3CCQZ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccqZ00
1N8R1 1M1K1 1VQL1 2OTLZ 1Q822 3G711 1VQM1 3CPWZ 1K732 1KQSZ 3CCJ1 1YI2Z 1YJN1 1QVGY 3CCJZ 1Q7Y2 2QEXZ 3CCMZ 1KC82 1VQMZ 1QVFZ 1VQ6Z 3OW2Y 3CCR1 1VQKZ 3CCSZ 1VQ8Z 1YIJ1 3CCEZ 3CMEZ 3CC4Z 1VQ9Z 1S72Z 3I561 1Q861 3CCE1 3I56Z 3CXCZ 3CC7Z 1K8A1 1VQN1 1VQ81 3CD6Z 1M902 1K9M2 3CXCY 1S721 3CME1 3CCQZ 1VQ61 3CCS1 3CMAZ 1YIT1 1NJI2 1VQ7Z 3OW2Z 1VQO1 1VQ5Z 3I55Z 3G6E1 1KD11 1VQ41 2OTJZ 1VQ51 1YJWZ 1KQSY 1QVFY 2QEX1 2OTL1 2QA4Z 1YITZ 1QVGZ 1K731 3G6EZ 3I551 1VQ4Z 3G4SZ 2OTJ1 1KD12 3CC21 3CPWY 1YJNZ 1VQP1 1VQLZ 1N8R2 1M1K2 3CC2Z 3G4S1 1KC81 1Q811 1K8A2 1W2BZ 3CCUZ 3G71Z 1VQ71 1JJ2Z 1Q821 2QA41 3CMA1 1YJW1 1K9M1 3CCVZ 1YIJZ 1VQOZ 1YJ9Z 1M901 3CCLZ 1VQK1 1YHQ1 3CCRZ 1NJI1 3CCQ1 3CC41 3CC71 1YHQZ 1Q862 3CD61 3CCL1 1Q812 1VQ91 3CCM1 1Q7Y1 1W2BY 1VQPZ 1YI21 1VQNZ 3CCV1 1YJ91 3CCU1 1JJ2Y
chains in the Genus database with same CATH superfamily
1N8R1 1M1K1 2VUMI 4RVGA 3G711 5A2Qb 4Y52I 1WJ2A 1ZH1A 2BJOA 1K732 1TWCI 1YI2Z 3U50C 2R93I 4A3LI 3S15I 3S1QI 1RQFA 1TWFI 3FQQA 2LEXA 1VQMZ 3FKII 2O4HA 1P9NA 1QVFZ 4A3EI 1ZB8A 2Y0SA 4E31A 1Y1VS 2IZ4A 3OW2Y 2J6AA 3CCSZ 2NAPA 1DL6A 4HH4A 3D9XA 3MZLB 1YIJ1 2NVXI 2K5RA 3GTMS 3I561 4EWCA 4NBGA 3I56Z 5D1OB 5IT9b 4MD7A 2VPXA 2IZ3A 1QXFA 3CCQZ 3CCS1 2AYDA 3OW2Z 3I55Z 3G6E1 2JIMA 1YJWZ 2R6MA 1K83I 1I6HI 5LL6f 1SIWA 1YITZ 2JR6A 2JIQA 2GTIA 1K731 3TDHB 4NH1C 2RPRA 2JNYA 2M6NA 1K8A2 3HOWI 3S14I 1Y1WI 2F4OA 3M3YI 2NVQI 4E32A 3NH5A 2OOXB 1YJW1 5FLXb 1M901 1NP6A 1YHQ1 3GTPI 3HOUI 3D6WA 1L1OC 1USPB 3CCQ1 2R92I 3CD61 3NFZA 3CCL1 2AKLA 5C4XI 2V8JA 1VQ91 2K3RA 1YJ91 2WB1A 1I3QI 1VQL1 1Q822 2GTHA 2RT9A 1X3ZA 3CPWZ 2E9HA 4RVHA 1KQSZ 1RO4A 3CCJ1 1QVGY 3CCJZ 4E33A 3J81b 2QEXZ 5CM2M 1KC82 4NBAA 4MD9A 2W03A 3IF8A 4BBRI 4HGZA 2LFUA 5FLMI 4E30A 3CCR1 1VQKZ 4S1TA 2F4MA 5IP9I 5A2Qf 2E2JI 3I4NI 3CMEZ 3K7AI 1Z02A 3CC4Z 3CQZI 1ZB9A 4BBSI 1VQ9Z 1S72Z 2NVTI 2NVYI 4E2WA 3CXCZ 3CD6Z 2QLVB 1VQN1 4BY7I 3I07A 5AN9F 2JIPA 2H85A 1LQLA 1K9M2 5IP7I 4NBEA 2IV2X 1Y8CA 4NBCA 3S2HI 3T4NB 2JA7I 3VB9A 3RZDI 4Y7NI 1NJI2 1VQ5Z 1KD11 2JA5I 4DK1A 2PM9A 4RS4A 3GTQI 2JMOA 2E2HI 3S1NI 3VMGA 2PK7A 2VPYA 3S16I 3G4SZ 4NOZA 1YJNZ 1N8R2 1M1K2 1WZNA 4CL1A 3CC2Z 3PO2I 1KC81 3J81f 3CCUZ 1JJ2Z 4A3KI 4A3II 1Q821 2QA41 3GTKI 3H3VJ 1Z01A 2KPIA 2JIRA 2VF1A 2RHBA 1VQOZ 3P5JB 3GTMI 4NFRA 1YUAA 4X6AI 1NJI1 3MZKB 3CC41 1WIIA 2M48A 1I50I 3CCM1 2V8KA 1AA6A 3ESWA 5T6BA 3J80f 1TWHI 3VMIA 3MONA 2Q4ZA 1FDOA 1USPA 3F3FC 5C44I 2P3YA 2QRCB 1NUIA 1WCMI 2V3VA 4MXUA 1VQM1 1RLYA 4MRIA 3QWUA 2WAQA 3LUSA 1YJN1 1RNIA 3KIHA 4E2YA 2JA8I 3CCMZ 2HF1A 2OZKA 4QTUA 3S1RI 4E2ZA 3BG0B 3F3PC 4NB8A 1VQ6Z 2G2KA 2QKDA 1VQ8Z 3CCEZ 2JS4A 1N2FA 4BY1I 5D1PA 5T67A 1Q861 3S2DI 2EGTA 1K8A1 3CXCY 3J7A4 2DE7A 4AYBA 3EERA 4TNUA 2DE5A 1KRLA 1VQ61 4NBDA 3NDIA 1PFTA 4A3GI 4RVDA 3Q87A 4A3BI 1VQ51 4MD8A 4XX2A 2QREB 2OTL1 2QRDB 3KIFA 4NBHA 3I551 3G6EZ 1KD12 1VQP1 2GU2A 5FLXf 3VMHA 1FDIA 3HOYI 5IT9f 3JAMf 1W2BZ 2E2II 4NBFA 1VQ71 1QYPA 4A3CI 2YU9I 2KI7B 2W04A 3CMA1 2DE6A 4NB9A 3BG1B 3HOVI 3M4OI 1YJ9Z 4BXXI 3NH8A 1VQK1 3NH4A 3CCRZ 5D1OA 1SFOI 2B63I 3CC71 1Q862 2YADA 2OOYB 1Q7Y1 3GTJI 1W2BY 1VQPZ 2ZAEB 1X3WA 5T64A 3CCU1 1JJ2Y 2JUBA 3PO3S 2V8IA 2OTLZ 4DGLA 1YUKA 3TE5B 4A93I 1VLAA 4A3JI 3IR7A 2I3CA 4RV9A 1Q7Y2 4NBBA 3JAMb 1Z03A 2VUGA 1JWHC 1Q16A 3HOZI 2HU9A 3GKQA 2V45A 2QR1B 2JA6I 3HKZA 1TWAI 2P28A 4A3MI 2O53A 4E2XA 1QF8A 3CCE1 3CC7Z 1VQ81 1M902 4MH4A 2Q51A 1S721 1R9TI 2VPZA 3VTNA 3CME1 4A3DI 1WW9A 2RIQA 3PO3I 3CMAZ 1YIT1 3IFUA 2RBLA 1VQ7Z 4DQYB 1VQO1 1RO2A 1VQ41 4HGYA 2OTJZ 1KQSY 1QVFY 2QEX1 3S1MI 2QA4Z 1RO0A 2PMZA 3H0GI 3HOXI 3D2LA 1QVGZ 3I4MI 1VQ4Z 1TFIA 2OTJ1 3GTOI 3CC21 3CPWY 2VPWA 1VQLZ 3FQMA 3G4S1 5C3EI 2LIYA 1Q811 4RVFA 3G71Z 3NDJA 4MONA 3S17I 3GTLI 4QTTA 4A3FI 1ML8A 1K9M1 3CCVZ 1YIJZ 3GCFA 3CCLZ 2JIOA 2R7ZI 1YHQZ 3RZOI 1S7MA 2E7ZA 1Q812 1X0TA 1Y1VI 3IX0A 3EEDA 3GTGI 1TWGI 1YI21 1VQNZ 3J80b 3CCV1 5C4JI
chains in the Genus database with same CATH topology
1N8R1 1M1K1 2VUMI 4RVGA 3G711 5A2Qb 4Y52I 1ZH1A 2BJOA 1K732 1TWCI 1YI2Z 3U50C 2R93I 4A3LI 3S15I 3S1QI 1RQFA 1TWFI 3FQQA 1VQMZ 3FKII 2O4HA 1P9NA 1QVFZ 4A3EI 1ZB8A 2Y0SA 4E31A 1Y1VS 2IZ4A 3OW2Y 2J6AA 3CCSZ 1DL6A 4HH4A 3D9XA 3MZLB 1YIJ1 2NVXI 2K5RA 3GTMS 3I561 4EWCA 4NBGA 3I56Z 5D1OB 5IT9b 4MD7A 2IZ3A 3CCQZ 3CCS1 3OW2Z 3I55Z 3G6E1 1YJWZ 2R6MA 1K83I 1I6HI 5LL6f 1YITZ 2JR6A 2GTIA 1K731 3TDHB 4NH1C 2RPRA 2JNYA 2M6NA 1K8A2 3HOWI 3S14I 1Y1WI 2F4OA 3M3YI 2NVQI 4E32A 3NH5A 2OOXB 1YJW1 5FLXb 1M901 1NP6A 1YHQ1 3GTPI 3HOUI 3D6WA 1L1OC 1USPB 3CCQ1 2R92I 3CD61 3NFZA 3CCL1 2AKLA 5C4XI 2V8JA 1VQ91 2K3RA 1YJ91 2WB1A 1I3QI 1VQL1 1Q822 2GTHA 2RT9A 1X3ZA 3CPWZ 2E9HA 4RVHA 1KQSZ 1RO4A 3CCJ1 1QVGY 3CCJZ 4E33A 3J81b 2QEXZ 5CM2M 1KC82 4NBAA 4MD9A 2W03A 3IF8A 4BBRI 4HGZA 2LFUA 5FLMI 4E30A 3CCR1 1VQKZ 4S1TA 2F4MA 5IP9I 5A2Qf 2E2JI 3I4NI 3CMEZ 3K7AI 1Z02A 3CC4Z 3CQZI 1ZB9A 4BBSI 1VQ9Z 1S72Z 2NVTI 2NVYI 4E2WA 3CXCZ 3CD6Z 2QLVB 1VQN1 4BY7I 3I07A 5AN9F 2H85A 1LQLA 1K9M2 5IP7I 4NBEA 4NBCA 3S2HI 3T4NB 2JA7I 3VB9A 3RZDI 4Y7NI 1NJI2 1VQ5Z 1KD11 2JA5I 4DK1A 2PM9A 4RS4A 3GTQI 2JMOA 2E2HI 3S1NI 3VMGA 2PK7A 3S16I 3G4SZ 4NOZA 1YJNZ 1N8R2 1M1K2 3CC2Z 4CL1A 3PO2I 1KC81 3J81f 3CCUZ 1JJ2Z 4A3KI 4A3II 1Q821 2QA41 3GTKI 3H3VJ 1Z01A 2KPIA 2VF1A 2RHBA 1VQOZ 3P5JB 3GTMI 4NFRA 1YUAA 4X6AI 1NJI1 3MZKB 3CC41 1WIIA 2M48A 1I50I 3CCM1 2V8KA 3ESWA 5T6BA 3J80f 1TWHI 3VMIA 3MONA 2Q4ZA 1USPA 3F3FC 5C44I 2P3YA 2QRCB 1NUIA 1WCMI 4MXUA 1VQM1 1RLYA 4MRIA 3QWUA 2WAQA 3LUSA 1YJN1 1RNIA 3KIHA 4E2YA 2JA8I 3CCMZ 2HF1A 2OZKA 4QTUA 3S1RI 4E2ZA 3BG0B 3F3PC 4NB8A 1VQ6Z 2G2KA 2QKDA 1VQ8Z 3CCEZ 2JS4A 1N2FA 4BY1I 5D1PA 5T67A 1Q861 3S2DI 2EGTA 1K8A1 3CXCY 3J7A4 2DE7A 4AYBA 3EERA 4TNUA 2DE5A 1KRLA 1VQ61 4NBDA 3NDIA 1PFTA 4A3GI 4RVDA 3Q87A 4A3BI 1VQ51 4MD8A 4XX2A 2QREB 2OTL1 2QRDB 3KIFA 4NBHA 3I551 3G6EZ 1KD12 1VQP1 2GU2A 5FLXf 3VMHA 3HOYI 5IT9f 3JAMf 1W2BZ 2E2II 4NBFA 1VQ71 1QYPA 4A3CI 2YU9I 2KI7B 2W04A 3CMA1 2DE6A 4NB9A 3BG1B 3HOVI 3M4OI 1YJ9Z 4BXXI 3NH8A 1VQK1 3NH4A 3CCRZ 5D1OA 1SFOI 2B63I 3CC71 1Q862 2YADA 2OOYB 1Q7Y1 3GTJI 1W2BY 1VQPZ 2ZAEB 1X3WA 5T64A 3CCU1 1JJ2Y 2JUBA 3PO3S 2V8IA 2OTLZ 4DGLA 1YUKA 3TE5B 4A93I 1VLAA 4A3JI 2I3CA 4RV9A 1Q7Y2 4NBBA 3JAMb 1Z03A 2VUGA 1JWHC 3HOZI 2HU9A 3GKQA 2QR1B 2JA6I 3HKZA 1TWAI 2P28A 4A3MI 2O53A 4E2XA 1QF8A 3CCE1 3CC7Z 1VQ81 1M902 4MH4A 2Q51A 1S721 1R9TI 3VTNA 3CME1 4A3DI 1WW9A 2RIQA 3PO3I 3CMAZ 1YIT1 3IFUA 2RBLA 1VQ7Z 4DQYB 1VQO1 1RO2A 1VQ41 4HGYA 2OTJZ 1KQSY 1QVFY 2QEX1 3S1MI 2QA4Z 1RO0A 2PMZA 3H0GI 3HOXI 1QVGZ 3I4MI 1VQ4Z 1TFIA 2OTJ1 3GTOI 3CC21 3CPWY 1VQLZ 3FQMA 3G4S1 5C3EI 2LIYA 1Q811 4RVFA 3G71Z 3NDJA 4MONA 3S17I 3GTLI 4QTTA 4A3FI 1ML8A 1K9M1 3CCVZ 1YIJZ 3GCFA 3CCLZ 2R7ZI 1YHQZ 3RZOI 1S7MA 1Q812 1X0TA 1Y1VI 3IX0A 3EEDA 3GTGI 1TWGI 1YI21 1VQNZ 3J80b 3CCV1 5C4JI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N8R 1;  1M1K 1;  1VQL 1;  2OTL Z;  1Q82 2;  3G71 1;  1VQM 1;  3CPW Z;  1K73 2;  1KQS Z;  3CCJ 1;  1YI2 Z;  1YJN 1;  1QVG Y;  3CCJ Z;  1Q7Y 2;  2QEX Z;  3CCM Z;  1KC8 2;  1VQM Z;  1QVF Z;  1VQ6 Z;  3OW2 Y;  3CCR 1;  1VQK Z;  3CCS Z;  1VQ8 Z;  1YIJ 1;  3CCE Z;  3CME Z;  3CC4 Z;  1VQ9 Z;  1S72 Z;  3I56 1;  1Q86 1;  3CCE 1;  3I56 Z;  3CXC Z;  3CC7 Z;  1K8A 1;  1VQN 1;  1VQ8 1;  3CD6 Z;  1M90 2;  1K9M 2;  3CXC Y;  1S72 1;  3CME 1;  3CCQ Z;  1VQ6 1;  3CCS 1;  3CMA Z;  1YIT 1;  1NJI 2;  1VQ7 Z;  3OW2 Z;  1VQO 1;  1VQ5 Z;  3I55 Z;  3G6E 1;  1KD1 1;  1VQ4 1;  2OTJ Z;  1VQ5 1;  1YJW Z;  1KQS Y;  1QVF Y;  2QEX 1;  2OTL 1;  2QA4 Z;  1YIT Z;  1QVG Z;  1K73 1;  3G6E Z;  3I55 1;  1VQ4 Z;  3G4S Z;  2OTJ 1;  1KD1 2;  3CC2 1;  3CPW Y;  1YJN Z;  1VQP 1;  1VQL Z;  1N8R 2;  1M1K 2;  3CC2 Z;  3G4S 1;  1KC8 1;  1Q81 1;  1K8A 2;  1W2B Z;  3CCU Z;  3G71 Z;  1VQ7 1;  1JJ2 Z;  1Q82 1;  2QA4 1;  3CMA 1;  1YJW 1;  1K9M 1;  3CCV Z;  1YIJ Z;  1VQO Z;  1YJ9 Z;  1M90 1;  3CCL Z;  1VQK 1;  1YHQ 1;  3CCR Z;  1NJI 1;  3CCQ 1;  3CC4 1;  3CC7 1;  1YHQ Z;  1Q86 2;  3CD6 1;  3CCL 1;  1Q81 2;  1VQ9 1;  3CCM 1;  1Q7Y 1;  1W2B Y;  1VQP Z;  1YI2 1;  1VQN Z;  3CCV 1;  1YJ9 1;  3CCU 1;  1JJ2 Y; 
#chains in the Genus database with same CATH topology
 1N8R 1;  1M1K 1;  2VUM I;  4RVG A;  3G71 1;  5A2Q b;  4Y52 I;  1WJ2 A;  1ZH1 A;  2BJO A;  1K73 2;  1TWC I;  1YI2 Z;  3U50 C;  2R93 I;  4A3L I;  3S15 I;  3S1Q I;  1RQF A;  1TWF I;  3FQQ A;  2LEX A;  1VQM Z;  3FKI I;  2O4H A;  1P9N A;  1QVF Z;  4A3E I;  1ZB8 A;  2Y0S A;  4E31 A;  1Y1V S;  2IZ4 A;  3OW2 Y;  2J6A A;  3CCS Z;  2NAP A;  1DL6 A;  4HH4 A;  3D9X A;  3MZL B;  1YIJ 1;  2NVX I;  2K5R A;  3GTM S;  3I56 1;  4EWC A;  4NBG A;  3I56 Z;  5D1O B;  5IT9 b;  4MD7 A;  2VPX A;  2IZ3 A;  1QXF A;  3CCQ Z;  3CCS 1;  2AYD A;  3OW2 Z;  3I55 Z;  3G6E 1;  2JIM A;  1YJW Z;  2R6M A;  1K83 I;  1I6H I;  5LL6 f;  1SIW A;  1YIT Z;  2JR6 A;  2JIQ A;  2GTI A;  1K73 1;  3TDH B;  4NH1 C;  2RPR A;  2JNY A;  2M6N A;  1K8A 2;  3HOW I;  3S14 I;  1Y1W I;  2F4O A;  3M3Y I;  2NVQ I;  4E32 A;  3NH5 A;  2OOX B;  1YJW 1;  5FLX b;  1M90 1;  1NP6 A;  1YHQ 1;  3GTP I;  3HOU I;  3D6W A;  1L1O C;  1USP B;  3CCQ 1;  2R92 I;  3CD6 1;  3NFZ A;  3CCL 1;  2AKL A;  5C4X I;  2V8J A;  1VQ9 1;  2K3R A;  1YJ9 1;  2WB1 A;  1I3Q I;  1VQL 1;  1Q82 2;  2GTH A;  2RT9 A;  1X3Z A;  3CPW Z;  2E9H A;  4RVH A;  1KQS Z;  1RO4 A;  3CCJ 1;  1QVG Y;  3CCJ Z;  4E33 A;  3J81 b;  2QEX Z;  5CM2 M;  1KC8 2;  4NBA A;  4MD9 A;  2W03 A;  3IF8 A;  4BBR I;  4HGZ A;  2LFU A;  5FLM I;  4E30 A;  3CCR 1;  1VQK Z;  4S1T A;  2F4M A;  5IP9 I;  5A2Q f;  2E2J I;  3I4N I;  3CME Z;  3K7A I;  1Z02 A;  3CC4 Z;  3CQZ I;  1ZB9 A;  4BBS I;  1VQ9 Z;  1S72 Z;  2NVT I;  2NVY I;  4E2W A;  3CXC Z;  3CD6 Z;  2QLV B;  1VQN 1;  4BY7 I;  3I07 A;  5AN9 F;  2JIP A;  2H85 A;  1LQL A;  1K9M 2;  5IP7 I;  4NBE A;  2IV2 X;  1Y8C A;  4NBC A;  3S2H I;  3T4N B;  2JA7 I;  3VB9 A;  3RZD I;  4Y7N I;  1NJI 2;  1VQ5 Z;  1KD1 1;  2JA5 I;  4DK1 A;  2PM9 A;  4RS4 A;  3GTQ I;  2JMO A;  2E2H I;  3S1N I;  3VMG A;  2PK7 A;  2VPY A;  3S16 I;  3G4S Z;  4NOZ A;  1YJN Z;  1N8R 2;  1M1K 2;  1WZN A;  4CL1 A;  3CC2 Z;  3PO2 I;  1KC8 1;  3J81 f;  3CCU Z;  1JJ2 Z;  4A3K I;  4A3I I;  1Q82 1;  2QA4 1;  3GTK I;  3H3V J;  1Z01 A;  2KPI A;  2JIR A;  2VF1 A;  2RHB A;  1VQO Z;  3P5J B;  3GTM I;  4NFR A;  1YUA A;  4X6A I;  1NJI 1;  3MZK B;  3CC4 1;  1WII A;  2M48 A;  1I50 I;  3CCM 1;  2V8K A;  1AA6 A;  3ESW A;  5T6B A;  3J80 f;  1TWH I;  3VMI A;  3MON A;  2Q4Z A;  1FDO A;  1USP A;  3F3F C;  5C44 I;  2P3Y A;  2QRC B;  1NUI A;  1WCM I;  2V3V A;  4MXU A;  1VQM 1;  1RLY A;  4MRI A;  3QWU A;  2WAQ A;  3LUS A;  1YJN 1;  1RNI A;  3KIH A;  4E2Y A;  2JA8 I;  3CCM Z;  2HF1 A;  2OZK A;  4QTU A;  3S1R I;  4E2Z A;  3BG0 B;  3F3P C;  4NB8 A;  1VQ6 Z;  2G2K A;  2QKD A;  1VQ8 Z;  3CCE Z;  2JS4 A;  1N2F A;  4BY1 I;  5D1P A;  5T67 A;  1Q86 1;  3S2D I;  2EGT A;  1K8A 1;  3CXC Y;  3J7A 4;  2DE7 A;  4AYB A;  3EER A;  4TNU A;  2DE5 A;  1KRL A;  1VQ6 1;  4NBD A;  3NDI A;  1PFT A;  4A3G I;  4RVD A;  3Q87 A;  4A3B I;  1VQ5 1;  4MD8 A;  4XX2 A;  2QRE B;  2OTL 1;  2QRD B;  3KIF A;  4NBH A;  3I55 1;  3G6E Z;  1KD1 2;  1VQP 1;  2GU2 A;  5FLX f;  3VMH A;  1FDI A;  3HOY I;  5IT9 f;  3JAM f;  1W2B Z;  2E2I I;  4NBF A;  1VQ7 1;  1QYP A;  4A3C I;  2YU9 I;  2KI7 B;  2W04 A;  3CMA 1;  2DE6 A;  4NB9 A;  3BG1 B;  3HOV I;  3M4O I;  1YJ9 Z;  4BXX I;  3NH8 A;  1VQK 1;  3NH4 A;  3CCR Z;  5D1O A;  1SFO I;  2B63 I;  3CC7 1;  1Q86 2;  2YAD A;  2OOY B;  1Q7Y 1;  3GTJ I;  1W2B Y;  1VQP Z;  2ZAE B;  1X3W A;  5T64 A;  3CCU 1;  1JJ2 Y;  2JUB A;  3PO3 S;  2V8I A;  2OTL Z;  4DGL A;  1YUK A;  3TE5 B;  4A93 I;  1VLA A;  4A3J I;  3IR7 A;  2I3C A;  4RV9 A;  1Q7Y 2;  4NBB A;  3JAM b;  1Z03 A;  2VUG A;  1JWH C;  1Q16 A;  3HOZ I;  2HU9 A;  3GKQ A;  2V45 A;  2QR1 B;  2JA6 I;  3HKZ A;  1TWA I;  2P28 A;  4A3M I;  2O53 A;  4E2X A;  1QF8 A;  3CCE 1;  3CC7 Z;  1VQ8 1;  1M90 2;  4MH4 A;  2Q51 A;  1S72 1;  1R9T I;  2VPZ A;  3VTN A;  3CME 1;  4A3D I;  1WW9 A;  2RIQ A;  3PO3 I;  3CMA Z;  1YIT 1;  3IFU A;  2RBL A;  1VQ7 Z;  4DQY B;  1VQO 1;  1RO2 A;  1VQ4 1;  4HGY A;  2OTJ Z;  1KQS Y;  1QVF Y;  2QEX 1;  3S1M I;  2QA4 Z;  1RO0 A;  2PMZ A;  3H0G I;  3HOX I;  3D2L A;  1QVG Z;  3I4M I;  1VQ4 Z;  1TFI A;  2OTJ 1;  3GTO I;  3CC2 1;  3CPW Y;  2VPW A;  1VQL Z;  3FQM A;  3G4S 1;  5C3E I;  2LIY A;  1Q81 1;  4RVF A;  3G71 Z;  3NDJ A;  4MON A;  3S17 I;  3GTL I;  4QTT A;  4A3F I;  1ML8 A;  1K9M 1;  3CCV Z;  1YIJ Z;  3GCF A;  3CCL Z;  2JIO A;  2R7Z I;  1YHQ Z;  3RZO I;  1S7M A;  2E7Z A;  1Q81 2;  1X0T A;  1Y1V I;  3IX0 A;  3EED A;  3GTG I;  1TWG I;  1YI2 1;  1VQN Z;  3J80 b;  3CCV 1;  5C4J I; 
#chains in the Genus database with same CATH homology
 1N8R 1;  1M1K 1;  2VUM I;  4RVG A;  3G71 1;  5A2Q b;  4Y52 I;  1ZH1 A;  2BJO A;  1K73 2;  1TWC I;  1YI2 Z;  3U50 C;  2R93 I;  4A3L I;  3S15 I;  3S1Q I;  1RQF A;  1TWF I;  3FQQ A;  1VQM Z;  3FKI I;  2O4H A;  1P9N A;  1QVF Z;  4A3E I;  1ZB8 A;  2Y0S A;  4E31 A;  1Y1V S;  2IZ4 A;  3OW2 Y;  2J6A A;  3CCS Z;  1DL6 A;  4HH4 A;  3D9X A;  3MZL B;  1YIJ 1;  2NVX I;  2K5R A;  3GTM S;  3I56 1;  4EWC A;  4NBG A;  3I56 Z;  5D1O B;  5IT9 b;  4MD7 A;  2IZ3 A;  3CCQ Z;  3CCS 1;  3OW2 Z;  3I55 Z;  3G6E 1;  1YJW Z;  2R6M A;  1K83 I;  1I6H I;  5LL6 f;  1YIT Z;  2JR6 A;  2GTI A;  1K73 1;  3TDH B;  4NH1 C;  2RPR A;  2JNY A;  2M6N A;  1K8A 2;  3HOW I;  3S14 I;  1Y1W I;  2F4O A;  3M3Y I;  2NVQ I;  4E32 A;  3NH5 A;  2OOX B;  1YJW 1;  5FLX b;  1M90 1;  1NP6 A;  1YHQ 1;  3GTP I;  3HOU I;  3D6W A;  1L1O C;  1USP B;  3CCQ 1;  2R92 I;  3CD6 1;  3NFZ A;  3CCL 1;  2AKL A;  5C4X I;  2V8J A;  1VQ9 1;  2K3R A;  1YJ9 1;  2WB1 A;  1I3Q I;  1VQL 1;  1Q82 2;  2GTH A;  2RT9 A;  1X3Z A;  3CPW Z;  2E9H A;  4RVH A;  1KQS Z;  1RO4 A;  3CCJ 1;  1QVG Y;  3CCJ Z;  4E33 A;  3J81 b;  2QEX Z;  5CM2 M;  1KC8 2;  4NBA A;  4MD9 A;  2W03 A;  3IF8 A;  4BBR I;  4HGZ A;  2LFU A;  5FLM I;  4E30 A;  3CCR 1;  1VQK Z;  4S1T A;  2F4M A;  5IP9 I;  5A2Q f;  2E2J I;  3I4N I;  3CME Z;  3K7A I;  1Z02 A;  3CC4 Z;  3CQZ I;  1ZB9 A;  4BBS I;  1VQ9 Z;  1S72 Z;  2NVT I;  2NVY I;  4E2W A;  3CXC Z;  3CD6 Z;  2QLV B;  1VQN 1;  4BY7 I;  3I07 A;  5AN9 F;  2H85 A;  1LQL A;  1K9M 2;  5IP7 I;  4NBE A;  4NBC A;  3S2H I;  3T4N B;  2JA7 I;  3VB9 A;  3RZD I;  4Y7N I;  1NJI 2;  1VQ5 Z;  1KD1 1;  2JA5 I;  4DK1 A;  2PM9 A;  4RS4 A;  3GTQ I;  2JMO A;  2E2H I;  3S1N I;  3VMG A;  2PK7 A;  3S16 I;  3G4S Z;  4NOZ A;  1YJN Z;  1N8R 2;  1M1K 2;  3CC2 Z;  4CL1 A;  3PO2 I;  1KC8 1;  3J81 f;  3CCU Z;  1JJ2 Z;  4A3K I;  4A3I I;  1Q82 1;  2QA4 1;  3GTK I;  3H3V J;  1Z01 A;  2KPI A;  2VF1 A;  2RHB A;  1VQO Z;  3P5J B;  3GTM I;  4NFR A;  1YUA A;  4X6A I;  1NJI 1;  3MZK B;  3CC4 1;  1WII A;  2M48 A;  1I50 I;  3CCM 1;  2V8K A;  3ESW A;  5T6B A;  3J80 f;  1TWH I;  3VMI A;  3MON A;  2Q4Z A;  1USP A;  3F3F C;  5C44 I;  2P3Y A;  2QRC B;  1NUI A;  1WCM I;  4MXU A;  1VQM 1;  1RLY A;  4MRI A;  3QWU A;  2WAQ A;  3LUS A;  1YJN 1;  1RNI A;  3KIH A;  4E2Y A;  2JA8 I;  3CCM Z;  2HF1 A;  2OZK A;  4QTU A;  3S1R I;  4E2Z A;  3BG0 B;  3F3P C;  4NB8 A;  1VQ6 Z;  2G2K A;  2QKD A;  1VQ8 Z;  3CCE Z;  2JS4 A;  1N2F A;  4BY1 I;  5D1P A;  5T67 A;  1Q86 1;  3S2D I;  2EGT A;  1K8A 1;  3CXC Y;  3J7A 4;  2DE7 A;  4AYB A;  3EER A;  4TNU A;  2DE5 A;  1KRL A;  1VQ6 1;  4NBD A;  3NDI A;  1PFT A;  4A3G I;  4RVD A;  3Q87 A;  4A3B I;  1VQ5 1;  4MD8 A;  4XX2 A;  2QRE B;  2OTL 1;  2QRD B;  3KIF A;  4NBH A;  3I55 1;  3G6E Z;  1KD1 2;  1VQP 1;  2GU2 A;  5FLX f;  3VMH A;  3HOY I;  5IT9 f;  3JAM f;  1W2B Z;  2E2I I;  4NBF A;  1VQ7 1;  1QYP A;  4A3C I;  2YU9 I;  2KI7 B;  2W04 A;  3CMA 1;  2DE6 A;  4NB9 A;  3BG1 B;  3HOV I;  3M4O I;  1YJ9 Z;  4BXX I;  3NH8 A;  1VQK 1;  3NH4 A;  3CCR Z;  5D1O A;  1SFO I;  2B63 I;  3CC7 1;  1Q86 2;  2YAD A;  2OOY B;  1Q7Y 1;  3GTJ I;  1W2B Y;  1VQP Z;  2ZAE B;  1X3W A;  5T64 A;  3CCU 1;  1JJ2 Y;  2JUB A;  3PO3 S;  2V8I A;  2OTL Z;  4DGL A;  1YUK A;  3TE5 B;  4A93 I;  1VLA A;  4A3J I;  2I3C A;  4RV9 A;  1Q7Y 2;  4NBB A;  3JAM b;  1Z03 A;  2VUG A;  1JWH C;  3HOZ I;  2HU9 A;  3GKQ A;  2QR1 B;  2JA6 I;  3HKZ A;  1TWA I;  2P28 A;  4A3M I;  2O53 A;  4E2X A;  1QF8 A;  3CCE 1;  3CC7 Z;  1VQ8 1;  1M90 2;  4MH4 A;  2Q51 A;  1S72 1;  1R9T I;  3VTN A;  3CME 1;  4A3D I;  1WW9 A;  2RIQ A;  3PO3 I;  3CMA Z;  1YIT 1;  3IFU A;  2RBL A;  1VQ7 Z;  4DQY B;  1VQO 1;  1RO2 A;  1VQ4 1;  4HGY A;  2OTJ Z;  1KQS Y;  1QVF Y;  2QEX 1;  3S1M I;  2QA4 Z;  1RO0 A;  2PMZ A;  3H0G I;  3HOX I;  1QVG Z;  3I4M I;  1VQ4 Z;  1TFI A;  2OTJ 1;  3GTO I;  3CC2 1;  3CPW Y;  1VQL Z;  3FQM A;  3G4S 1;  5C3E I;  2LIY A;  1Q81 1;  4RVF A;  3G71 Z;  3NDJ A;  4MON A;  3S17 I;  3GTL I;  4QTT A;  4A3F I;  1ML8 A;  1K9M 1;  3CCV Z;  1YIJ Z;  3GCF A;  3CCL Z;  2R7Z I;  1YHQ Z;  3RZO I;  1S7M A;  1Q81 2;  1X0T A;  1Y1V I;  3IX0 A;  3EED A;  3GTG I;  1TWG I;  1YI2 1;  1VQN Z;  3J80 b;  3CCV 1;  5C4J I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...