1TWFI

Rna polymerase ii complexed with utp at 2.3 a resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
122
structure length
122
Chain Sequence
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
total genus 17
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1twfI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1twfI02
3FKII 3HOYI 2JS4A 3GTJI 2JA7I 2R93I 3H3VJ 4Y52I 5IP7I 4NBAA 1YUAA 3S1RI 1ML8A 4BBRI 3GTLI 1TWFI 4A3II 3K7AI 1DL6A 3EERA 3HOZI 1R9TI 1NUIA 3HOXI 3S2HI 3I4NI 4A3MI 3M3YI 3S17I 3HOUI 3S15I 3S1QI 1L1OC 2R92I 2J6AA 3S1MI 1ZB8A 3HOVI 3D6WA 3ESWA 2PK7A 4NBGA 2E2HI 1USPA 3GTPI 4A3LI 1USPB 1Y1VI 3Q87A 4NB9A 5IP9I 3S14I 4NB8A 4XX2A 3VMGA 1Y1WI 2BJOA 2NVXI 1TWHI 2KPIA 2JNYA 2NVTI 5C4JI 3H0GI 3PO2I 3RZDI 2E2JI 2JR6A 4A3KI 1VLAA 3GTQI 2VUMI 3U50C 4A3DI 4A93I 2R7ZI 3PO3S 2F4OA 2P3YA 4NBEA 1X3ZA 1N2FA 4NOZA 3VMHA 3GTMS 4NBBA 1RO4A 4A3GI 3GTGI 2RBLA 4NBHA 4X6AI 4NBCA 1WW9A 1LQLA 3I07A 1PFTA 4BY1I 2E2II 4QTUA 4A3BI 5C44I 4A3EI 4NBFA 2DE6A 4A3JI 1RLYA 4NBDA 2JA8I 3GTKI 1I50I 1I6HI 2JA6I 2F4MA 3GKQA 3S1NI 3HOWI 3I4MI 3LUSA 1I3QI 2NVYI 1TWAI 4BXXI 1WCMI 3S16I 2K5RA 4QTTA 3VB9A 3PO3I 1ZB9A 3S2DI 1QYPA 2HF1A 5FLMI 2NVQI 2DE5A 4Y7NI 3GTMI 1SFOI 2AKLA 3M4OI 4MH4A 1TWCI 5C3EI 3GTOI 3RZOI 5C4XI 1TFIA 3GCFA 1X3WA 5CM2M 4BBSI 4A3CI 1K83I 2DE7A 2B63I 1TWGI 2JA5I 1Y1VS 3CQZI 4BY7I 3VMIA 4A3FI 2YU9I
chains in the Genus database with same CATH superfamily
3CC2Z 3OW2Y 1JJ2Z 1W2BY 2OTJZ 1YHQ1 1QF8A 2R6MA 1YJ91 5T64A 3K7AI 2J6AA 1ZB8A 2G2KA 1KD12 3GTPI 1USPA 1YIJ1 4E32A 4DGLA 1Y1VI 3Q87A 3S14I 3CCE1 5D1PA 3CCVZ 2JNYA 4AYBA 3NH8A 3MZLB 4A3KI 1Q16A 1VLAA 4RS4A 1VQ7Z 4RV9A 3U50C 1VQ9Z 3G6EZ 2R7ZI 2E7ZA 1QVFZ 3PO3S 4MD9A 3NDIA 3I561 1VQL1 4NBEA 1N2FA 3VMHA 3CXCY 3F3PC 4E31A 1VQMZ 4RVGA 4S1TA 1RO4A 3TDHB 1YI21 4X6AI 2Y0SA 1N8R2 1KRLA 1VQ51 3CC21 5FLXb 1PFTA 2VPWA 4A3BI 2VPXA 4RVDA 3OW2Z 1W2BZ 4NBDA 2JA8I 1Y8CA 3GTKI 1I6HI 2F4MA 3GKQA 2IV2X 4DK1A 1WZNA 5AN9F 1I3QI 4MD7A 3J81f 4E2XA 4CL1A 2RIQA 4NFRA 1M1K1 5FLMI 2V45A 3J80f 2W04A 2AKLA 3M4OI 4MH4A 1TWCI 3MZKB 2QREB 1N8R1 3CCMZ 4HGYA 4A3CI 1Y1VS 1VQ71 2M6NA 4MD8A 1QXFA 1VQ91 2YU9I 3S2DI 3G6E1 2JIMA 2VPYA 3GTJI 3H3VJ 3IF8A 3KIFA 2P28A 3CXCZ 1VQM1 1KC81 4A3II 2WAQA 3EERA 1KQSZ 4EWCA 2GTIA 3HOXI 3NFZA 3M3YI 3HOUI 3S1QI 3D6WA 2PK7A 4E2YA 2JMOA 1VQ5Z 4E33A 3VMGA 3G4SZ 1QVGY 1YJNZ 2KPIA 5C4JI 3PO2I 3CCU1 3RZDI 2E2JI 3BG0B 3CCJZ 1P9NA 2OOXB 2VUMI 4E2WA 4A3DI 1NP6A 4HH4A 5LL6f 3CCR1 1VQKZ 2F4OA 3CC4Z 2P3YA 4NOZA 3CCM1 2JIRA 4NBBA 1YUKA 2RBLA 2RPRA 1M901 4NBCA 1WW9A 1YJWZ 3BG1B 3CD6Z 3I07A 4QTUA 1Q7Y2 2QRCB 2M48A 4RVHA 4NBFA 3S1NI 2V8IA 3IR7A 3HOWI 2V3VA 3I4MI 1VQOZ 2ZAEB 2RT9A 1TWAI 4BXXI 3S16I 1M1K2 4E2ZA 4QTTA 3VB9A 2K3RA 2KI7B 3IFUA 3TE5B 3EEDA 1Q821 5D1OA 2JUBA 2DE5A 1K8A2 3GTMI 2AYDA 2JIOA 3CME1 2QLVB 5C4XI 3G4S1 1YJN1 1QVGZ 5CM2M 1S72Z 3D9XA 2LIYA 3CCLZ 3CCJ1 1K83I 2DE7A 1Q7Y1 3I55Z 1TWGI 2JA5I 4BY7I 4E30A 2OZKA 2QRDB 2E9HA 2JS4A 1KC82 3CCUZ 1VQK1 3CC41 2R93I 5IP7I 4NBAA 1RQFA 1YUAA 3S1RI 3IX0A 1K8A1 1DL6A 2V8KA 3MONA 3CCRZ 1YJW1 1R9TI 3D2LA 3CD61 3S2HI 3I4NI 4A3MI 1Z01A 2EGTA 3S15I 1L1OC 1Q861 1RO0A 1K9M1 1JJ2Y 3S1MI 3HOVI 3ESWA 4NBGA 2E2HI 4A3LI 1USPB 5A2Qf 1S7MA 1VQO1 3JAMf 4NB8A 4NH1C 4XX2A 3J81b 3FQQA 2O4HA 2NVXI 1VQNZ 2GU2A 1NJI1 2NVTI 3H0GI 3J80b 3VTNA 3CMAZ 1VQ61 3NH4A 4A93I 2YADA 2LFUA 1M902 1S721 1VQ8Z 3CCL1 3GTMS 2H85A 3CMEZ 4A3GI 3I551 1YITZ 4MONA 5A2Qb 1Z02A 3CCQZ 1Q811 5C44I 2DE6A 1RLYA 1I50I 2JA6I 1WIIA 1JWHC 2W03A 1Q822 1SIWA 2OOYB 5T67A 2K5RA 4HGZA 2HF1A 3FQMA 2VF1A 4Y7NI 2JIPA 3RZOI 3KIHA 1X3WA 1VQN1 3CCSZ 1WJ2A 4RVFA 3NDJA 3CMA1 3VMIA 4A3FI 4MRIA 3FKII 2VPZA 3HOYI 4DQYB 5FLXf 2JA7I 2I3CA 4Y52I 1VQ4Z 2QEXZ 1VQ81 1VQ6Z 2HU9A 1ML8A 4BBRI 3GTLI 3T4NB 1YIT1 1TWFI 1Q862 1Z03A 3F3FC 1K9M2 3HOZI 3G71Z 1NUIA 2QA4Z 3CCQ1 2Q51A 3CPWY 3S17I 2R92I 3CC7Z 2PM9A 2WB1A 5T6BA 4NB9A 1NJI2 5IP9I 1KD11 1Y1WI 1KQSY 2BJOA 3HKZA 1TWHI 2JR6A 1VQPZ 3J7A4 2OTJ1 2IZ4A 3GTQI 2LEXA 2IZ3A 2OTLZ 3NH5A 1FDOA 1FDIA 5IT9f 1RO2A 1X3ZA 1YHQZ 3CCS1 2RHBA 1YJ9Z 3QWUA 1X0TA 3GTGI 4NBHA 1Q812 2JIQA 1LQLA 3P5JB 1K732 4BY1I 2E2II 1RNIA 2QR1B 2GTHA 4A3EI 3CCV1 1ZH1A 4A3JI 1VQ41 2QEX1 1YIJZ 4MXUA 3LUSA 2NVYI 1WCMI 3CCEZ 3G711 2QA41 3PO3I 1ZB9A 3CPWZ 4TNUA 1QYPA 5IT9b 5D1OB 2NVQI 2O53A 1AA6A 2PMZA 3CC71 2QKDA 2V8JA 1SFOI 3JAMb 5C3EI 3GTOI 1QVFY 1TFIA 3GCFA 2Q4ZA 3I56Z 1VQLZ 2NAPA 4BBSI 1K731 1VQP1 2B63I 3CQZI 1YI2Z 2VUGA 2OTL1
chains in the Genus database with same CATH topology
3CC2Z 3OW2Y 1JJ2Z 1W2BY 2OTJZ 1YHQ1 1QF8A 2R6MA 1YJ91 5T64A 3K7AI 2J6AA 1ZB8A 2G2KA 1KD12 3GTPI 1USPA 1YIJ1 4E32A 4DGLA 1Y1VI 3Q87A 3S14I 3CCE1 5D1PA 3CCVZ 2JNYA 4AYBA 3NH8A 3MZLB 4A3KI 1VLAA 4RS4A 1VQ7Z 4RV9A 3U50C 1VQ9Z 3G6EZ 2R7ZI 1QVFZ 3PO3S 4MD9A 3NDIA 3I561 1VQL1 4NBEA 1N2FA 3VMHA 3CXCY 3F3PC 4E31A 1VQMZ 4RVGA 4S1TA 1RO4A 3TDHB 1YI21 4X6AI 2Y0SA 1N8R2 1KRLA 1VQ51 3CC21 5FLXb 1PFTA 4A3BI 4RVDA 3OW2Z 1W2BZ 4NBDA 2JA8I 3GTKI 1I6HI 2F4MA 3GKQA 4DK1A 5AN9F 1I3QI 4MD7A 3J81f 4E2XA 4CL1A 2RIQA 4NFRA 1M1K1 5FLMI 3J80f 2W04A 2AKLA 3M4OI 4MH4A 1TWCI 3MZKB 2QREB 1N8R1 3CCMZ 4HGYA 4A3CI 1Y1VS 1VQ71 2M6NA 4MD8A 1VQ91 2YU9I 3S2DI 3G6E1 3GTJI 3H3VJ 3IF8A 3KIFA 2P28A 3CXCZ 1VQM1 1KC81 4A3II 2WAQA 3EERA 1KQSZ 4EWCA 2GTIA 3HOXI 3NFZA 3M3YI 3HOUI 3S1QI 3D6WA 2PK7A 4E2YA 2JMOA 1VQ5Z 4E33A 3VMGA 3G4SZ 1QVGY 1YJNZ 2KPIA 5C4JI 3PO2I 3CCU1 3RZDI 2E2JI 3BG0B 3CCJZ 1P9NA 2OOXB 2VUMI 4E2WA 4A3DI 1NP6A 4HH4A 5LL6f 3CCR1 1VQKZ 2F4OA 3CC4Z 2P3YA 4NOZA 3CCM1 4NBBA 1YUKA 2RBLA 2RPRA 1M901 4NBCA 1WW9A 1YJWZ 3BG1B 3CD6Z 3I07A 4QTUA 1Q7Y2 2QRCB 2M48A 4RVHA 4NBFA 3S1NI 2V8IA 3HOWI 3I4MI 1VQOZ 2ZAEB 2RT9A 1TWAI 4BXXI 3S16I 1M1K2 4E2ZA 4QTTA 3VB9A 2K3RA 2KI7B 3IFUA 3TE5B 3EEDA 1Q821 5D1OA 2JUBA 2DE5A 1K8A2 3GTMI 3CME1 2QLVB 5C4XI 3G4S1 1YJN1 1QVGZ 5CM2M 1S72Z 3D9XA 2LIYA 3CCLZ 3CCJ1 1K83I 2DE7A 1Q7Y1 3I55Z 1TWGI 2JA5I 4BY7I 4E30A 2OZKA 2QRDB 2E9HA 2JS4A 1KC82 3CCUZ 1VQK1 3CC41 2R93I 5IP7I 4NBAA 1RQFA 1YUAA 3S1RI 3IX0A 1K8A1 1DL6A 2V8KA 3MONA 3CCRZ 1YJW1 1R9TI 3CD61 3S2HI 3I4NI 4A3MI 1Z01A 2EGTA 3S15I 1L1OC 1Q861 1RO0A 1K9M1 1JJ2Y 3S1MI 3HOVI 3ESWA 4NBGA 2E2HI 4A3LI 1USPB 5A2Qf 1S7MA 1VQO1 3JAMf 4NB8A 4NH1C 4XX2A 3J81b 3FQQA 2O4HA 2NVXI 1VQNZ 2GU2A 1NJI1 2NVTI 3H0GI 3J80b 3VTNA 3CMAZ 1VQ61 3NH4A 4A93I 2YADA 2LFUA 1M902 1S721 1VQ8Z 3CCL1 3GTMS 2H85A 3CMEZ 4A3GI 3I551 1YITZ 4MONA 5A2Qb 1Z02A 3CCQZ 1Q811 5C44I 2DE6A 1RLYA 1I50I 2JA6I 1WIIA 1JWHC 2W03A 1Q822 2OOYB 5T67A 2K5RA 4HGZA 2HF1A 3FQMA 2VF1A 4Y7NI 3RZOI 3KIHA 1X3WA 1VQN1 3CCSZ 4RVFA 3NDJA 3CMA1 3VMIA 4A3FI 4MRIA 3FKII 3HOYI 4DQYB 5FLXf 2JA7I 2I3CA 4Y52I 1VQ4Z 2QEXZ 1VQ81 1VQ6Z 2HU9A 1ML8A 4BBRI 3GTLI 3T4NB 1YIT1 1TWFI 1Q862 1Z03A 3F3FC 1K9M2 3HOZI 3G71Z 1NUIA 2QA4Z 3CCQ1 2Q51A 3CPWY 3S17I 2R92I 3CC7Z 2PM9A 2WB1A 5T6BA 4NB9A 1NJI2 5IP9I 1KD11 1Y1WI 1KQSY 2BJOA 3HKZA 1TWHI 2JR6A 1VQPZ 3J7A4 2OTJ1 2IZ4A 3GTQI 2IZ3A 2OTLZ 3NH5A 5IT9f 1RO2A 1X3ZA 1YHQZ 3CCS1 2RHBA 1YJ9Z 3QWUA 1X0TA 3GTGI 4NBHA 1Q812 1LQLA 3P5JB 1K732 4BY1I 2E2II 1RNIA 2QR1B 2GTHA 4A3EI 3CCV1 1ZH1A 4A3JI 1VQ41 2QEX1 1YIJZ 4MXUA 3LUSA 2NVYI 1WCMI 3CCEZ 3G711 2QA41 3PO3I 1ZB9A 3CPWZ 4TNUA 1QYPA 5IT9b 5D1OB 2NVQI 2O53A 3CC71 2PMZA 2QKDA 2V8JA 1SFOI 3JAMb 5C3EI 3GTOI 1QVFY 1TFIA 3GCFA 2Q4ZA 3I56Z 1VQLZ 4BBSI 1K731 1VQP1 2B63I 3CQZI 1YI2Z 2VUGA 2OTL1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FKI I;  3HOY I;  2JS4 A;  3GTJ I;  2JA7 I;  2R93 I;  3H3V J;  4Y52 I;  5IP7 I;  4NBA A;  1YUA A;  3S1R I;  1ML8 A;  4BBR I;  3GTL I;  1TWF I;  4A3I I;  3K7A I;  1DL6 A;  3EER A;  3HOZ I;  1R9T I;  1NUI A;  3HOX I;  3S2H I;  3I4N I;  4A3M I;  3M3Y I;  3S17 I;  3HOU I;  3S15 I;  3S1Q I;  1L1O C;  2R92 I;  2J6A A;  3S1M I;  1ZB8 A;  3HOV I;  3D6W A;  3ESW A;  2PK7 A;  4NBG A;  2E2H I;  1USP A;  3GTP I;  4A3L I;  1USP B;  1Y1V I;  3Q87 A;  4NB9 A;  5IP9 I;  3S14 I;  4NB8 A;  4XX2 A;  3VMG A;  1Y1W I;  2BJO A;  2NVX I;  1TWH I;  2KPI A;  2JNY A;  2NVT I;  5C4J I;  3H0G I;  3PO2 I;  3RZD I;  2E2J I;  2JR6 A;  4A3K I;  1VLA A;  3GTQ I;  2VUM I;  3U50 C;  4A3D I;  4A93 I;  2R7Z I;  3PO3 S;  2F4O A;  2P3Y A;  4NBE A;  1X3Z A;  1N2F A;  4NOZ A;  3VMH A;  3GTM S;  4NBB A;  1RO4 A;  4A3G I;  3GTG I;  2RBL A;  4NBH A;  4X6A I;  4NBC A;  1WW9 A;  1LQL A;  3I07 A;  1PFT A;  4BY1 I;  2E2I I;  4QTU A;  4A3B I;  5C44 I;  4A3E I;  4NBF A;  2DE6 A;  4A3J I;  1RLY A;  4NBD A;  2JA8 I;  3GTK I;  1I50 I;  1I6H I;  2JA6 I;  2F4M A;  3GKQ A;  3S1N I;  3HOW I;  3I4M I;  3LUS A;  1I3Q I;  2NVY I;  1TWA I;  4BXX I;  1WCM I;  3S16 I;  2K5R A;  4QTT A;  3VB9 A;  3PO3 I;  1ZB9 A;  3S2D I;  1QYP A;  2HF1 A;  5FLM I;  2NVQ I;  2DE5 A;  4Y7N I;  3GTM I;  1SFO I;  2AKL A;  3M4O I;  4MH4 A;  1TWC I;  5C3E I;  3GTO I;  3RZO I;  5C4X I;  1TFI A;  3GCF A;  1X3W A;  5CM2 M;  4BBS I;  4A3C I;  1K83 I;  2DE7 A;  2B63 I;  1TWG I;  2JA5 I;  1Y1V S;  3CQZ I;  4BY7 I;  3VMI A;  4A3F I;  2YU9 I; 
#chains in the Genus database with same CATH topology
 3CC2 Z;  3OW2 Y;  1JJ2 Z;  1W2B Y;  2OTJ Z;  1YHQ 1;  1QF8 A;  2R6M A;  1YJ9 1;  5T64 A;  3K7A I;  2J6A A;  1ZB8 A;  2G2K A;  1KD1 2;  3GTP I;  1USP A;  1YIJ 1;  4E32 A;  4DGL A;  1Y1V I;  3Q87 A;  3S14 I;  3CCE 1;  5D1P A;  3CCV Z;  2JNY A;  4AYB A;  3NH8 A;  3MZL B;  4A3K I;  1Q16 A;  1VLA A;  4RS4 A;  1VQ7 Z;  4RV9 A;  3U50 C;  1VQ9 Z;  3G6E Z;  2R7Z I;  2E7Z A;  1QVF Z;  3PO3 S;  4MD9 A;  3NDI A;  3I56 1;  1VQL 1;  4NBE A;  1N2F A;  3VMH A;  3CXC Y;  3F3P C;  4E31 A;  1VQM Z;  4RVG A;  4S1T A;  1RO4 A;  3TDH B;  1YI2 1;  4X6A I;  2Y0S A;  1N8R 2;  1KRL A;  1VQ5 1;  3CC2 1;  5FLX b;  1PFT A;  2VPW A;  4A3B I;  2VPX A;  4RVD A;  3OW2 Z;  1W2B Z;  4NBD A;  2JA8 I;  1Y8C A;  3GTK I;  1I6H I;  2F4M A;  3GKQ A;  2IV2 X;  4DK1 A;  1WZN A;  5AN9 F;  1I3Q I;  4MD7 A;  3J81 f;  4E2X A;  4CL1 A;  2RIQ A;  4NFR A;  1M1K 1;  5FLM I;  2V45 A;  3J80 f;  2W04 A;  2AKL A;  3M4O I;  4MH4 A;  1TWC I;  3MZK B;  2QRE B;  1N8R 1;  3CCM Z;  4HGY A;  4A3C I;  1Y1V S;  1VQ7 1;  2M6N A;  4MD8 A;  1QXF A;  1VQ9 1;  2YU9 I;  3S2D I;  3G6E 1;  2JIM A;  2VPY A;  3GTJ I;  3H3V J;  3IF8 A;  3KIF A;  2P28 A;  3CXC Z;  1VQM 1;  1KC8 1;  4A3I I;  2WAQ A;  3EER A;  1KQS Z;  4EWC A;  2GTI A;  3HOX I;  3NFZ A;  3M3Y I;  3HOU I;  3S1Q I;  3D6W A;  2PK7 A;  4E2Y A;  2JMO A;  1VQ5 Z;  4E33 A;  3VMG A;  3G4S Z;  1QVG Y;  1YJN Z;  2KPI A;  5C4J I;  3PO2 I;  3CCU 1;  3RZD I;  2E2J I;  3BG0 B;  3CCJ Z;  1P9N A;  2OOX B;  2VUM I;  4E2W A;  4A3D I;  1NP6 A;  4HH4 A;  5LL6 f;  3CCR 1;  1VQK Z;  2F4O A;  3CC4 Z;  2P3Y A;  4NOZ A;  3CCM 1;  2JIR A;  4NBB A;  1YUK A;  2RBL A;  2RPR A;  1M90 1;  4NBC A;  1WW9 A;  1YJW Z;  3BG1 B;  3CD6 Z;  3I07 A;  4QTU A;  1Q7Y 2;  2QRC B;  2M48 A;  4RVH A;  4NBF A;  3S1N I;  2V8I A;  3IR7 A;  3HOW I;  2V3V A;  3I4M I;  1VQO Z;  2ZAE B;  2RT9 A;  1TWA I;  4BXX I;  3S16 I;  1M1K 2;  4E2Z A;  4QTT A;  3VB9 A;  2K3R A;  2KI7 B;  3IFU A;  3TE5 B;  3EED A;  1Q82 1;  5D1O A;  2JUB A;  2DE5 A;  1K8A 2;  3GTM I;  2AYD A;  2JIO A;  3CME 1;  2QLV B;  5C4X I;  3G4S 1;  1YJN 1;  1QVG Z;  5CM2 M;  1S72 Z;  3D9X A;  2LIY A;  3CCL Z;  3CCJ 1;  1K83 I;  2DE7 A;  1Q7Y 1;  3I55 Z;  1TWG I;  2JA5 I;  4BY7 I;  4E30 A;  2OZK A;  2QRD B;  2E9H A;  2JS4 A;  1KC8 2;  3CCU Z;  1VQK 1;  3CC4 1;  2R93 I;  5IP7 I;  4NBA A;  1RQF A;  1YUA A;  3S1R I;  3IX0 A;  1K8A 1;  1DL6 A;  2V8K A;  3MON A;  3CCR Z;  1YJW 1;  1R9T I;  3D2L A;  3CD6 1;  3S2H I;  3I4N I;  4A3M I;  1Z01 A;  2EGT A;  3S15 I;  1L1O C;  1Q86 1;  1RO0 A;  1K9M 1;  1JJ2 Y;  3S1M I;  3HOV I;  3ESW A;  4NBG A;  2E2H I;  4A3L I;  1USP B;  5A2Q f;  1S7M A;  1VQO 1;  3JAM f;  4NB8 A;  4NH1 C;  4XX2 A;  3J81 b;  3FQQ A;  2O4H A;  2NVX I;  1VQN Z;  2GU2 A;  1NJI 1;  2NVT I;  3H0G I;  3J80 b;  3VTN A;  3CMA Z;  1VQ6 1;  3NH4 A;  4A93 I;  2YAD A;  2LFU A;  1M90 2;  1S72 1;  1VQ8 Z;  3CCL 1;  3GTM S;  2H85 A;  3CME Z;  4A3G I;  3I55 1;  1YIT Z;  4MON A;  5A2Q b;  1Z02 A;  3CCQ Z;  1Q81 1;  5C44 I;  2DE6 A;  1RLY A;  1I50 I;  2JA6 I;  1WII A;  1JWH C;  2W03 A;  1Q82 2;  1SIW A;  2OOY B;  5T67 A;  2K5R A;  4HGZ A;  2HF1 A;  3FQM A;  2VF1 A;  4Y7N I;  2JIP A;  3RZO I;  3KIH A;  1X3W A;  1VQN 1;  3CCS Z;  1WJ2 A;  4RVF A;  3NDJ A;  3CMA 1;  3VMI A;  4A3F I;  4MRI A;  3FKI I;  2VPZ A;  3HOY I;  4DQY B;  5FLX f;  2JA7 I;  2I3C A;  4Y52 I;  1VQ4 Z;  2QEX Z;  1VQ8 1;  1VQ6 Z;  2HU9 A;  1ML8 A;  4BBR I;  3GTL I;  3T4N B;  1YIT 1;  1TWF I;  1Q86 2;  1Z03 A;  3F3F C;  1K9M 2;  3HOZ I;  3G71 Z;  1NUI A;  2QA4 Z;  3CCQ 1;  2Q51 A;  3CPW Y;  3S17 I;  2R92 I;  3CC7 Z;  2PM9 A;  2WB1 A;  5T6B A;  4NB9 A;  1NJI 2;  5IP9 I;  1KD1 1;  1Y1W I;  1KQS Y;  2BJO A;  3HKZ A;  1TWH I;  2JR6 A;  1VQP Z;  3J7A 4;  2OTJ 1;  2IZ4 A;  3GTQ I;  2LEX A;  2IZ3 A;  2OTL Z;  3NH5 A;  1FDO A;  1FDI A;  5IT9 f;  1RO2 A;  1X3Z A;  1YHQ Z;  3CCS 1;  2RHB A;  1YJ9 Z;  3QWU A;  1X0T A;  3GTG I;  4NBH A;  1Q81 2;  2JIQ A;  1LQL A;  3P5J B;  1K73 2;  4BY1 I;  2E2I I;  1RNI A;  2QR1 B;  2GTH A;  4A3E I;  3CCV 1;  1ZH1 A;  4A3J I;  1VQ4 1;  2QEX 1;  1YIJ Z;  4MXU A;  3LUS A;  2NVY I;  1WCM I;  3CCE Z;  3G71 1;  2QA4 1;  3PO3 I;  1ZB9 A;  3CPW Z;  4TNU A;  1QYP A;  5IT9 b;  5D1O B;  2NVQ I;  2O53 A;  1AA6 A;  2PMZ A;  3CC7 1;  2QKD A;  2V8J A;  1SFO I;  3JAM b;  5C3E I;  3GTO I;  1QVF Y;  1TFI A;  3GCF A;  2Q4Z A;  3I56 Z;  1VQL Z;  2NAP A;  4BBS I;  1K73 1;  1VQP 1;  2B63 I;  3CQZ I;  1YI2 Z;  2VUG A;  2OTL 1; 
#chains in the Genus database with same CATH homology
 3CC2 Z;  3OW2 Y;  1JJ2 Z;  1W2B Y;  2OTJ Z;  1YHQ 1;  1QF8 A;  2R6M A;  1YJ9 1;  5T64 A;  3K7A I;  2J6A A;  1ZB8 A;  2G2K A;  1KD1 2;  3GTP I;  1USP A;  1YIJ 1;  4E32 A;  4DGL A;  1Y1V I;  3Q87 A;  3S14 I;  3CCE 1;  5D1P A;  3CCV Z;  2JNY A;  4AYB A;  3NH8 A;  3MZL B;  4A3K I;  1VLA A;  4RS4 A;  1VQ7 Z;  4RV9 A;  3U50 C;  1VQ9 Z;  3G6E Z;  2R7Z I;  1QVF Z;  3PO3 S;  4MD9 A;  3NDI A;  3I56 1;  1VQL 1;  4NBE A;  1N2F A;  3VMH A;  3CXC Y;  3F3P C;  4E31 A;  1VQM Z;  4RVG A;  4S1T A;  1RO4 A;  3TDH B;  1YI2 1;  4X6A I;  2Y0S A;  1N8R 2;  1KRL A;  1VQ5 1;  3CC2 1;  5FLX b;  1PFT A;  4A3B I;  4RVD A;  3OW2 Z;  1W2B Z;  4NBD A;  2JA8 I;  3GTK I;  1I6H I;  2F4M A;  3GKQ A;  4DK1 A;  5AN9 F;  1I3Q I;  4MD7 A;  3J81 f;  4E2X A;  4CL1 A;  2RIQ A;  4NFR A;  1M1K 1;  5FLM I;  3J80 f;  2W04 A;  2AKL A;  3M4O I;  4MH4 A;  1TWC I;  3MZK B;  2QRE B;  1N8R 1;  3CCM Z;  4HGY A;  4A3C I;  1Y1V S;  1VQ7 1;  2M6N A;  4MD8 A;  1VQ9 1;  2YU9 I;  3S2D I;  3G6E 1;  3GTJ I;  3H3V J;  3IF8 A;  3KIF A;  2P28 A;  3CXC Z;  1VQM 1;  1KC8 1;  4A3I I;  2WAQ A;  3EER A;  1KQS Z;  4EWC A;  2GTI A;  3HOX I;  3NFZ A;  3M3Y I;  3HOU I;  3S1Q I;  3D6W A;  2PK7 A;  4E2Y A;  2JMO A;  1VQ5 Z;  4E33 A;  3VMG A;  3G4S Z;  1QVG Y;  1YJN Z;  2KPI A;  5C4J I;  3PO2 I;  3CCU 1;  3RZD I;  2E2J I;  3BG0 B;  3CCJ Z;  1P9N A;  2OOX B;  2VUM I;  4E2W A;  4A3D I;  1NP6 A;  4HH4 A;  5LL6 f;  3CCR 1;  1VQK Z;  2F4O A;  3CC4 Z;  2P3Y A;  4NOZ A;  3CCM 1;  4NBB A;  1YUK A;  2RBL A;  2RPR A;  1M90 1;  4NBC A;  1WW9 A;  1YJW Z;  3BG1 B;  3CD6 Z;  3I07 A;  4QTU A;  1Q7Y 2;  2QRC B;  2M48 A;  4RVH A;  4NBF A;  3S1N I;  2V8I A;  3HOW I;  3I4M I;  1VQO Z;  2ZAE B;  2RT9 A;  1TWA I;  4BXX I;  3S16 I;  1M1K 2;  4E2Z A;  4QTT A;  3VB9 A;  2K3R A;  2KI7 B;  3IFU A;  3TE5 B;  3EED A;  1Q82 1;  5D1O A;  2JUB A;  2DE5 A;  1K8A 2;  3GTM I;  3CME 1;  2QLV B;  5C4X I;  3G4S 1;  1YJN 1;  1QVG Z;  5CM2 M;  1S72 Z;  3D9X A;  2LIY A;  3CCL Z;  3CCJ 1;  1K83 I;  2DE7 A;  1Q7Y 1;  3I55 Z;  1TWG I;  2JA5 I;  4BY7 I;  4E30 A;  2OZK A;  2QRD B;  2E9H A;  2JS4 A;  1KC8 2;  3CCU Z;  1VQK 1;  3CC4 1;  2R93 I;  5IP7 I;  4NBA A;  1RQF A;  1YUA A;  3S1R I;  3IX0 A;  1K8A 1;  1DL6 A;  2V8K A;  3MON A;  3CCR Z;  1YJW 1;  1R9T I;  3CD6 1;  3S2H I;  3I4N I;  4A3M I;  1Z01 A;  2EGT A;  3S15 I;  1L1O C;  1Q86 1;  1RO0 A;  1K9M 1;  1JJ2 Y;  3S1M I;  3HOV I;  3ESW A;  4NBG A;  2E2H I;  4A3L I;  1USP B;  5A2Q f;  1S7M A;  1VQO 1;  3JAM f;  4NB8 A;  4NH1 C;  4XX2 A;  3J81 b;  3FQQ A;  2O4H A;  2NVX I;  1VQN Z;  2GU2 A;  1NJI 1;  2NVT I;  3H0G I;  3J80 b;  3VTN A;  3CMA Z;  1VQ6 1;  3NH4 A;  4A93 I;  2YAD A;  2LFU A;  1M90 2;  1S72 1;  1VQ8 Z;  3CCL 1;  3GTM S;  2H85 A;  3CME Z;  4A3G I;  3I55 1;  1YIT Z;  4MON A;  5A2Q b;  1Z02 A;  3CCQ Z;  1Q81 1;  5C44 I;  2DE6 A;  1RLY A;  1I50 I;  2JA6 I;  1WII A;  1JWH C;  2W03 A;  1Q82 2;  2OOY B;  5T67 A;  2K5R A;  4HGZ A;  2HF1 A;  3FQM A;  2VF1 A;  4Y7N I;  3RZO I;  3KIH A;  1X3W A;  1VQN 1;  3CCS Z;  4RVF A;  3NDJ A;  3CMA 1;  3VMI A;  4A3F I;  4MRI A;  3FKI I;  3HOY I;  4DQY B;  5FLX f;  2JA7 I;  2I3C A;  4Y52 I;  1VQ4 Z;  2QEX Z;  1VQ8 1;  1VQ6 Z;  2HU9 A;  1ML8 A;  4BBR I;  3GTL I;  3T4N B;  1YIT 1;  1TWF I;  1Q86 2;  1Z03 A;  3F3F C;  1K9M 2;  3HOZ I;  3G71 Z;  1NUI A;  2QA4 Z;  3CCQ 1;  2Q51 A;  3CPW Y;  3S17 I;  2R92 I;  3CC7 Z;  2PM9 A;  2WB1 A;  5T6B A;  4NB9 A;  1NJI 2;  5IP9 I;  1KD1 1;  1Y1W I;  1KQS Y;  2BJO A;  3HKZ A;  1TWH I;  2JR6 A;  1VQP Z;  3J7A 4;  2OTJ 1;  2IZ4 A;  3GTQ I;  2IZ3 A;  2OTL Z;  3NH5 A;  5IT9 f;  1RO2 A;  1X3Z A;  1YHQ Z;  3CCS 1;  2RHB A;  1YJ9 Z;  3QWU A;  1X0T A;  3GTG I;  4NBH A;  1Q81 2;  1LQL A;  3P5J B;  1K73 2;  4BY1 I;  2E2I I;  1RNI A;  2QR1 B;  2GTH A;  4A3E I;  3CCV 1;  1ZH1 A;  4A3J I;  1VQ4 1;  2QEX 1;  1YIJ Z;  4MXU A;  3LUS A;  2NVY I;  1WCM I;  3CCE Z;  3G71 1;  2QA4 1;  3PO3 I;  1ZB9 A;  3CPW Z;  4TNU A;  1QYP A;  5IT9 b;  5D1O B;  2NVQ I;  2O53 A;  3CC7 1;  2PMZ A;  2QKD A;  2V8J A;  1SFO I;  3JAM b;  5C3E I;  3GTO I;  1QVF Y;  1TFI A;  3GCF A;  2Q4Z A;  3I56 Z;  1VQL Z;  4BBS I;  1K73 1;  1VQP 1;  2B63 I;  3CQZ I;  1YI2 Z;  2VUG A;  2OTL 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...