP 1;  2QEX 1;  1M1K 1;  3CCM Z;  3CCQ Z;  1YJW Z;  1YHQ Z;  1YJN 1;  1KD1 2;  1VQO Z;  1VQ6 Z;  1Q86 2;  3CCJ Z;  1VQ4 1;  1KD1 1;  1K9M 1;  3CC2 Z;  1Q81 1;  1Q7Y 2;  3G4S Z;  3CME Z;  1Q7Y 1;  1VQ5 Z;  3CPW Y;  3CCQ 1;  1VQL Z;  1M90 2;  3CMA 1;  1NJI 2;  1KC8 2;  1VQ8 Z;  3I56 Z;  3CCE Z;  1NJI 1;  1YJ9 Z;  1YIT 1;  1N8R 2;  1YI2 Z;  1VQN 1;  3CC7 Z;  1S72 1;  3CCS Z;  1VQ5 1;  1N8R 1;  3CCL Z;  3G71 Z;  1QVF Z;  1K73 2;  1Q82 2;  3I56 1;  1Q86 1;  3CCU Z;  2OTL Z;  1K8A 2;  3CCM 1;  1YI2 1;  1YIJ Z;  3I55 Z;  1YJW 1;  3CCS 1;  1VQK Z;  1KQS Y;  1K8A 1;  3CC4 Z;  1YHQ 1;  1M90 1;  1VQO 1;  3CXC Z;  1VQ6 1;  1KQS Z;  1VQ7 Z;  1KC8 1;  3CCJ 1;  1VQM Z;  1JJ2 Z;  3CC2 1;  3G4S 1;  2OTJ Z;  1QVF Y;  3CME 1;  1VQL 1;  2QEX Z;  2QA4 Z;  1VQ8 1;  1K73 1;  1YJN Z;  3CCE 1;  1Q82 1;  3CD6 Z;  3CCV Z;  1VQM 1;  1VQ4 Z;  1YJ9 1;  1W2B Y;  3CC7 1;  3G6E Z;  3CXC Y;  1VQ9 Z;  1M1K 2;  1W2B Z;  1QVG Z;  1JJ2 Y;  3CCL 1;  3G71 1;  2QA4 1;  3CMA Z;  3CD6 1;  1K9M 2;  3CCU 1;  3CCV 1;  1Q81 2;  2OTL 1;  1YIT Z;  3CCR Z;  3G6E 1;  3I55 1;  1YIJ 1;  1VQP Z;  1VQK 1;  1VQ9 1;  1VQN Z;  1S72 Z;  3CC4 1;  1VQ7 1;  3CPW Z;  1QVG Y;  3OW2 Y;  2OTJ 1; 
#chains in the Genus database with same CATH topology
 3MZL B;  3S15 I;  5FLX b;  3CCR 1;  1VQP 1;  1M1K 1;  1WZN A;  1YHQ Z;  3BG1 B;  1VQO Z;  2E2J I;  3HOV I;  3GTO I;  3CCJ Z;  1VQ4 1;  1KD1 1;  3T4N B;  1PFT A;  1Q81 1;  1Q7Y 2;  3S14 I;  3IF8 A;  1VQL Z;  3CMA 1;  2GTH A;  1KC8 2;  3NDJ A;  2R92 I;  3CCE Z;  2LFU A;  4XX2 A;  4RS4 A;  3EER A;  3J81 b;  2NVQ I;  4MD8 A;  1QXF A;  1X0T A;  4NH1 C;  2JA7 I;  1YI2 Z;  1S72 1;  1N8R 1;  1ZH1 A;  4A93 I;  5IT9 f;  1Q82 2;  2JUB A;  5D1O B;  4DGL A;  1FDI A;  4E30 A;  1Q86 1;  5LL6 f;  1WCM I;  1SIW A;  2OTL Z;  3CCM 1;  1YI2 1;  4BBR I;  1K83 I;  1VQK Z;  2Q4Z A;  1AA6 A;  1KQS Y;  2QLV B;  3S16 I;  1M90 1;  1WJ2 A;  1VQ7 Z;  2M48 A;  2DE6 A;  1JJ2 Z;  2VPX A;  3G4S 1;  1Y1W I;  3KIF A;  3S1R I;  2VUM I;  3GTJ I;  1Y8C A;  2K5R A;  2RIQ A;  3VTN A;  4RVH A;  1JWH C;  1FDO A;  2IZ4 A;  3CC7 1;  4NBG A;  2P28 A;  1M1K 2;  4RVD A;  4MXU A;  1W2B Z;  1JJ2 Y;  5AN9 F;  3FKI I;  1TWH I;  2W04 A;  2F4O A;  2EGT A;  1N2F A;  1Q81 2;  4MD9 A;  1TWG I;  3I55 1;  1TWC I;  2KI7 B;  2E7Z A;  2GTI A;  2PM9 A;  4A3J I;  3GCF A;  3IFU A;  4E32 A;  5FLX f;  2JA5 I;  2NVT I;  2HF1 A;  3D6W A;  3OW2 Y;  3JAM b;  2BJO A;  2JA6 I;  2R93 I;  3IX0 A;  2VF1 A;  4RV9 A;  2QEX 1;  4A3L I;  4A3D I;  2RHB A;  4MRI A;  1VQ6 Z;  1TFI A;  2V45 A;  1Q86 2;  3CC2 Z;  3CME Z;  2R6M A;  3NFZ A;  3J81 f;  1VQ5 Z;  3I4M I;  2IZ3 A;  2V8K A;  4MH4 A;  5A2Q b;  1TWA I;  1M90 2;  1Y1V I;  3D2L A;  1VLA A;  2V8I A;  1NJI 1;  1KRL A;  1YJ9 Z;  1YIT 1;  4NBH A;  1VQN 1;  1X3Z A;  1VQ5 1;  3M3Y I;  4A3C I;  3P5J B;  3CCL Z;  3G71 Z;  3J7A 4;  4E2X A;  1YUK A;  2V8J A;  1RLY A;  1RO2 A;  2OOX B;  5D1O A;  1K8A 2;  3NH4 A;  4QTU A;  1YIJ Z;  2G2K A;  3CC4 Z;  1YHQ 1;  3CXC Z;  2PK7 A;  1VQO 1;  1KQS Z;  1WW9 A;  3CCJ 1;  1VQM Z;  2K3R A;  4BBS I;  1USP A;  3GTP I;  4A3G I;  2J6A A;  2H85 A;  4Y7N I;  1VQL 1;  3ESW A;  4TNU A;  1TWF I;  3GKQ A;  1YJN Z;  2I3C A;  3CCE 1;  2ZAE B;  3PO3 I;  1VQM 1;  3GTQ I;  3U50 C;  4NFR A;  2YU9 I;  3G6E Z;  3CXC Y;  3VMG A;  2KPI A;  3HOY I;  2JIO A;  1ZB9 A;  3TE5 B;  2GU2 A;  3GTM I;  2OTL 1;  1QF8 A;  2QRD B;  3G6E 1;  2YAD A;  3JAM f;  1VQK 1;  2LIY A;  5C4X I;  3M4O I;  2QRC B;  2Q51 A;  1VQ7 1;  3HOX I;  1LQL A;  3PO3 S;  3CPW Z;  3J80 b;  5T67 A;  1ZB8 A;  4DK1 A;  3OW2 Z;  2AYD A;  1NP6 A;  1WII A;  4DQY B;  4BY7 I;  3CCQ Z;  1YJW Z;  4MON A;  2OOY B;  3RZD I;  3H0G I;  1KD1 2;  1Q16 A;  2P3Y A;  2F4M A;  2RPR A;  4A3K I;  5A2Q f;  1K9M 1;  3GTM S;  3TDH B;  1RNI A;  2M6N A;  1Q7Y 1;  4NB9 A;  5T64 A;  3CPW Y;  3CCQ 1;  3S2H I;  4BY1 I;  1VQ8 Z;  3I56 Z;  3MON A;  3F3P C;  3VB9 A;  3I07 A;  3HOZ I;  5C3E I;  2V3V A;  1N8R 2;  3CCS Z;  2DE7 A;  3RZO I;  2QKD A;  5C4J I;  1QVF Z;  3S17 I;  4HH4 A;  3F3F C;  3I56 1;  3D9X A;  4E2Z A;  4AYB A;  3CCU Z;  3QWU A;  2Y0S A;  1QYP A;  1RO4 A;  3CCS 1;  4NBD A;  4NBF A;  3S1Q I;  1VQ6 1;  3NH8 A;  2O4H A;  3HOU I;  4E31 A;  4A3I I;  3GTK I;  4NBC A;  2E9H A;  4RVF A;  5IP7 I;  3CC2 1;  2OTJ Z;  1QVF Y;  3CME 1;  4A3B I;  2VPZ A;  5IP9 I;  3IR7 A;  1R9T I;  1K73 1;  1X3W A;  1Z01 A;  2AKL A;  4E33 A;  3NH5 A;  1NUI A;  4S1T A;  1YJ9 1;  1VQ4 Z;  4A3M I;  4EWC A;  3S2D I;  2WAQ A;  1Y1V S;  3CCL 1;  3G71 1;  2NVX I;  4NB8 A;  1S7M A;  3CMA Z;  4HGY A;  3VMI A;  1K9M 2;  2QR1 B;  4A3F I;  2JNY A;  1YIJ 1;  1I6H I;  1RO0 A;  1S72 Z;  3J80 f;  3CC4 1;  5FLM I;  5D1P A;  2PMZ A;  4QTT A;  2NAP A;  1RQF A;  2JR6 A;  1P9N A;  3GTL I;  5C44 I;  3S1N I;  4NBA A;  3CCM Z;  3I4N I;  5T6B A;  1YJN 1;  2DE5 A;  3BG0 B;  3HKZ A;  2WB1 A;  2JA8 I;  2JIQ A;  2VUG A;  3G4S Z;  1SFO I;  3K7A I;  3EED A;  3CQZ I;  1NJI 2;  1USP B;  4MD7 A;  2OZK A;  3CC7 Z;  1Z03 A;  1Z02 A;  2E2I I;  4NBB A;  2JIM A;  1K73 2;  4A3E I;  4NBE A;  2B63 I;  1I3Q I;  4HGZ A;  2QRE B;  1I50 I;  3LUS A;  2LEX A;  5IT9 b;  2JIR A;  3I55 Z;  2R7Z I;  1YJW 1;  2E2H I;  1K8A 1;  2RT9 A;  4Y52 I;  2VPY A;  3NDI A;  3GTG I;  1KC8 1;  4E2Y A;  4BXX I;  4NOZ A;  3FQM A;  3VMH A;  4RVG A;  3S1M I;  2JMO A;  2QEX Z;  3KIH A;  2JS4 A;  4E2W A;  2QA4 Z;  2O53 A;  1VQ8 1;  5CM2 M;  1ML8 A;  1Q82 1;  3CD6 Z;  3CCV Z;  4X6A I;  3H3V J;  2VPW A;  3PO2 I;  1W2B Y;  3Q87 A;  1VQ9 Z;  1QVG Z;  2QA4 1;  2W03 A;  3FQQ A;  1L1O C;  3CD6 1;  2JIP A;  3CCU 1;  3CCV 1;  3HOW I;  1YIT Z;  3CCR Z;  1VQP Z;  3MZK B;  1VQ9 1;  1VQN Z;  2RBL A;  4CL1 A;  2IV2 X;  1DL6 A;  2HU9 A;  1YUA A;  2NVY I;  1QVG Y;  2OTJ 1; 
#chains in the Genus database with same CATH homology
 3MZL B;  3S15 I;  5FLX b;  3CCR 1;  1VQP 1;  1M1K 1;  1YHQ Z;  3BG1 B;  1VQO Z;  2E2J I;  3HOV I;  3GTO I;  3CCJ Z;  1VQ4 1;  1KD1 1;  3T4N B;  1PFT A;  1Q81 1;  1Q7Y 2;  3S14 I;  3IF8 A;  1VQL Z;  3CMA 1;  2GTH A;  1KC8 2;  3NDJ A;  2R92 I;  3CCE Z;  2LFU A;  4XX2 A;  4RS4 A;  3EER A;  3J81 b;  2NVQ I;  4MD8 A;  1X0T A;  4NH1 C;  2JA7 I;  1YI2 Z;  1S72 1;  1N8R 1;  1ZH1 A;  4A93 I;  5IT9 f;  1Q82 2;  2JUB A;  5D1O B;  4DGL A;  4E30 A;  1Q86 1;  5LL6 f;  1WCM I;  2OTL Z;  3CCM 1;  1YI2 1;  4BBR I;  1K83 I;  1VQK Z;  2Q4Z A;  3S16 I;  1KQS Y;  2QLV B;  1M90 1;  1VQ7 Z;  2M48 A;  2DE6 A;  1JJ2 Z;  3G4S 1;  1Y1W I;  3KIF A;  3S1R I;  2VUM I;  3GTJ I;  2K5R A;  2RIQ A;  3VTN A;  4RVH A;  1JWH C;  2IZ4 A;  3CC7 1;  4NBG A;  2P28 A;  1M1K 2;  4RVD A;  4MXU A;  1W2B Z;  1JJ2 Y;  5AN9 F;  3FKI I;  1TWH I;  2W04 A;  2F4O A;  2EGT A;  1N2F A;  1Q81 2;  4MD9 A;  1TWG I;  3I55 1;  1TWC I;  2KI7 B;  2GTI A;  2PM9 A;  4A3J I;  3GCF A;  3IFU A;  4E32 A;  5FLX f;  2JA5 I;  2NVT I;  2HF1 A;  3D6W A;  3OW2 Y;  3JAM b;  2BJO A;  2JA6 I;  2R93 I;  3IX0 A;  2VF1 A;  4RV9 A;  2QEX 1;  4A3L I;  4A3D I;  2RHB A;  4MRI A;  1VQ6 Z;  1TFI A;  1Q86 2;  3CC2 Z;  3CME Z;  2R6M A;  3NFZ A;  3J81 f;  1VQ5 Z;  3I4M I;  2IZ3 A;  2V8K A;  4MH4 A;  5A2Q b;  1TWA I;  1M90 2;  1Y1V I;  1VLA A;  2V8I A;  1NJI 1;  1KRL A;  1YJ9 Z;  1YIT 1;  4NBH A;  1VQN 1;  1X3Z A;  1VQ5 1;  3M3Y I;  4A3C I;  3P5J B;  3CCL Z;  3G71 Z;  3J7A 4;  4E2X A;  1YUK A;  2V8J A;  1RLY A;  1RO2 A;  2OOX B;  5D1O A;  1K8A 2;  3NH4 A;  4QTU A;  1YIJ Z;  2G2K A;  3CC4 Z;  1YHQ 1;  3CXC Z;  2PK7 A;  1VQO 1;  1KQS Z;  1WW9 A;  3CCJ 1;  1VQM Z;  2K3R A;  4BBS I;  1USP A;  3GTP I;  4A3G I;  2J6A A;  2H85 A;  4Y7N I;  1VQL 1;  3ESW A;  4TNU A;  1TWF I;  3GKQ A;  1YJN Z;  2I3C A;  3CCE 1;  2ZAE B;  3PO3 I;  1VQM 1;  3GTQ I;  3U50 C;  4NFR A;  2YU9 I;  3G6E Z;  3CXC Y;  3VMG A;  2KPI A;  3HOY I;  1ZB9 A;  3TE5 B;  2GU2 A;  3GTM I;  2OTL 1;  1QF8 A;  2QRD B;  3G6E 1;  2YAD A;  3JAM f;  1VQK 1;  2LIY A;  5C4X I;  3M4O I;  2QRC B;  2Q51 A;  1VQ7 1;  3HOX I;  1LQL A;  3PO3 S;  3CPW Z;  3J80 b;  5T67 A;  1ZB8 A;  4DK1 A;  3OW2 Z;  1NP6 A;  1WII A;  4DQY B;  4BY7 I;  3CCQ Z;  1YJW Z;  4MON A;  2OOY B;  3RZD I;  3H0G I;  1KD1 2;  2P3Y A;  2F4M A;  2RPR A;  4A3K I;  5A2Q f;  1K9M 1;  3GTM S;  3TDH B;  1RNI A;  2M6N A;  1Q7Y 1;  4NB9 A;  5T64 A;  3CPW Y;  3CCQ 1;  3S2H I;  4BY1 I;  1VQ8 Z;  3I56 Z;  3MON A;  3F3P C;  3VB9 A;  3I07 A;  3HOZ I;  5C3E I;  1N8R 2;  3CCS Z;  2DE7 A;  3RZO I;  2QKD A;  5C4J I;  1QVF Z;  3S17 I;  4HH4 A;  3F3F C;  3I56 1;  3D9X A;  4E2Z A;  4AYB A;  3CCU Z;  3QWU A;  2Y0S A;  1QYP A;  1RO4 A;  3CCS 1;  4NBD A;  4NBF A;  3S1Q I;  1VQ6 1;  3NH8 A;  2O4H A;  3HOU I;  4E31 A;  4A3I I;  3GTK I;  4NBC A;  2E9H A;  4RVF A;  5IP7 I;  3CC2 1;  2OTJ Z;  1QVF Y;  3CME 1;  4A3B I;  5IP9 I;  1R9T I;  1K73 1;  1X3W A;  1Z01 A;  2AKL A;  4E33 A;  3NH5 A;  1NUI A;  4S1T A;  1YJ9 1;  1VQ4 Z;  4A3M I;  4EWC A;  3S2D I;  2WAQ A;  1Y1V S;  3CCL 1;  3G71 1;  2NVX I;  4NB8 A;  1S7M A;  3CMA Z;  4HGY A;  3VMI A;  1K9M 2;  2QR1 B;  4A3F I;  2JNY A;  1YIJ 1;  1I6H I;  1RO0 A;  1S72 Z;  3J80 f;  3CC4 1;  5FLM I;  5D1P A;  2PMZ A;  4QTT A;  1RQF A;  2JR6 A;  1P9N A;  3GTL I;  5C44 I;  3S1N I;  4NBA A;  3CCM Z;  3I4N I;  5T6B A;  1YJN 1;  2DE5 A;  3BG0 B;  3HKZ A;  2WB1 A;  2JA8 I;  2VUG A;  3G4S Z;  1SFO I;  3K7A I;  3EED A;  3CQZ I;  1NJI 2;  1USP B;  4MD7 A;  2OZK A;  3CC7 Z;  1Z03 A;  1Z02 A;  2E2I I;  4NBB A;  1K73 2;  4A3E I;  4NBE A;  2B63 I;  1I3Q I;  4HGZ A;  2QRE B;  1I50 I;  3LUS A;  5IT9 b;  3I55 Z;  2R7Z I;  1YJW 1;  2E2H I;  1K8A 1;  2RT9 A;  4Y52 I;  3NDI A;  3GTG I;  1KC8 1;  4E2Y A;  4BXX I;  4NOZ A;  3FQM A;  3VMH A;  4RVG A;  3S1M I;  2JMO A;  2QEX Z;  3KIH A;  2JS4 A;  4E2W A;  2QA4 Z;  2O53 A;  1VQ8 1;  5CM2 M;  1ML8 A;  1Q82 1;  3CD6 Z;  3CCV Z;  4X6A I;  3H3V J;  3PO2 I;  1W2B Y;  3Q87 A;  1VQ9 Z;  1QVG Z;  2QA4 1;  2W03 A;  3FQQ A;  1L1O C;  3CD6 1;  3CCU 1;  3CCV 1;  3HOW I;  1YIT Z;  3CCR Z;  1VQP Z;  3MZK B;  1VQ9 1;  1VQN Z;  2RBL A;  4CL1 A;  1DL6 A;  2HU9 A;  1YUA A;  2NVY I;  1QVG Y;  2OTJ 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...