1TWFI

Rna polymerase ii complexed with utp at 2.3 a resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
122
structure length
122
Chain Sequence
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
total genus 17
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1twfI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1twfI02
3GTGI 4BBSI 2JA6I 2R92I 1DL6A 2NVYI 4NBDA 2NVTI 3I4MI 4A3CI 4A3LI 4X6AI 1I50I 3Q87A 4XX2A 2HF1A 2E2HI 1X3ZA 4A3KI 1TWGI 3GTMI 3GTLI 1TFIA 3PO3I 4NB8A 3S2DI 1I6HI 3S1QI 3S2HI 4QTUA 4BXXI 3GTQI 1SFOI 1RLYA 2PK7A 4NBGA 3FKII 5C4XI 1ML8A 2YU9I 2E2II 1TWFI 4A3FI 3HOZI 2B63I 3GCFA 4BBRI 2E2JI 2JA7I 1K83I 1ZB9A 4A3MI 3S14I 2K5RA 1TWAI 5IP9I 1L1OC 2JS4A 1Y1WI 1LQLA 1R9TI 1WW9A 2NVXI 3K7AI 3S1NI 5C44I 4NBFA 3S15I 2R7ZI 4A3DI 2JA8I 1YUAA 4NB9A 1TWHI 4A3GI 3HOYI 3HOUI 3VMGA 4BY1I 4A3BI 4QTTA 3S1MI 3HOWI 3S16I 1I3QI 3H3VJ 2RBLA 2DE6A 2BJOA 3HOXI 4NBHA 4A3JI 4Y52I 3S1RI 4NOZA 5IP7I 1WCMI 3ESWA 1VLAA 2JR6A 4A3II 3LUSA 2R93I 4NBEA 3GTKI 5CM2M 2JNYA 1NUIA 2DE5A 3U50C 2F4MA 3VMIA 3HOVI 3GKQA 4Y7NI 3GTJI 2JA5I 3VB9A 3S17I 1ZB8A 1USPB 2KPIA 2P3YA 3CQZI 2VUMI 5C4JI 1TWCI 4NBCA 3GTOI 1RO4A 2AKLA 5C3EI 2DE7A 3M3YI 3GTMS 3M4OI 3H0GI 4A3EI 3PO2I 3PO3S 1N2FA 3I07A 3RZOI 4BY7I 1QYPA 3D6WA 2NVQI 1USPA 3RZDI 5FLMI 3GTPI 4NBBA 1Y1VS 2F4OA 1PFTA 1Y1VI 2J6AA 4MH4A 3VMHA 4A93I 1X3WA 3I4NI 4NBAA 3EERA
chains in the Genus database with same CATH superfamily
2VUGA 4E2YA 4BBSI 3CMA1 1DL6A 3Q87A 2QR1B 4E2ZA 2HF1A 3CCLZ 1KQSZ 1VQKZ 2RPRA 2VF1A 3G71Z 1NJI1 3JAMb 2QLVB 2O4HA 2W04A 1SFOI 5C4XI 2PK7A 1VQ8Z 2EGTA 2V45A 2I3CA 3HOZI 2W03A 4BBRI 2V8JA 1QXFA 1ZB9A 2K5RA 5IP9I 2JS4A 1YIJ1 2V8KA 1R9TI 1M901 5C44I 3CC4Z 2GU2A 2R7ZI 1YJN1 1SIWA 1YI21 4QTTA 3S16I 1Q16A 2JUBA 1Z02A 4A3JI 4NOZA 2IZ3A 1VLAA 2K3RA 1K9M1 3LUSA 3CCMZ 3F3PC 2JIOA 1S7MA 1KRLA 1K732 1WJ2A 1JJ2Y 2F4MA 3VMIA 2RT9A 3GKQA 1NP6A 5T64A 3JAMf 4EWCA 3CCQ1 3CD61 5D1PA 5LL6f 1RQFA 3CQZI 1VQMZ 3D2LA 1VQNZ 1NJI2 1K8A1 4RV9A 2M6NA 3EEDA 4E31A 1QVGY 3T4NB 3J80f 2OOXB 3GTMS 3CCRZ 3H0GI 1N2FA 1YJ91 3CME1 4BY7I 1QYPA 1USPA 3CCJ1 1Y1VI 3VTNA 1VQP1 4A93I 3NH8A 4MD8A 1FDIA 1M902 3IFUA 3EERA 4NBDA 1AA6A 2NVTI 4X6AI 1I50I 4XX2A 2IV2X 5A2Qb 2QEX1 4TNUA 4A3KI 3OW2Y 1TFIA 3CPWY 3PO3I 3NFZA 3S2DI 4RVGA 1VQ9Z 3I561 4BXXI 4NBGA 3FKII 4HGYA 5T67A 1ML8A 4CL1A 1QVFZ 2OTL1 2QA41 2E2II 1K731 1KD11 2B63I 1RO2A 4RVHA 2Q4ZA 4A3MI 3S14I 1VQLZ 3TE5B 3NH4A 5D1OA 1Y1WI 1YUKA 1VQ5Z 1WW9A 2NVXI 3S1NI 3P5JB 2PMZA 3J81f 4A3DI 3HOYI 2KI7B 2QRCB 4A3BI 1K8A2 3HOWI 1I3QI 3CC21 2DE6A 5IT9b 2WAQA 3KIHA 3I55Z 1P9NA 2E7ZA 3CCVZ 1YJW1 1VQ71 3CCU1 4A3II 2Y0SA 3J7A4 3NH5A 5CM2M 1WZNA 2JNYA 3TDHB 1M1K2 1NUIA 2DE5A 3U50C 3HOVI 1Y8CA 1VQ6Z 3CCL1 1ZB8A 1Q812 1VQK1 3G6EZ 2KPIA 2QREB 3G711 2VUMI 1VQ4Z 1TWCI 4DQYB 2AKLA 1VQ81 2GTHA 5C3EI 3NDIA 4MD7A 5FLXb 3M4OI 4DGLA 4A3EI 3PO2I 3I07A 3RZOI 3CC7Z 1KD12 3RZDI 1Z01A 2PM9A 5FLMI 4NFRA 2F4OA 2QRDB 1S72Z 4MH4A 1JJ2Z 3BG0B 3F3FC 2O53A 3VMHA 3CC41 4E2XA 2R92I 1ZH1A 3G4SZ 2JIQA 3CCEZ 4A3LI 3HKZA 1VQ61 2E2HI 1QVGZ 1RO0A 1TWGI 3GTLI 4DK1A 4NB8A 1VQ41 3S2HI 4QTUA 4HGZA 4S1TA 4E2WA 3CCM1 4MXUA 3BG1B 2VPXA 3CC71 1VQOZ 2VPWA 4RVDA 1Q862 3GCFA 1M1K1 2RIQA 2E2JI 2JA7I 2OOYB 2E9HA 4HH4A 1S721 3FQMA 1TWAI 1L1OC 1LQLA 4AYBA 1Q811 3K7AI 2V8IA 1RNIA 2VPYA 1YHQZ 2JA8I 3CMAZ 1VQM1 1VQN1 1TWHI 3OW2Z 3CPWZ 3HOUI 3VMGA 4RVFA 1QF8A 2R6MA 2BJOA 3CCR1 3HOXI 1X0TA 4Y52I 2LFUA 1WCMI 2VPZA 1YITZ 1Q821 1KC81 3ESWA 1FDOA 2R93I 2P28A 3GTKI 1VQO1 3D9XA 3CXCY 3IF8A 3GTJI 2HU9A 1YIJZ 3S17I 3MZKB 3FQQA 3QWUA 5C4JI 1YJNZ 1VQ91 1Z03A 1YI2Z 2LIYA 1KQSY 2DE7A 3PO3S 2ZAEB 2YADA 1Q861 3D6WA 2NVQI 5A2Qf 1Q7Y1 1YIT1 2Q51A 5D1OB 2JIPA 4E30A 1WIIA 1PFTA 1VQL1 2J6AA 2WB1A 2QKDA 1VQ51 2G2KA 3J80b 3GTGI 2JA6I 2NVYI 3I4MI 4A3CI 3IR7A 2M48A 3CCQZ 3CD6Z 1X3ZA 4RS4A 3GTMI 3I551 1N8R2 2AYDA 4MD9A 5AN9F 1I6HI 3S1QI 3GTQI 4E32A 3CCV1 1RLYA 1KC82 1Q822 2YU9I 1TWFI 1YJ9Z 3CCSZ 3CMEZ 3IX0A 4A3FI 3MZLB 3NDJA 3CCJZ 5IT9f 1K83I 2OTJZ 2RHBA 1VQPZ 2JMOA 3G6E1 4NBFA 3S15I 4MRIA 1YUAA 4NB9A 4A3GI 4BY1I 3S1MI 1W2BY 3H3VJ 2RBLA 2QEXZ 1W2BZ 5T6BA 4MONA 4NBHA 4E33A 3S1RI 3I56Z 5IP7I 1Q7Y2 2JR6A 3J81b 4NBEA 2QA4Z 2OTLZ 3CCS1 2LEXA 2JIMA 5FLXf 3G4S1 2OTJ1 3CCE1 4Y7NI 2JA5I 3VB9A 1USPB 1JWHC 2JIRA 1N8R1 2P3YA 4NBCA 3KIFA 3GTOI 1RO4A 2IZ4A 3CC2Z 3MONA 3M3YI 2NAPA 2H85A 3GTPI 2GTIA 4NBBA 1QVFY 1Y1VS 1YJWZ 1VQ7Z 3CCUZ 2OZKA 3CXCZ 1K9M2 1X3WA 4NH1C 2V3VA 3I4NI 4NBAA 1YHQ1
chains in the Genus database with same CATH topology
2VUGA 4E2YA 4BBSI 3CMA1 1DL6A 3Q87A 2QR1B 4E2ZA 2HF1A 3CCLZ 1KQSZ 1VQKZ 2RPRA 2VF1A 3G71Z 1NJI1 3JAMb 2QLVB 2O4HA 2W04A 1SFOI 5C4XI 2PK7A 1VQ8Z 2EGTA 2I3CA 3HOZI 2W03A 4BBRI 2V8JA 1ZB9A 2K5RA 5IP9I 2JS4A 1YIJ1 2V8KA 1R9TI 1M901 5C44I 3CC4Z 2GU2A 2R7ZI 1YJN1 1YI21 4QTTA 3S16I 2JUBA 1Z02A 4A3JI 4NOZA 2IZ3A 1VLAA 2K3RA 1K9M1 3LUSA 3CCMZ 3F3PC 1S7MA 1KRLA 1K732 1JJ2Y 2F4MA 3VMIA 2RT9A 3GKQA 1NP6A 5T64A 3JAMf 4EWCA 3CCQ1 3CD61 5D1PA 5LL6f 1RQFA 3CQZI 1VQMZ 1VQNZ 1NJI2 1K8A1 4RV9A 2M6NA 3EEDA 4E31A 1QVGY 3T4NB 3J80f 2OOXB 3GTMS 3CCRZ 3H0GI 1N2FA 1YJ91 3CME1 4BY7I 1QYPA 1USPA 3CCJ1 1Y1VI 3VTNA 1VQP1 4A93I 3NH8A 4MD8A 1M902 3IFUA 3EERA 4NBDA 2NVTI 4X6AI 1I50I 4XX2A 5A2Qb 2QEX1 4TNUA 4A3KI 3OW2Y 1TFIA 3CPWY 3PO3I 3NFZA 3S2DI 4RVGA 1VQ9Z 3I561 4BXXI 4NBGA 3FKII 4HGYA 5T67A 1ML8A 4CL1A 1QVFZ 2OTL1 2QA41 2E2II 1K731 1KD11 2B63I 1RO2A 4RVHA 2Q4ZA 4A3MI 3S14I 1VQLZ 3TE5B 3NH4A 5D1OA 1Y1WI 1YUKA 1VQ5Z 1WW9A 2NVXI 3S1NI 3P5JB 2PMZA 3J81f 4A3DI 3HOYI 2KI7B 2QRCB 4A3BI 1K8A2 3HOWI 1I3QI 3CC21 2DE6A 5IT9b 2WAQA 3KIHA 3I55Z 1P9NA 3CCVZ 1YJW1 1VQ71 3CCU1 4A3II 2Y0SA 3J7A4 3NH5A 5CM2M 2JNYA 3TDHB 1M1K2 1NUIA 2DE5A 3U50C 3HOVI 1VQ6Z 3CCL1 1ZB8A 1Q812 1VQK1 3G6EZ 2KPIA 2QREB 3G711 2VUMI 1VQ4Z 1TWCI 4DQYB 2AKLA 1VQ81 2GTHA 5C3EI 3NDIA 4MD7A 5FLXb 3M4OI 4DGLA 4A3EI 3PO2I 3I07A 3RZOI 3CC7Z 1KD12 3RZDI 1Z01A 2PM9A 5FLMI 4NFRA 2F4OA 2QRDB 1S72Z 4MH4A 1JJ2Z 3BG0B 3F3FC 2O53A 3VMHA 3CC41 4E2XA 2R92I 1ZH1A 3G4SZ 3CCEZ 4A3LI 3HKZA 1VQ61 2E2HI 1QVGZ 1RO0A 1TWGI 3GTLI 4DK1A 4NB8A 1VQ41 3S2HI 4QTUA 4HGZA 4S1TA 4E2WA 3CCM1 4MXUA 3BG1B 3CC71 1VQOZ 4RVDA 1Q862 3GCFA 1M1K1 2RIQA 2E2JI 2JA7I 2OOYB 2E9HA 4HH4A 1S721 3FQMA 1TWAI 1L1OC 1LQLA 4AYBA 1Q811 3K7AI 2V8IA 1RNIA 1YHQZ 2JA8I 3CMAZ 1VQM1 1VQN1 1TWHI 3OW2Z 3CPWZ 3HOUI 3VMGA 4RVFA 1QF8A 2R6MA 2BJOA 3CCR1 3HOXI 1X0TA 4Y52I 2LFUA 1WCMI 1YITZ 1KC81 1Q821 3ESWA 2R93I 2P28A 3GTKI 1VQO1 3D9XA 3CXCY 3IF8A 3GTJI 2HU9A 1YIJZ 3S17I 3MZKB 3FQQA 3QWUA 5C4JI 1YJNZ 1VQ91 1Z03A 1YI2Z 2LIYA 1KQSY 2DE7A 3PO3S 2ZAEB 2YADA 1Q861 3D6WA 2NVQI 5A2Qf 1Q7Y1 1YIT1 2Q51A 5D1OB 4E30A 1WIIA 1PFTA 1VQL1 2J6AA 2WB1A 2QKDA 1VQ51 2G2KA 3J80b 3GTGI 2JA6I 2NVYI 3I4MI 4A3CI 2M48A 3CCQZ 3CD6Z 1X3ZA 4RS4A 3GTMI 3I551 1N8R2 4MD9A 5AN9F 1I6HI 3S1QI 3GTQI 4E32A 3CCV1 1RLYA 1KC82 1Q822 2YU9I 1TWFI 1YJ9Z 3CCSZ 3CMEZ 3IX0A 4A3FI 3MZLB 3NDJA 3CCJZ 5IT9f 1K83I 2OTJZ 2RHBA 1VQPZ 2JMOA 3G6E1 4NBFA 3S15I 4MRIA 1YUAA 4NB9A 4A3GI 4BY1I 3S1MI 1W2BY 3H3VJ 2RBLA 2QEXZ 1W2BZ 5T6BA 4MONA 4NBHA 4E33A 3S1RI 3I56Z 5IP7I 1Q7Y2 2JR6A 3J81b 4NBEA 2QA4Z 2OTLZ 3CCS1 5FLXf 3G4S1 2OTJ1 3CCE1 4Y7NI 2JA5I 3VB9A 1USPB 1JWHC 1N8R1 2P3YA 4NBCA 3KIFA 3GTOI 1RO4A 2IZ4A 3CC2Z 3MONA 3M3YI 2H85A 3GTPI 2GTIA 4NBBA 1QVFY 1Y1VS 1YJWZ 1VQ7Z 3CCUZ 2OZKA 3CXCZ 1K9M2 1X3WA 4NH1C 3I4NI 4NBAA 1YHQ1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTG I;  4BBS I;  2JA6 I;  2R92 I;  1DL6 A;  2NVY I;  4NBD A;  2NVT I;  3I4M I;  4A3C I;  4A3L I;  4X6A I;  1I50 I;  3Q87 A;  4XX2 A;  2HF1 A;  2E2H I;  1X3Z A;  4A3K I;  1TWG I;  3GTM I;  3GTL I;  1TFI A;  3PO3 I;  4NB8 A;  3S2D I;  1I6H I;  3S1Q I;  3S2H I;  4QTU A;  4BXX I;  3GTQ I;  1SFO I;  1RLY A;  2PK7 A;  4NBG A;  3FKI I;  5C4X I;  1ML8 A;  2YU9 I;  2E2I I;  1TWF I;  4A3F I;  3HOZ I;  2B63 I;  3GCF A;  4BBR I;  2E2J I;  2JA7 I;  1K83 I;  1ZB9 A;  4A3M I;  3S14 I;  2K5R A;  1TWA I;  5IP9 I;  1L1O C;  2JS4 A;  1Y1W I;  1LQL A;  1R9T I;  1WW9 A;  2NVX I;  3K7A I;  3S1N I;  5C44 I;  4NBF A;  3S15 I;  2R7Z I;  4A3D I;  2JA8 I;  1YUA A;  4NB9 A;  1TWH I;  4A3G I;  3HOY I;  3HOU I;  3VMG A;  4BY1 I;  4A3B I;  4QTT A;  3S1M I;  3HOW I;  3S16 I;  1I3Q I;  3H3V J;  2RBL A;  2DE6 A;  2BJO A;  3HOX I;  4NBH A;  4A3J I;  4Y52 I;  3S1R I;  4NOZ A;  5IP7 I;  1WCM I;  3ESW A;  1VLA A;  2JR6 A;  4A3I I;  3LUS A;  2R93 I;  4NBE A;  3GTK I;  5CM2 M;  2JNY A;  1NUI A;  2DE5 A;  3U50 C;  2F4M A;  3VMI A;  3HOV I;  3GKQ A;  4Y7N I;  3GTJ I;  2JA5 I;  3VB9 A;  3S17 I;  1ZB8 A;  1USP B;  2KPI A;  2P3Y A;  3CQZ I;  2VUM I;  5C4J I;  1TWC I;  4NBC A;  3GTO I;  1RO4 A;  2AKL A;  5C3E I;  2DE7 A;  3M3Y I;  3GTM S;  3M4O I;  3H0G I;  4A3E I;  3PO2 I;  3PO3 S;  1N2F A;  3I07 A;  3RZO I;  4BY7 I;  1QYP A;  3D6W A;  2NVQ I;  1USP A;  3RZD I;  5FLM I;  3GTP I;  4NBB A;  1Y1V S;  2F4O A;  1PFT A;  1Y1V I;  2J6A A;  4MH4 A;  3VMH A;  4A93 I;  1X3W A;  3I4N I;  4NBA A;  3EER A; 
#chains in the Genus database with same CATH topology
 2VUG A;  4E2Y A;  4BBS I;  3CMA 1;  1DL6 A;  3Q87 A;  2QR1 B;  4E2Z A;  2HF1 A;  3CCL Z;  1KQS Z;  1VQK Z;  2RPR A;  2VF1 A;  3G71 Z;  1NJI 1;  3JAM b;  2QLV B;  2O4H A;  2W04 A;  1SFO I;  5C4X I;  2PK7 A;  1VQ8 Z;  2EGT A;  2V45 A;  2I3C A;  3HOZ I;  2W03 A;  4BBR I;  2V8J A;  1QXF A;  1ZB9 A;  2K5R A;  5IP9 I;  2JS4 A;  1YIJ 1;  2V8K A;  1R9T I;  1M90 1;  5C44 I;  3CC4 Z;  2GU2 A;  2R7Z I;  1YJN 1;  1SIW A;  1YI2 1;  4QTT A;  3S16 I;  1Q16 A;  2JUB A;  1Z02 A;  4A3J I;  4NOZ A;  2IZ3 A;  1VLA A;  2K3R A;  1K9M 1;  3LUS A;  3CCM Z;  3F3P C;  2JIO A;  1S7M A;  1KRL A;  1K73 2;  1WJ2 A;  1JJ2 Y;  2F4M A;  3VMI A;  2RT9 A;  3GKQ A;  1NP6 A;  5T64 A;  3JAM f;  4EWC A;  3CCQ 1;  3CD6 1;  5D1P A;  5LL6 f;  1RQF A;  3CQZ I;  1VQM Z;  3D2L A;  1VQN Z;  1NJI 2;  1K8A 1;  4RV9 A;  2M6N A;  3EED A;  4E31 A;  1QVG Y;  3T4N B;  3J80 f;  2OOX B;  3GTM S;  3CCR Z;  3H0G I;  1N2F A;  1YJ9 1;  3CME 1;  4BY7 I;  1QYP A;  1USP A;  3CCJ 1;  1Y1V I;  3VTN A;  1VQP 1;  4A93 I;  3NH8 A;  4MD8 A;  1FDI A;  1M90 2;  3IFU A;  3EER A;  4NBD A;  1AA6 A;  2NVT I;  4X6A I;  1I50 I;  4XX2 A;  2IV2 X;  5A2Q b;  2QEX 1;  4TNU A;  4A3K I;  3OW2 Y;  1TFI A;  3CPW Y;  3PO3 I;  3NFZ A;  3S2D I;  4RVG A;  1VQ9 Z;  3I56 1;  4BXX I;  4NBG A;  3FKI I;  4HGY A;  5T67 A;  1ML8 A;  4CL1 A;  1QVF Z;  2OTL 1;  2QA4 1;  2E2I I;  1K73 1;  1KD1 1;  2B63 I;  1RO2 A;  4RVH A;  2Q4Z A;  4A3M I;  3S14 I;  1VQL Z;  3TE5 B;  3NH4 A;  5D1O A;  1Y1W I;  1YUK A;  1VQ5 Z;  1WW9 A;  2NVX I;  3S1N I;  3P5J B;  2PMZ A;  3J81 f;  4A3D I;  3HOY I;  2KI7 B;  2QRC B;  4A3B I;  1K8A 2;  3HOW I;  1I3Q I;  3CC2 1;  2DE6 A;  5IT9 b;  2WAQ A;  3KIH A;  3I55 Z;  1P9N A;  2E7Z A;  3CCV Z;  1YJW 1;  1VQ7 1;  3CCU 1;  4A3I I;  2Y0S A;  3J7A 4;  3NH5 A;  5CM2 M;  1WZN A;  2JNY A;  3TDH B;  1M1K 2;  1NUI A;  2DE5 A;  3U50 C;  3HOV I;  1Y8C A;  1VQ6 Z;  3CCL 1;  1ZB8 A;  1Q81 2;  1VQK 1;  3G6E Z;  2KPI A;  2QRE B;  3G71 1;  2VUM I;  1VQ4 Z;  1TWC I;  4DQY B;  2AKL A;  1VQ8 1;  2GTH A;  5C3E I;  3NDI A;  4MD7 A;  5FLX b;  3M4O I;  4DGL A;  4A3E I;  3PO2 I;  3I07 A;  3RZO I;  3CC7 Z;  1KD1 2;  3RZD I;  1Z01 A;  2PM9 A;  5FLM I;  4NFR A;  2F4O A;  2QRD B;  1S72 Z;  4MH4 A;  1JJ2 Z;  3BG0 B;  3F3F C;  2O53 A;  3VMH A;  3CC4 1;  4E2X A;  2R92 I;  1ZH1 A;  3G4S Z;  2JIQ A;  3CCE Z;  4A3L I;  3HKZ A;  1VQ6 1;  2E2H I;  1QVG Z;  1RO0 A;  1TWG I;  3GTL I;  4DK1 A;  4NB8 A;  1VQ4 1;  3S2H I;  4QTU A;  4HGZ A;  4S1T A;  4E2W A;  3CCM 1;  4MXU A;  3BG1 B;  2VPX A;  3CC7 1;  1VQO Z;  2VPW A;  4RVD A;  1Q86 2;  3GCF A;  1M1K 1;  2RIQ A;  2E2J I;  2JA7 I;  2OOY B;  2E9H A;  4HH4 A;  1S72 1;  3FQM A;  1TWA I;  1L1O C;  1LQL A;  4AYB A;  1Q81 1;  3K7A I;  2V8I A;  1RNI A;  2VPY A;  1YHQ Z;  2JA8 I;  3CMA Z;  1VQM 1;  1VQN 1;  1TWH I;  3OW2 Z;  3CPW Z;  3HOU I;  3VMG A;  4RVF A;  1QF8 A;  2R6M A;  2BJO A;  3CCR 1;  3HOX I;  1X0T A;  4Y52 I;  2LFU A;  1WCM I;  2VPZ A;  1YIT Z;  1Q82 1;  1KC8 1;  3ESW A;  1FDO A;  2R93 I;  2P28 A;  3GTK I;  1VQO 1;  3D9X A;  3CXC Y;  3IF8 A;  3GTJ I;  2HU9 A;  1YIJ Z;  3S17 I;  3MZK B;  3FQQ A;  3QWU A;  5C4J I;  1YJN Z;  1VQ9 1;  1Z03 A;  1YI2 Z;  2LIY A;  1KQS Y;  2DE7 A;  3PO3 S;  2ZAE B;  2YAD A;  1Q86 1;  3D6W A;  2NVQ I;  5A2Q f;  1Q7Y 1;  1YIT 1;  2Q51 A;  5D1O B;  2JIP A;  4E30 A;  1WII A;  1PFT A;  1VQL 1;  2J6A A;  2WB1 A;  2QKD A;  1VQ5 1;  2G2K A;  3J80 b;  3GTG I;  2JA6 I;  2NVY I;  3I4M I;  4A3C I;  3IR7 A;  2M48 A;  3CCQ Z;  3CD6 Z;  1X3Z A;  4RS4 A;  3GTM I;  3I55 1;  1N8R 2;  2AYD A;  4MD9 A;  5AN9 F;  1I6H I;  3S1Q I;  3GTQ I;  4E32 A;  3CCV 1;  1RLY A;  1KC8 2;  1Q82 2;  2YU9 I;  1TWF I;  1YJ9 Z;  3CCS Z;  3CME Z;  3IX0 A;  4A3F I;  3MZL B;  3NDJ A;  3CCJ Z;  5IT9 f;  1K83 I;  2OTJ Z;  2RHB A;  1VQP Z;  2JMO A;  3G6E 1;  4NBF A;  3S15 I;  4MRI A;  1YUA A;  4NB9 A;  4A3G I;  4BY1 I;  3S1M I;  1W2B Y;  3H3V J;  2RBL A;  2QEX Z;  1W2B Z;  5T6B A;  4MON A;  4NBH A;  4E33 A;  3S1R I;  3I56 Z;  5IP7 I;  1Q7Y 2;  2JR6 A;  3J81 b;  4NBE A;  2QA4 Z;  2OTL Z;  3CCS 1;  2LEX A;  2JIM A;  5FLX f;  3G4S 1;  2OTJ 1;  3CCE 1;  4Y7N I;  2JA5 I;  3VB9 A;  1USP B;  1JWH C;  2JIR A;  1N8R 1;  2P3Y A;  4NBC A;  3KIF A;  3GTO I;  1RO4 A;  2IZ4 A;  3CC2 Z;  3MON A;  3M3Y I;  2NAP A;  2H85 A;  3GTP I;  2GTI A;  4NBB A;  1QVF Y;  1Y1V S;  1YJW Z;  1VQ7 Z;  3CCU Z;  2OZK A;  3CXC Z;  1K9M 2;  1X3W A;  4NH1 C;  2V3V A;  3I4N I;  4NBA A;  1YHQ 1; 
#chains in the Genus database with same CATH homology
 2VUG A;  4E2Y A;  4BBS I;  3CMA 1;  1DL6 A;  3Q87 A;  2QR1 B;  4E2Z A;  2HF1 A;  3CCL Z;  1KQS Z;  1VQK Z;  2RPR A;  2VF1 A;  3G71 Z;  1NJI 1;  3JAM b;  2QLV B;  2O4H A;  2W04 A;  1SFO I;  5C4X I;  2PK7 A;  1VQ8 Z;  2EGT A;  2I3C A;  3HOZ I;  2W03 A;  4BBR I;  2V8J A;  1ZB9 A;  2K5R A;  5IP9 I;  2JS4 A;  1YIJ 1;  2V8K A;  1R9T I;  1M90 1;  5C44 I;  3CC4 Z;  2GU2 A;  2R7Z I;  1YJN 1;  1YI2 1;  4QTT A;  3S16 I;  2JUB A;  1Z02 A;  4A3J I;  4NOZ A;  2IZ3 A;  1VLA A;  2K3R A;  1K9M 1;  3LUS A;  3CCM Z;  3F3P C;  1S7M A;  1KRL A;  1K73 2;  1JJ2 Y;  2F4M A;  3VMI A;  2RT9 A;  3GKQ A;  1NP6 A;  5T64 A;  3JAM f;  4EWC A;  3CCQ 1;  3CD6 1;  5D1P A;  5LL6 f;  1RQF A;  3CQZ I;  1VQM Z;  1VQN Z;  1NJI 2;  1K8A 1;  4RV9 A;  2M6N A;  3EED A;  4E31 A;  1QVG Y;  3T4N B;  3J80 f;  2OOX B;  3GTM S;  3CCR Z;  3H0G I;  1N2F A;  1YJ9 1;  3CME 1;  4BY7 I;  1QYP A;  1USP A;  3CCJ 1;  1Y1V I;  3VTN A;  1VQP 1;  4A93 I;  3NH8 A;  4MD8 A;  1M90 2;  3IFU A;  3EER A;  4NBD A;  2NVT I;  4X6A I;  1I50 I;  4XX2 A;  5A2Q b;  2QEX 1;  4TNU A;  4A3K I;  3OW2 Y;  1TFI A;  3CPW Y;  3PO3 I;  3NFZ A;  3S2D I;  4RVG A;  1VQ9 Z;  3I56 1;  4BXX I;  4NBG A;  3FKI I;  4HGY A;  5T67 A;  1ML8 A;  4CL1 A;  1QVF Z;  2OTL 1;  2QA4 1;  2E2I I;  1K73 1;  1KD1 1;  2B63 I;  1RO2 A;  4RVH A;  2Q4Z A;  4A3M I;  3S14 I;  1VQL Z;  3TE5 B;  3NH4 A;  5D1O A;  1Y1W I;  1YUK A;  1VQ5 Z;  1WW9 A;  2NVX I;  3S1N I;  3P5J B;  2PMZ A;  3J81 f;  4A3D I;  3HOY I;  2KI7 B;  2QRC B;  4A3B I;  1K8A 2;  3HOW I;  1I3Q I;  3CC2 1;  2DE6 A;  5IT9 b;  2WAQ A;  3KIH A;  3I55 Z;  1P9N A;  3CCV Z;  1YJW 1;  1VQ7 1;  3CCU 1;  4A3I I;  2Y0S A;  3J7A 4;  3NH5 A;  5CM2 M;  2JNY A;  3TDH B;  1M1K 2;  1NUI A;  2DE5 A;  3U50 C;  3HOV I;  1VQ6 Z;  3CCL 1;  1ZB8 A;  1Q81 2;  1VQK 1;  3G6E Z;  2KPI A;  2QRE B;  3G71 1;  2VUM I;  1VQ4 Z;  1TWC I;  4DQY B;  2AKL A;  1VQ8 1;  2GTH A;  5C3E I;  3NDI A;  4MD7 A;  5FLX b;  3M4O I;  4DGL A;  4A3E I;  3PO2 I;  3I07 A;  3RZO I;  3CC7 Z;  1KD1 2;  3RZD I;  1Z01 A;  2PM9 A;  5FLM I;  4NFR A;  2F4O A;  2QRD B;  1S72 Z;  4MH4 A;  1JJ2 Z;  3BG0 B;  3F3F C;  2O53 A;  3VMH A;  3CC4 1;  4E2X A;  2R92 I;  1ZH1 A;  3G4S Z;  3CCE Z;  4A3L I;  3HKZ A;  1VQ6 1;  2E2H I;  1QVG Z;  1RO0 A;  1TWG I;  3GTL I;  4DK1 A;  4NB8 A;  1VQ4 1;  3S2H I;  4QTU A;  4HGZ A;  4S1T A;  4E2W A;  3CCM 1;  4MXU A;  3BG1 B;  3CC7 1;  1VQO Z;  4RVD A;  1Q86 2;  3GCF A;  1M1K 1;  2RIQ A;  2E2J I;  2JA7 I;  2OOY B;  2E9H A;  4HH4 A;  1S72 1;  3FQM A;  1TWA I;  1L1O C;  1LQL A;  4AYB A;  1Q81 1;  3K7A I;  2V8I A;  1RNI A;  1YHQ Z;  2JA8 I;  3CMA Z;  1VQM 1;  1VQN 1;  1TWH I;  3OW2 Z;  3CPW Z;  3HOU I;  3VMG A;  4RVF A;  1QF8 A;  2R6M A;  2BJO A;  3CCR 1;  3HOX I;  1X0T A;  4Y52 I;  2LFU A;  1WCM I;  1YIT Z;  1KC8 1;  1Q82 1;  3ESW A;  2R93 I;  2P28 A;  3GTK I;  1VQO 1;  3D9X A;  3CXC Y;  3IF8 A;  3GTJ I;  2HU9 A;  1YIJ Z;  3S17 I;  3MZK B;  3FQQ A;  3QWU A;  5C4J I;  1YJN Z;  1VQ9 1;  1Z03 A;  1YI2 Z;  2LIY A;  1KQS Y;  2DE7 A;  3PO3 S;  2ZAE B;  2YAD A;  1Q86 1;  3D6W A;  2NVQ I;  5A2Q f;  1Q7Y 1;  1YIT 1;  2Q51 A;  5D1O B;  4E30 A;  1WII A;  1PFT A;  1VQL 1;  2J6A A;  2WB1 A;  2QKD A;  1VQ5 1;  2G2K A;  3J80 b;  3GTG I;  2JA6 I;  2NVY I;  3I4M I;  4A3C I;  2M48 A;  3CCQ Z;  3CD6 Z;  1X3Z A;  4RS4 A;  3GTM I;  3I55 1;  1N8R 2;  4MD9 A;  5AN9 F;  1I6H I;  3S1Q I;  3GTQ I;  4E32 A;  3CCV 1;  1RLY A;  1KC8 2;  1Q82 2;  2YU9 I;  1TWF I;  1YJ9 Z;  3CCS Z;  3CME Z;  3IX0 A;  4A3F I;  3MZL B;  3NDJ A;  3CCJ Z;  5IT9 f;  1K83 I;  2OTJ Z;  2RHB A;  1VQP Z;  2JMO A;  3G6E 1;  4NBF A;  3S15 I;  4MRI A;  1YUA A;  4NB9 A;  4A3G I;  4BY1 I;  3S1M I;  1W2B Y;  3H3V J;  2RBL A;  2QEX Z;  1W2B Z;  5T6B A;  4MON A;  4NBH A;  4E33 A;  3S1R I;  3I56 Z;  5IP7 I;  1Q7Y 2;  2JR6 A;  3J81 b;  4NBE A;  2QA4 Z;  2OTL Z;  3CCS 1;  5FLX f;  3G4S 1;  2OTJ 1;  3CCE 1;  4Y7N I;  2JA5 I;  3VB9 A;  1USP B;  1JWH C;  1N8R 1;  2P3Y A;  4NBC A;  3KIF A;  3GTO I;  1RO4 A;  2IZ4 A;  3CC2 Z;  3MON A;  3M3Y I;  2H85 A;  3GTP I;  2GTI A;  4NBB A;  1QVF Y;  1Y1V S;  1YJW Z;  1VQ7 Z;  3CCU Z;  2OZK A;  3CXC Z;  1K9M 2;  1X3W A;  4NH1 C;  3I4N I;  4NBA A;  1YHQ 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...