1TWFI

Rna polymerase ii complexed with utp at 2.3 a resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
122
structure length
122
Chain Sequence
b'MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
molecule tags Transcription
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
total genus 17
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1twfI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1twfI02
1Y1VI 2E2JI 3S1MI 1TWHI 3GTOI 3EERA 3HOVI 4A3EI 3S16I 4NBCA 1NUIA 1K83I 1ZB8A 3GCFA 3GTLI 4A3CI 1DL6A 3PO2I 3S2HI 4BBRI 2HF1A 3HOZI 2K5RA 2PK7A 1VLAA 1N2FA 3HOUI 4A3II 3S17I 2JA8I 2VUMI 2YU9I 4A3JI 3GTMS 3GKQA 2F4MA 4XX2A 3U50C 3S1QI 5C44I 4NB8A 1R9TI 3GTPI 5IP7I 2R93I 1RLYA 3CQZI 2DE6A 4Y52I 1ML8A 3PO3S 1TWFI 5FLMI 2NVXI 2JA5I 4MH4A 3S2DI 2JA6I 5C3EI 2DE7A 3M4OI 5IP9I 1RO4A 2NVYI 4BY7I 2NVQI 3H3VJ 3S15I 4NB9A 3I4NI 4BXXI 2JA7I 4NBHA 4A3KI 1I50I 2JS4A 2BJOA 1PFTA 3Q87A 5CM2M 1X3ZA 4NBAA 1L1OC 3H0GI 4BBSI 4A3BI 1SFOI 3RZOI 3ESWA 3GTMI 4BY1I 3GTKI 2P3YA 3S14I 4NBFA 3GTQI 4A3MI 3I4MI 2B63I 1TWCI 2DE5A 4A3DI 1Y1WI 3HOWI 1TFIA 2E2HI 3VMGA 4NBDA 3S1RI 4A3GI 3VMHA 2J6AA 1ZB9A 1I6HI 1TWGI 4A3FI 3VB9A 4A3LI 1Y1VS 1WCMI 4A93I 4QTTA 2R7ZI 3I07A 3GTJI 4NBBA 4Y7NI 1USPA 2F4OA 3D6WA 5C4JI 2JNYA 5C4XI 2E2II 3LUSA 1TWAI 3K7AI 4X6AI 3FKII 4NOZA 3PO3I 1YUAA 3GTGI 1QYPA 1USPB 3RZDI 2KPIA 1WW9A 2RBLA 1LQLA 3S1NI 2AKLA 3HOYI 3VMIA 2JR6A 1I3QI 3HOXI 4QTUA 4NBGA 1X3WA 2R92I 3M3YI 4NBEA 2NVTI
chains in the Genus database with same CATH superfamily
5T6BA 2OTJZ 2E2JI 2H85A 2ZAEB 3GTOI 3S1MI 3NDJA 3CC21 2PM9A 4A3CI 3GCFA 3CC2Z 3PO2I 5T67A 4BBRI 5FLXb 4MRIA 2K5RA 2RT9A 1VLAA 1N2FA 3HOUI 1YIT1 1KQSY 4E2ZA 3CCM1 2JA8I 2YU9I 2VF1A 3G6EZ 3GTMS 3GKQA 3S1QI 3U50C 3JAMf 1R9TI 5IP7I 2Y0SA 1S72Z 3MZLB 4CL1A 2JIOA 2JA6I 2E7ZA 3F3PC 2QKDA 5T64A 1M901 1WZNA 2NVQI 2GTIA 1YHQZ 5D1OB 3EEDA 4NB9A 1RQFA 3I4NI 3CCL1 2JMOA 3CCV1 4BXXI 2JA7I 4NBHA 1I50I 3NH4A 2JS4A 3G71Z 3Q87A 4E30A 2QEXZ 4NBAA 1VQ6Z 4A3BI 3RZOI 3J7A4 3ESWA 2P3YA 3F3FC 3CC4Z 4E32A 1RNIA 4S1TA 3CC41 2B63I 2DE5A 1SIWA 3G4S1 2W03A 1VQ81 3MZKB 2WB1A 4NBDA 4RS4A 1RO0A 1Q811 3VMHA 2J6AA 1I6HI 3IF8A 1VQ4Z 2QA4Z 1VQP1 1WCMI 1VQKZ 1USPA 3D6WA 3IX0A 1N8R2 1NJI2 2JIRA 4NOZA 2P28A 1VQ91 2O53A 3PO3I 1KQSZ 3CCE1 2HU9A 1USPB 3CCJZ 1WW9A 1X0TA 2KI7B 3HOXI 4QTUA 3TE5B 2JUBA 1Y8CA 1M1K1 3EERA 1Z01A 5IT9b 4A3EI 3S16I 4NBCA 3GTLI 1YJ9Z 1KD12 1K9M2 2HF1A 1S7MA 1VQOZ 3CCRZ 4DGLA 1YITZ 4E2XA 2QRCB 2LFUA 3CC71 3CD61 3G6E1 3CMEZ 4NB8A 4RVHA 2R93I 2DE6A 1QVFY 3NH8A 1ML8A 1TWFI 2JA5I 4MH4A 3S2DI 2K3RA 3M4OI 1RO4A 2NVYI 4BY7I 5D1PA 2LIYA 4NH1C 1AA6A 3CCS1 3H3VJ 3CC7Z 3S15I 4RV9A 5D1OA 2IZ3A 3KIHA 1W2BY 1Z03A 1RO2A 1VQ61 3GTKI 4A3MI 3I4MI 1QVGZ 1VQ8Z 3OW2Y 4MONA 1VQM1 1KD11 1NJI1 3S1RI 4A3GI 1ZB9A 1TWGI 3D9XA 3NH5A 5FLXf 4A3FI 2NAPA 1YJN1 3CCQ1 1YJNZ 2O4HA 3D2LA 2R7ZI 3I07A 2GTHA 4NBBA 4AYBA 2R6MA 2F4OA 3LUSA 4HH4A 1Q821 2M48A 3CXCY 1Q16A 1YJWZ 1YUAA 1VQ71 3GTGI 2VPWA 1QF8A 2OOYB 2RBLA 1VQ41 3HKZA 2IV2X 2AKLA 1YIJ1 3HOYI 2VPZA 2V8JA 3VMIA 1N8R1 1WJ2A 3VTNA 2WAQA 1VQ51 1JJ2Y 4NBGA 4DK1A 2RPRA 2NVTI 2OTJ1 3J81b 1Y1VI 1S721 1TWHI 3HOVI 1K83I 2E9HA 5IT9f 3S2HI 1YJ91 2GU2A 1VQO1 3KIFA 1YIJZ 3FQQA 4A3II 3CD6Z 3CCSZ 2VUMI 3BG1B 3CME1 2F4MA 1QXFA 3GTPI 3I561 1RLYA 2VUGA 2QRDB 1KC82 3J81f 4Y52I 2NVXI 2EGTA 5C3EI 2Q51A 1VQMZ 3I551 3CCVZ 1Z02A 1WIIA 2V8IA 3CCQZ 5CM2M 1X3ZA 4DQYB 4MD7A 3H0GI 1Q822 2QEX1 2PMZA 1SFOI 1K8A2 3GTMI 3S14I 1K9M1 3GTQI 2AYDA 3G4SZ 4A3DI 2YADA 2I3CA 1Y1WI 1TFIA 1Q861 3I55Z 2OZKA 1KRLA 4MD9A 2IZ4A 1VQPZ 3VB9A 4A3LI 2LEXA 4A93I 2JIMA 4QTTA 1VQ5Z 5C4JI 2JNYA 5C4XI 1YUKA 1W2BZ 1TWAI 3K7AI 3NFZA 2OTL1 1VQN1 4X6AI 3J80b 2VPYA 5AN9F 2JIQA 5A2Qb 4E2YA 2KPIA 1LQLA 5A2Qf 3S1NI 2VPXA 2Q4ZA 3NDIA 3IFUA 1YI2Z 1YI21 1I3QI 1KC81 4RVGA 4RVDA 1JJ2Z 1P9NA 4MXUA 2R92I 1ZH1A 2V3VA 1JWHC 3JAMb 1NUIA 1ZB8A 1QVGY 1DL6A 4NFRA 3CXCZ 3HOZI 2PK7A 3CCR1 3S17I 1Q862 2G2KA 4A3JI 3CCMZ 3CMAZ 2RHBA 4XX2A 5C44I 2OOXB 3CQZI 3CPWZ 3PO3S 5FLMI 3CPWY 3QWUA 1Q7Y1 1K731 2DE7A 2V45A 5IP9I 5LL6f 1FDIA 1VQL1 1K732 1YHQ1 3CCUZ 1VQLZ 2QR1B 1Q7Y2 4A3KI 3I56Z 2BJOA 2W04A 1FDOA 1PFTA 1M1K2 4BBSI 1L1OC 3IR7A 3TDHB 4BY1I 4HGZA 4MD8A 4NBFA 2JIPA 1TWCI 1K8A1 3CCU1 3HOWI 2E2HI 3CCLZ 3VMGA 4RVFA 3OW2Z 3G711 2QA41 1Y1VS 2V8KA 3J80f 3T4NB 3GTJI 1VQK1 4Y7NI 2QLVB 4EWCA 2E2II 2QREB 2OTLZ 1VQNZ 2M6NA 3BG0B 1VQ9Z 3FKII 1YJW1 1VQ7Z 4HGYA 3CCEZ 3CCJ1 1QYPA 3P5JB 3MONA 1Q812 1M902 3RZDI 4E33A 1QVFZ 4E2WA 2JR6A 1NP6A 2RIQA 3FQMA 4E31A 4TNUA 3CMA1 1X3WA 3M3YI 4NBEA
chains in the Genus database with same CATH topology
5T6BA 2OTJZ 2E2JI 2H85A 2ZAEB 3GTOI 3S1MI 3NDJA 3CC21 2PM9A 4A3CI 3GCFA 3CC2Z 3PO2I 5T67A 4BBRI 5FLXb 4MRIA 2K5RA 2RT9A 1VLAA 1N2FA 3HOUI 1YIT1 1KQSY 4E2ZA 3CCM1 2JA8I 2YU9I 2VF1A 3G6EZ 3GTMS 3GKQA 3S1QI 3U50C 3JAMf 1R9TI 5IP7I 2Y0SA 1S72Z 3MZLB 4CL1A 2JA6I 3F3PC 2QKDA 5T64A 1M901 2NVQI 2GTIA 1YHQZ 5D1OB 3EEDA 4NB9A 1RQFA 3I4NI 3CCL1 2JMOA 3CCV1 4BXXI 2JA7I 4NBHA 1I50I 3NH4A 2JS4A 3G71Z 3Q87A 4E30A 2QEXZ 4NBAA 1VQ6Z 4A3BI 3RZOI 3J7A4 3ESWA 2P3YA 3F3FC 3CC4Z 4E32A 1RNIA 4S1TA 3CC41 2B63I 2DE5A 3G4S1 2W03A 1VQ81 3MZKB 2WB1A 4NBDA 4RS4A 1RO0A 1Q811 3VMHA 2J6AA 1I6HI 3IF8A 1VQ4Z 2QA4Z 1VQP1 1WCMI 1VQKZ 1USPA 3D6WA 3IX0A 1N8R2 1NJI2 4NOZA 2P28A 1VQ91 2O53A 3PO3I 1KQSZ 3CCE1 2HU9A 1USPB 3CCJZ 1WW9A 1X0TA 2KI7B 3HOXI 4QTUA 3TE5B 2JUBA 1M1K1 3EERA 1Z01A 5IT9b 4A3EI 3S16I 4NBCA 3GTLI 1YJ9Z 1KD12 1K9M2 2HF1A 1S7MA 1VQOZ 3CCRZ 4DGLA 1YITZ 4E2XA 2QRCB 2LFUA 3CC71 3CD61 3G6E1 3CMEZ 4NB8A 4RVHA 2R93I 2DE6A 1QVFY 3NH8A 1ML8A 1TWFI 2JA5I 4MH4A 3S2DI 2K3RA 3M4OI 1RO4A 2NVYI 4BY7I 5D1PA 2LIYA 4NH1C 3CCS1 3H3VJ 3CC7Z 3S15I 4RV9A 5D1OA 2IZ3A 3KIHA 1W2BY 1Z03A 1RO2A 1VQ61 3GTKI 4A3MI 3I4MI 1QVGZ 1VQ8Z 3OW2Y 4MONA 1VQM1 1KD11 1NJI1 3S1RI 4A3GI 1ZB9A 1TWGI 3D9XA 3NH5A 5FLXf 4A3FI 1YJN1 3CCQ1 1YJNZ 2O4HA 2R7ZI 3I07A 2GTHA 4NBBA 4AYBA 2R6MA 2F4OA 3LUSA 4HH4A 1Q821 2M48A 3CXCY 1YJWZ 1YUAA 1VQ71 3GTGI 1QF8A 2OOYB 2RBLA 1VQ41 3HKZA 2AKLA 1YIJ1 3HOYI 2V8JA 3VMIA 1N8R1 3VTNA 2WAQA 1VQ51 1JJ2Y 4NBGA 4DK1A 2RPRA 2NVTI 2OTJ1 3J81b 1Y1VI 1S721 1TWHI 3HOVI 1K83I 2E9HA 5IT9f 3S2HI 1YJ91 2GU2A 1VQO1 3KIFA 1YIJZ 3FQQA 4A3II 3CD6Z 3CCSZ 2VUMI 3BG1B 3CME1 2F4MA 3GTPI 3I561 1RLYA 2VUGA 2QRDB 1KC82 3J81f 4Y52I 2NVXI 2EGTA 5C3EI 2Q51A 1VQMZ 3I551 3CCVZ 1Z02A 1WIIA 2V8IA 3CCQZ 5CM2M 1X3ZA 4DQYB 4MD7A 3H0GI 1Q822 2QEX1 2PMZA 1SFOI 1K8A2 3GTMI 3S14I 1K9M1 3GTQI 3G4SZ 4A3DI 2YADA 2I3CA 1Y1WI 1TFIA 1Q861 3I55Z 2OZKA 1KRLA 4MD9A 2IZ4A 1VQPZ 3VB9A 4A3LI 4A93I 4QTTA 1VQ5Z 5C4JI 2JNYA 5C4XI 1YUKA 1W2BZ 1TWAI 3K7AI 3NFZA 2OTL1 1VQN1 4X6AI 3J80b 5AN9F 5A2Qb 4E2YA 2KPIA 1LQLA 5A2Qf 3S1NI 2Q4ZA 3NDIA 3IFUA 1YI2Z 1YI21 1I3QI 1KC81 4RVGA 4RVDA 1JJ2Z 1P9NA 4MXUA 2R92I 1ZH1A 1JWHC 3JAMb 1NUIA 1ZB8A 1QVGY 1DL6A 4NFRA 3CXCZ 3HOZI 2PK7A 3CCR1 3S17I 1Q862 2G2KA 4A3JI 3CCMZ 3CMAZ 2RHBA 4XX2A 5C44I 2OOXB 3CQZI 3CPWZ 3PO3S 5FLMI 3CPWY 3QWUA 1Q7Y1 1K731 2DE7A 5IP9I 5LL6f 1VQL1 1K732 1YHQ1 3CCUZ 1VQLZ 2QR1B 1Q7Y2 4A3KI 3I56Z 2BJOA 2W04A 1PFTA 1M1K2 4BBSI 1L1OC 3TDHB 4BY1I 4HGZA 4MD8A 4NBFA 1TWCI 1K8A1 3CCU1 3HOWI 2E2HI 3CCLZ 3VMGA 4RVFA 3OW2Z 3G711 2QA41 1Y1VS 2V8KA 3J80f 3T4NB 3GTJI 1VQK1 4Y7NI 2QLVB 4EWCA 2E2II 2QREB 2OTLZ 1VQNZ 2M6NA 3BG0B 1VQ9Z 3FKII 1YJW1 1VQ7Z 4HGYA 3CCEZ 3CCJ1 1QYPA 3P5JB 3MONA 1Q812 1M902 3RZDI 4E33A 1QVFZ 4E2WA 2JR6A 1NP6A 2RIQA 3FQMA 4E31A 4TNUA 3CMA1 1X3WA 3M3YI 4NBEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1V I;  2E2J I;  3S1M I;  1TWH I;  3GTO I;  3EER A;  3HOV I;  4A3E I;  3S16 I;  4NBC A;  1NUI A;  1K83 I;  1ZB8 A;  3GCF A;  3GTL I;  4A3C I;  1DL6 A;  3PO2 I;  3S2H I;  4BBR I;  2HF1 A;  3HOZ I;  2K5R A;  2PK7 A;  1VLA A;  1N2F A;  3HOU I;  4A3I I;  3S17 I;  2JA8 I;  2VUM I;  2YU9 I;  4A3J I;  3GTM S;  3GKQ A;  2F4M A;  4XX2 A;  3U50 C;  3S1Q I;  5C44 I;  4NB8 A;  1R9T I;  3GTP I;  5IP7 I;  2R93 I;  1RLY A;  3CQZ I;  2DE6 A;  4Y52 I;  1ML8 A;  3PO3 S;  1TWF I;  5FLM I;  2NVX I;  2JA5 I;  4MH4 A;  3S2D I;  2JA6 I;  5C3E I;  2DE7 A;  3M4O I;  5IP9 I;  1RO4 A;  2NVY I;  4BY7 I;  2NVQ I;  3H3V J;  3S15 I;  4NB9 A;  3I4N I;  4BXX I;  2JA7 I;  4NBH A;  4A3K I;  1I50 I;  2JS4 A;  2BJO A;  1PFT A;  3Q87 A;  5CM2 M;  1X3Z A;  4NBA A;  1L1O C;  3H0G I;  4BBS I;  4A3B I;  1SFO I;  3RZO I;  3ESW A;  3GTM I;  4BY1 I;  3GTK I;  2P3Y A;  3S14 I;  4NBF A;  3GTQ I;  4A3M I;  3I4M I;  2B63 I;  1TWC I;  2DE5 A;  4A3D I;  1Y1W I;  3HOW I;  1TFI A;  2E2H I;  3VMG A;  4NBD A;  3S1R I;  4A3G I;  3VMH A;  2J6A A;  1ZB9 A;  1I6H I;  1TWG I;  4A3F I;  3VB9 A;  4A3L I;  1Y1V S;  1WCM I;  4A93 I;  4QTT A;  2R7Z I;  3I07 A;  3GTJ I;  4NBB A;  4Y7N I;  1USP A;  2F4O A;  3D6W A;  5C4J I;  2JNY A;  5C4X I;  2E2I I;  3LUS A;  1TWA I;  3K7A I;  4X6A I;  3FKI I;  4NOZ A;  3PO3 I;  1YUA A;  3GTG I;  1QYP A;  1USP B;  3RZD I;  2KPI A;  1WW9 A;  2RBL A;  1LQL A;  3S1N I;  2AKL A;  3HOY I;  3VMI A;  2JR6 A;  1I3Q I;  3HOX I;  4QTU A;  4NBG A;  1X3W A;  2R92 I;  3M3Y I;  4NBE A;  2NVT I; 
#chains in the Genus database with same CATH topology
 5T6B A;  2OTJ Z;  2E2J I;  2H85 A;  2ZAE B;  3GTO I;  3S1M I;  3NDJ A;  3CC2 1;  2PM9 A;  4A3C I;  3GCF A;  3CC2 Z;  3PO2 I;  5T67 A;  4BBR I;  5FLX b;  4MRI A;  2K5R A;  2RT9 A;  1VLA A;  1N2F A;  3HOU I;  1YIT 1;  1KQS Y;  4E2Z A;  3CCM 1;  2JA8 I;  2YU9 I;  2VF1 A;  3G6E Z;  3GTM S;  3GKQ A;  3S1Q I;  3U50 C;  3JAM f;  1R9T I;  5IP7 I;  2Y0S A;  1S72 Z;  3MZL B;  4CL1 A;  2JIO A;  2JA6 I;  2E7Z A;  3F3P C;  2QKD A;  5T64 A;  1M90 1;  1WZN A;  2NVQ I;  2GTI A;  1YHQ Z;  5D1O B;  3EED A;  4NB9 A;  1RQF A;  3I4N I;  3CCL 1;  2JMO A;  3CCV 1;  4BXX I;  2JA7 I;  4NBH A;  1I50 I;  3NH4 A;  2JS4 A;  3G71 Z;  3Q87 A;  4E30 A;  2QEX Z;  4NBA A;  1VQ6 Z;  4A3B I;  3RZO I;  3J7A 4;  3ESW A;  2P3Y A;  3F3F C;  3CC4 Z;  4E32 A;  1RNI A;  4S1T A;  3CC4 1;  2B63 I;  2DE5 A;  1SIW A;  3G4S 1;  2W03 A;  1VQ8 1;  3MZK B;  2WB1 A;  4NBD A;  4RS4 A;  1RO0 A;  1Q81 1;  3VMH A;  2J6A A;  1I6H I;  3IF8 A;  1VQ4 Z;  2QA4 Z;  1VQP 1;  1WCM I;  1VQK Z;  1USP A;  3D6W A;  3IX0 A;  1N8R 2;  1NJI 2;  2JIR A;  4NOZ A;  2P28 A;  1VQ9 1;  2O53 A;  3PO3 I;  1KQS Z;  3CCE 1;  2HU9 A;  1USP B;  3CCJ Z;  1WW9 A;  1X0T A;  2KI7 B;  3HOX I;  4QTU A;  3TE5 B;  2JUB A;  1Y8C A;  1M1K 1;  3EER A;  1Z01 A;  5IT9 b;  4A3E I;  3S16 I;  4NBC A;  3GTL I;  1YJ9 Z;  1KD1 2;  1K9M 2;  2HF1 A;  1S7M A;  1VQO Z;  3CCR Z;  4DGL A;  1YIT Z;  4E2X A;  2QRC B;  2LFU A;  3CC7 1;  3CD6 1;  3G6E 1;  3CME Z;  4NB8 A;  4RVH A;  2R93 I;  2DE6 A;  1QVF Y;  3NH8 A;  1ML8 A;  1TWF I;  2JA5 I;  4MH4 A;  3S2D I;  2K3R A;  3M4O I;  1RO4 A;  2NVY I;  4BY7 I;  5D1P A;  2LIY A;  4NH1 C;  1AA6 A;  3CCS 1;  3H3V J;  3CC7 Z;  3S15 I;  4RV9 A;  5D1O A;  2IZ3 A;  3KIH A;  1W2B Y;  1Z03 A;  1RO2 A;  1VQ6 1;  3GTK I;  4A3M I;  3I4M I;  1QVG Z;  1VQ8 Z;  3OW2 Y;  4MON A;  1VQM 1;  1KD1 1;  1NJI 1;  3S1R I;  4A3G I;  1ZB9 A;  1TWG I;  3D9X A;  3NH5 A;  5FLX f;  4A3F I;  2NAP A;  1YJN 1;  3CCQ 1;  1YJN Z;  2O4H A;  3D2L A;  2R7Z I;  3I07 A;  2GTH A;  4NBB A;  4AYB A;  2R6M A;  2F4O A;  3LUS A;  4HH4 A;  1Q82 1;  2M48 A;  3CXC Y;  1Q16 A;  1YJW Z;  1YUA A;  1VQ7 1;  3GTG I;  2VPW A;  1QF8 A;  2OOY B;  2RBL A;  1VQ4 1;  3HKZ A;  2IV2 X;  2AKL A;  1YIJ 1;  3HOY I;  2VPZ A;  2V8J A;  3VMI A;  1N8R 1;  1WJ2 A;  3VTN A;  2WAQ A;  1VQ5 1;  1JJ2 Y;  4NBG A;  4DK1 A;  2RPR A;  2NVT I;  2OTJ 1;  3J81 b;  1Y1V I;  1S72 1;  1TWH I;  3HOV I;  1K83 I;  2E9H A;  5IT9 f;  3S2H I;  1YJ9 1;  2GU2 A;  1VQO 1;  3KIF A;  1YIJ Z;  3FQQ A;  4A3I I;  3CD6 Z;  3CCS Z;  2VUM I;  3BG1 B;  3CME 1;  2F4M A;  1QXF A;  3GTP I;  3I56 1;  1RLY A;  2VUG A;  2QRD B;  1KC8 2;  3J81 f;  4Y52 I;  2NVX I;  2EGT A;  5C3E I;  2Q51 A;  1VQM Z;  3I55 1;  3CCV Z;  1Z02 A;  1WII A;  2V8I A;  3CCQ Z;  5CM2 M;  1X3Z A;  4DQY B;  4MD7 A;  3H0G I;  1Q82 2;  2QEX 1;  2PMZ A;  1SFO I;  1K8A 2;  3GTM I;  3S14 I;  1K9M 1;  3GTQ I;  2AYD A;  3G4S Z;  4A3D I;  2YAD A;  2I3C A;  1Y1W I;  1TFI A;  1Q86 1;  3I55 Z;  2OZK A;  1KRL A;  4MD9 A;  2IZ4 A;  1VQP Z;  3VB9 A;  4A3L I;  2LEX A;  4A93 I;  2JIM A;  4QTT A;  1VQ5 Z;  5C4J I;  2JNY A;  5C4X I;  1YUK A;  1W2B Z;  1TWA I;  3K7A I;  3NFZ A;  2OTL 1;  1VQN 1;  4X6A I;  3J80 b;  2VPY A;  5AN9 F;  2JIQ A;  5A2Q b;  4E2Y A;  2KPI A;  1LQL A;  5A2Q f;  3S1N I;  2VPX A;  2Q4Z A;  3NDI A;  3IFU A;  1YI2 Z;  1YI2 1;  1I3Q I;  1KC8 1;  4RVG A;  4RVD A;  1JJ2 Z;  1P9N A;  4MXU A;  2R92 I;  1ZH1 A;  2V3V A;  1JWH C;  3JAM b;  1NUI A;  1ZB8 A;  1QVG Y;  1DL6 A;  4NFR A;  3CXC Z;  3HOZ I;  2PK7 A;  3CCR 1;  3S17 I;  1Q86 2;  2G2K A;  4A3J I;  3CCM Z;  3CMA Z;  2RHB A;  4XX2 A;  5C44 I;  2OOX B;  3CQZ I;  3CPW Z;  3PO3 S;  5FLM I;  3CPW Y;  3QWU A;  1Q7Y 1;  1K73 1;  2DE7 A;  2V45 A;  5IP9 I;  5LL6 f;  1FDI A;  1VQL 1;  1K73 2;  1YHQ 1;  3CCU Z;  1VQL Z;  2QR1 B;  1Q7Y 2;  4A3K I;  3I56 Z;  2BJO A;  2W04 A;  1FDO A;  1PFT A;  1M1K 2;  4BBS I;  1L1O C;  3IR7 A;  3TDH B;  4BY1 I;  4HGZ A;  4MD8 A;  4NBF A;  2JIP A;  1TWC I;  1K8A 1;  3CCU 1;  3HOW I;  2E2H I;  3CCL Z;  3VMG A;  4RVF A;  3OW2 Z;  3G71 1;  2QA4 1;  1Y1V S;  2V8K A;  3J80 f;  3T4N B;  3GTJ I;  1VQK 1;  4Y7N I;  2QLV B;  4EWC A;  2E2I I;  2QRE B;  2OTL Z;  1VQN Z;  2M6N A;  3BG0 B;  1VQ9 Z;  3FKI I;  1YJW 1;  1VQ7 Z;  4HGY A;  3CCE Z;  3CCJ 1;  1QYP A;  3P5J B;  3MON A;  1Q81 2;  1M90 2;  3RZD I;  4E33 A;  1QVF Z;  4E2W A;  2JR6 A;  1NP6 A;  2RIQ A;  3FQM A;  4E31 A;  4TNU A;  3CMA 1;  1X3W A;  3M3Y I;  4NBE A; 
#chains in the Genus database with same CATH homology
 5T6B A;  2OTJ Z;  2E2J I;  2H85 A;  2ZAE B;  3GTO I;  3S1M I;  3NDJ A;  3CC2 1;  2PM9 A;  4A3C I;  3GCF A;  3CC2 Z;  3PO2 I;  5T67 A;  4BBR I;  5FLX b;  4MRI A;  2K5R A;  2RT9 A;  1VLA A;  1N2F A;  3HOU I;  1YIT 1;  1KQS Y;  4E2Z A;  3CCM 1;  2JA8 I;  2YU9 I;  2VF1 A;  3G6E Z;  3GTM S;  3GKQ A;  3S1Q I;  3U50 C;  3JAM f;  1R9T I;  5IP7 I;  2Y0S A;  1S72 Z;  3MZL B;  4CL1 A;  2JA6 I;  3F3P C;  2QKD A;  5T64 A;  1M90 1;  2NVQ I;  2GTI A;  1YHQ Z;  5D1O B;  3EED A;  4NB9 A;  1RQF A;  3I4N I;  3CCL 1;  2JMO A;  3CCV 1;  4BXX I;  2JA7 I;  4NBH A;  1I50 I;  3NH4 A;  2JS4 A;  3G71 Z;  3Q87 A;  4E30 A;  2QEX Z;  4NBA A;  1VQ6 Z;  4A3B I;  3RZO I;  3J7A 4;  3ESW A;  2P3Y A;  3F3F C;  3CC4 Z;  4E32 A;  1RNI A;  4S1T A;  3CC4 1;  2B63 I;  2DE5 A;  3G4S 1;  2W03 A;  1VQ8 1;  3MZK B;  2WB1 A;  4NBD A;  4RS4 A;  1RO0 A;  1Q81 1;  3VMH A;  2J6A A;  1I6H I;  3IF8 A;  1VQ4 Z;  2QA4 Z;  1VQP 1;  1WCM I;  1VQK Z;  1USP A;  3D6W A;  3IX0 A;  1N8R 2;  1NJI 2;  4NOZ A;  2P28 A;  1VQ9 1;  2O53 A;  3PO3 I;  1KQS Z;  3CCE 1;  2HU9 A;  1USP B;  3CCJ Z;  1WW9 A;  1X0T A;  2KI7 B;  3HOX I;  4QTU A;  3TE5 B;  2JUB A;  1M1K 1;  3EER A;  1Z01 A;  5IT9 b;  4A3E I;  3S16 I;  4NBC A;  3GTL I;  1YJ9 Z;  1KD1 2;  1K9M 2;  2HF1 A;  1S7M A;  1VQO Z;  3CCR Z;  4DGL A;  1YIT Z;  4E2X A;  2QRC B;  2LFU A;  3CC7 1;  3CD6 1;  3G6E 1;  3CME Z;  4NB8 A;  4RVH A;  2R93 I;  2DE6 A;  1QVF Y;  3NH8 A;  1ML8 A;  1TWF I;  2JA5 I;  4MH4 A;  3S2D I;  2K3R A;  3M4O I;  1RO4 A;  2NVY I;  4BY7 I;  5D1P A;  2LIY A;  4NH1 C;  3CCS 1;  3H3V J;  3CC7 Z;  3S15 I;  4RV9 A;  5D1O A;  2IZ3 A;  3KIH A;  1W2B Y;  1Z03 A;  1RO2 A;  1VQ6 1;  3GTK I;  4A3M I;  3I4M I;  1QVG Z;  1VQ8 Z;  3OW2 Y;  4MON A;  1VQM 1;  1KD1 1;  1NJI 1;  3S1R I;  4A3G I;  1ZB9 A;  1TWG I;  3D9X A;  3NH5 A;  5FLX f;  4A3F I;  1YJN 1;  3CCQ 1;  1YJN Z;  2O4H A;  2R7Z I;  3I07 A;  2GTH A;  4NBB A;  4AYB A;  2R6M A;  2F4O A;  3LUS A;  4HH4 A;  1Q82 1;  2M48 A;  3CXC Y;  1YJW Z;  1YUA A;  1VQ7 1;  3GTG I;  1QF8 A;  2OOY B;  2RBL A;  1VQ4 1;  3HKZ A;  2AKL A;  1YIJ 1;  3HOY I;  2V8J A;  3VMI A;  1N8R 1;  3VTN A;  2WAQ A;  1VQ5 1;  1JJ2 Y;  4NBG A;  4DK1 A;  2RPR A;  2NVT I;  2OTJ 1;  3J81 b;  1Y1V I;  1S72 1;  1TWH I;  3HOV I;  1K83 I;  2E9H A;  5IT9 f;  3S2H I;  1YJ9 1;  2GU2 A;  1VQO 1;  3KIF A;  1YIJ Z;  3FQQ A;  4A3I I;  3CD6 Z;  3CCS Z;  2VUM I;  3BG1 B;  3CME 1;  2F4M A;  3GTP I;  3I56 1;  1RLY A;  2VUG A;  2QRD B;  1KC8 2;  3J81 f;  4Y52 I;  2NVX I;  2EGT A;  5C3E I;  2Q51 A;  1VQM Z;  3I55 1;  3CCV Z;  1Z02 A;  1WII A;  2V8I A;  3CCQ Z;  5CM2 M;  1X3Z A;  4DQY B;  4MD7 A;  3H0G I;  1Q82 2;  2QEX 1;  2PMZ A;  1SFO I;  1K8A 2;  3GTM I;  3S14 I;  1K9M 1;  3GTQ I;  3G4S Z;  4A3D I;  2YAD A;  2I3C A;  1Y1W I;  1TFI A;  1Q86 1;  3I55 Z;  2OZK A;  1KRL A;  4MD9 A;  2IZ4 A;  1VQP Z;  3VB9 A;  4A3L I;  4A93 I;  4QTT A;  1VQ5 Z;  5C4J I;  2JNY A;  5C4X I;  1YUK A;  1W2B Z;  1TWA I;  3K7A I;  3NFZ A;  2OTL 1;  1VQN 1;  4X6A I;  3J80 b;  5AN9 F;  5A2Q b;  4E2Y A;  2KPI A;  1LQL A;  5A2Q f;  3S1N I;  2Q4Z A;  3NDI A;  3IFU A;  1YI2 Z;  1YI2 1;  1I3Q I;  1KC8 1;  4RVG A;  4RVD A;  1JJ2 Z;  1P9N A;  4MXU A;  2R92 I;  1ZH1 A;  1JWH C;  3JAM b;  1NUI A;  1ZB8 A;  1QVG Y;  1DL6 A;  4NFR A;  3CXC Z;  3HOZ I;  2PK7 A;  3CCR 1;  3S17 I;  1Q86 2;  2G2K A;  4A3J I;  3CCM Z;  3CMA Z;  2RHB A;  4XX2 A;  5C44 I;  2OOX B;  3CQZ I;  3CPW Z;  3PO3 S;  5FLM I;  3CPW Y;  3QWU A;  1Q7Y 1;  1K73 1;  2DE7 A;  5IP9 I;  5LL6 f;  1VQL 1;  1K73 2;  1YHQ 1;  3CCU Z;  1VQL Z;  2QR1 B;  1Q7Y 2;  4A3K I;  3I56 Z;  2BJO A;  2W04 A;  1PFT A;  1M1K 2;  4BBS I;  1L1O C;  3TDH B;  4BY1 I;  4HGZ A;  4MD8 A;  4NBF A;  1TWC I;  1K8A 1;  3CCU 1;  3HOW I;  2E2H I;  3CCL Z;  3VMG A;  4RVF A;  3OW2 Z;  3G71 1;  2QA4 1;  1Y1V S;  2V8K A;  3J80 f;  3T4N B;  3GTJ I;  1VQK 1;  4Y7N I;  2QLV B;  4EWC A;  2E2I I;  2QRE B;  2OTL Z;  1VQN Z;  2M6N A;  3BG0 B;  1VQ9 Z;  3FKI I;  1YJW 1;  1VQ7 Z;  4HGY A;  3CCE Z;  3CCJ 1;  1QYP A;  3P5J B;  3MON A;  1Q81 2;  1M90 2;  3RZD I;  4E33 A;  1QVF Z;  4E2W A;  2JR6 A;  1NP6 A;  2RIQ A;  3FQM A;  4E31 A;  4TNU A;  3CMA 1;  1X3W A;  3M3Y I;  4NBE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...