1TWFI

Rna polymerase ii complexed with utp at 2.3 a resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
122
structure length
122
Chain Sequence
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
total genus 17
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1twfI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1twfI02
3I4NI 2HF1A 2F4MA 4NB9A 3M3YI 3HOYI 1TWAI 2JR6A 3I07A 1K83I 1Y1VS 3S14I 3GTLI 1I3QI 1RO4A 2DE5A 1I6HI 3S1RI 2BJOA 4NBBA 3H0GI 3PO2I 1TWHI 3GTJI 1QYPA 4A3EI 4X6AI 1TWCI 2VUMI 2JA8I 3S16I 5FLMI 3S1QI 3VMGA 1SFOI 3GCFA 1I50I 3M4OI 4NOZA 2R93I 1YUAA 5C44I 5C3EI 5C4XI 2J6AA 2B63I 1VLAA 5IP7I 4A3KI 4BY1I 4A93I 3U50C 3VMHA 2RBLA 4NB8A 2R7ZI 2K5RA 1USPA 1R9TI 5CM2M 1NUIA 1ZB8A 4MH4A 4A3II 3GTQI 1ZB9A 2AKLA 5C4JI 3ESWA 2E2II 3GTMS 4BBRI 4NBEA 3CQZI 3EERA 3VMIA 3LUSA 2F4OA 4NBDA 4A3BI 4A3LI 5IP9I 1Y1VI 3Q87A 1DL6A 3GTPI 2E2JI 3S2DI 3D6WA 4NBFA 3PO3I 2PK7A 2YU9I 4BXXI 3HOVI 2JS4A 4A3CI 3GKQA 3S17I 3GTOI 3HOWI 3HOZI 3S15I 1N2FA 2DE6A 2JA5I 1RLYA 2E2HI 3I4MI 3S1NI 1X3ZA 2JNYA 4QTTA 2JA6I 3K7AI 3PO3S 3GTKI 1TFIA 2DE7A 4A3JI 2R92I 1Y1WI 2JA7I 1X3WA 1L1OC 4NBHA 4A3FI 4Y7NI 3FKII 3HOUI 1PFTA 4NBAA 1TWGI 2P3YA 4NBGA 4A3DI 4BBSI 2KPIA 3VB9A 1TWFI 4QTUA 3RZOI 4XX2A 2NVXI 3GTGI 4A3MI 3S2HI 1ML8A 1LQLA 3HOXI 3GTMI 3S1MI 4Y52I 3RZDI 1WW9A 2NVTI 2NVQI 1WCMI 1USPB 4A3GI 3H3VJ 4BY7I 4NBCA 2NVYI
chains in the Genus database with same CATH superfamily
4NB9A 3CCLZ 1VQ71 2QA41 3J80f 1Q821 1N8R1 1QVGY 3CMEZ 1RO4A 3GTLI 2OTJ1 1Q822 2VF1A 3H0GI 1NJI2 1TWHI 4AYBA 3GTJI 1QYPA 2OTL1 2WAQA 1Q812 4E31A 3NH8A 3S16I 4S1TA 4HH4A 3S1QI 3VMGA 4NOZA 3NDIA 2V8JA 2R93I 1YHQZ 2RIQA 3CXCY 1WZNA 1K8A2 3G4S1 2R7ZI 2Y0SA 2K5RA 1USPA 3EEDA 4DGLA 4E2ZA 4RVHA 5A2Qb 3CCEZ 2WB1A 1ZB9A 3CCU1 4RVDA 4NFRA 1VQK1 1FDIA 5A2Qf 2QEXZ 3QWUA 2RPRA 4HGZA 4A3BI 4A3LI 1KQSY 2PMZA 2AYDA 3Q87A 4MONA 3GTPI 1DL6A 3CCVZ 3I551 1VQO1 5AN9F 4NBFA 2PK7A 3CC7Z 4BXXI 3HOVI 1KQSZ 4A3CI 3GKQA 4MRIA 1VQ41 2E9HA 1Z03A 3HOZI 1FDOA 1VQ5Z 2JA5I 3G711 1RLYA 4MD7A 4HGYA 2IZ4A 3CCV1 2G2KA 2JNYA 2JA6I 3PO3S 1TFIA 4A3JI 2JA7I 3CCM1 2GTHA 3HOUI 3G6EZ 1VQ91 1QF8A 4NBGA 4A3DI 3VB9A 3RZOI 4XX2A 3GTGI 4A3MI 1ML8A 4Y52I 3RZDI 1WW9A 3NFZA 1Q862 3CXCZ 1RO0A 1Q811 2NVYI 3I4NI 2QRCB 1VQM1 3M3YI 3JAMb 5FLXb 1YJWZ 1M1K1 3MONA 1YJW1 3I07A 1VQMZ 1K9M1 3F3PC 1I6HI 2DE5A 1K8A1 2BJOA 4A3EI 3D2LA 1TWCI 4CL1A 2JA8I 3NDJA 3HKZA 5T64A 1RQFA 3GCFA 3M4OI 5C3EI 3G6E1 4EWCA 3BG1B 5T67A 3IX0A 1YJN1 2J6AA 4RVGA 2JIRA 1VQ81 5IP7I 3U50C 1Q7Y2 1VQ51 1NUIA 1Q861 3G4SZ 3GTQI 1KC81 1QVFY 3MZKB 3ESWA 2V8IA 4RV9A 4BBRI 4NBEA 2Q51A 3LUSA 3VTNA 1RNIA 1W2BY 1YJNZ 1WJ2A 2OOXB 2OTJZ 4E2WA 2QRDB 3D6WA 2YU9I 5D1OB 1K732 2JS4A 1VQP1 1W2BZ 3GTOI 2LFUA 1NP6A 2M6NA 3IFUA 3S1NI 1X3ZA 1YIJZ 4QTTA 3K7AI 1ZH1A 1QVGZ 2R92I 3CC71 2H85A 2RT9A 1PFTA 4NBAA 2P3YA 1K9M2 2K3RA 1TWFI 3S2HI 1S72Z 3J81f 3S1MI 2V8KA 1YUKA 2IZ3A 1QXFA 3J80b 3CME1 1KD12 2HU9A 2F4MA 4TNUA 2QA4Z 3D9XA 1VQ7Z 1S721 4NH1C 2JMOA 1Q16A 3FQQA 2OZKA 2VPWA 3S1RI 4NBBA 1JJ2Z 1VQ4Z 4X6AI 4MD9A 2VUMI 2GTIA 3T4NB 5FLMI 2YADA 1I50I 5FLXf 1YUAA 3CCJZ 5C44I 3FQMA 3OW2Z 3I561 1K731 2JUBA 5D1OA 2O4HA 5IT9f 2I3CA 2R6MA 1M901 2RBLA 1VQ6Z 1R9TI 1X0TA 4RS4A 4E32A 1VQKZ 1VQ9Z 2QLVB 3CC41 1Y8CA 1YJ9Z 3CCUZ 3MZLB 4A3II 2NAPA 1P9NA 2E2II 3IF8A 4E30A 3CQZI 3EERA 1Z02A 5LL6f 2W04A 3VMIA 4NBDA 2V45A 3J81b 1Y1VI 1VQNZ 1YIT1 3KIHA 2LIYA 1SIWA 2Q4ZA 3JAMf 3S17I 1VQ8Z 2JIQA 1N2FA 2DE6A 2QEX1 1VQLZ 4DK1A 1WIIA 2DE7A 2VUGA 4Y7NI 3CCQZ 3CCQ1 1S7MA 2KPIA 1N8R2 4QTUA 5IT9b 3NH4A 1LQLA 3HOXI 3GTMI 2P28A 2NVTI 2NVQI 1WCMI 1VQOZ 3I55Z 3CPWZ 3OW2Y 4BY7I 5D1PA 2M48A 3CD61 2HF1A 1VQ61 4E2YA 1TWAI 3HOYI 2JR6A 1K83I 1Y1VS 3S14I 1I3QI 2PM9A 2KI7B 1YITZ 2LEXA 3PO2I 1M1K2 4MD8A 1QVFZ 3CCMZ 3CCE1 1SFOI 1YI2Z 2VPYA 3G71Z 1JJ2Y 2IV2X 5C4XI 2QREB 2B63I 1VLAA 2O53A 3CMAZ 2QKDA 2W03A 4A3KI 2JIPA 3BG0B 4BY1I 4A93I 4MXUA 2V3VA 2JIMA 3P5JB 1VQL1 3VMHA 4NB8A 1YJ91 5CM2M 2OOYB 1RO2A 1ZB8A 4MH4A 1M902 2VPZA 2AKLA 5C4JI 2RHBA 3GTMS 1Z01A 1NJI1 3I56Z 3CD6Z 3CCJ1 3CC21 2E7ZA 2F4OA 3CMA1 5IP9I 4RVFA 3CCR1 2EGTA 1YIJ1 2E2JI 3KIFA 3S2DI 1YI21 2ZAEB 3PO3I 3TE5B 3CCRZ 3CCSZ 1VQPZ 4E2XA 2QR1B 3CPWY 1KRLA 3NH5A 3J7A4 3HOWI 3S15I 3CC2Z 1KD11 3CC4Z 3TDHB 1YHQ1 3F3FC 2E2HI 3I4MI 4DQYB 2GU2A 1Q7Y1 3GTKI 1Y1WI 2OTLZ 1X3WA 1AA6A 1L1OC 4NBHA 4A3FI 3FKII 1TWGI 4BBSI 1VQN1 5T6BA 3IR7A 2NVXI 4E33A 2VPXA 3CCL1 3CCS1 2JIOA 1USPB 4A3GI 1JWHC 3H3VJ 4NBCA 1KC82
chains in the Genus database with same CATH topology
4NB9A 3CCLZ 1VQ71 2QA41 3J80f 1Q821 1N8R1 1QVGY 3CMEZ 1RO4A 3GTLI 2OTJ1 1Q822 2VF1A 3H0GI 1NJI2 1TWHI 4AYBA 3GTJI 1QYPA 2OTL1 2WAQA 1Q812 4E31A 3NH8A 3S16I 4S1TA 4HH4A 3S1QI 3VMGA 4NOZA 3NDIA 2V8JA 2R93I 1YHQZ 2RIQA 3CXCY 1K8A2 3G4S1 2R7ZI 2Y0SA 2K5RA 1USPA 3EEDA 4DGLA 4E2ZA 4RVHA 5A2Qb 3CCEZ 2WB1A 1ZB9A 3CCU1 4RVDA 4NFRA 1VQK1 5A2Qf 2QEXZ 3QWUA 2RPRA 4HGZA 4A3BI 4A3LI 1KQSY 2PMZA 3Q87A 4MONA 3GTPI 1DL6A 3CCVZ 3I551 1VQO1 5AN9F 4NBFA 2PK7A 3CC7Z 4BXXI 3HOVI 1KQSZ 4A3CI 3GKQA 4MRIA 1VQ41 2E9HA 1Z03A 3HOZI 1VQ5Z 2JA5I 3G711 1RLYA 4MD7A 4HGYA 2IZ4A 3CCV1 2G2KA 2JNYA 2JA6I 3PO3S 1TFIA 4A3JI 2JA7I 3CCM1 2GTHA 3HOUI 3G6EZ 1VQ91 1QF8A 4NBGA 4A3DI 3VB9A 3RZOI 4XX2A 3GTGI 4A3MI 1ML8A 4Y52I 3RZDI 1WW9A 3NFZA 1Q862 3CXCZ 1RO0A 1Q811 2NVYI 3I4NI 2QRCB 1VQM1 3M3YI 3JAMb 5FLXb 1YJWZ 1M1K1 3MONA 1YJW1 3I07A 1VQMZ 1K9M1 3F3PC 1I6HI 2DE5A 1K8A1 2BJOA 4A3EI 1TWCI 4CL1A 2JA8I 3NDJA 3HKZA 5T64A 1RQFA 3GCFA 3M4OI 5C3EI 3G6E1 4EWCA 3BG1B 5T67A 3IX0A 1YJN1 2J6AA 4RVGA 1VQ81 5IP7I 3U50C 1Q7Y2 1VQ51 1NUIA 1Q861 3G4SZ 3GTQI 1KC81 1QVFY 3MZKB 3ESWA 2V8IA 4RV9A 4BBRI 4NBEA 2Q51A 3LUSA 3VTNA 1RNIA 1W2BY 1YJNZ 2OOXB 2OTJZ 4E2WA 2QRDB 3D6WA 2YU9I 5D1OB 1K732 2JS4A 1VQP1 1W2BZ 3GTOI 2LFUA 1NP6A 2M6NA 3IFUA 3S1NI 1X3ZA 1YIJZ 4QTTA 3K7AI 1ZH1A 1QVGZ 2R92I 3CC71 2H85A 2RT9A 1PFTA 4NBAA 2P3YA 1K9M2 2K3RA 1TWFI 3S2HI 1S72Z 3J81f 3S1MI 2V8KA 1YUKA 2IZ3A 3J80b 3CME1 1KD12 2HU9A 2F4MA 4TNUA 2QA4Z 3D9XA 1VQ7Z 1S721 4NH1C 2JMOA 3FQQA 2OZKA 3S1RI 4NBBA 1JJ2Z 1VQ4Z 4X6AI 4MD9A 2VUMI 2GTIA 3T4NB 5FLMI 2YADA 1I50I 5FLXf 1YUAA 3CCJZ 5C44I 3FQMA 3OW2Z 3I561 1K731 2JUBA 5D1OA 2O4HA 5IT9f 2I3CA 2R6MA 1M901 2RBLA 1VQ6Z 1R9TI 1X0TA 4RS4A 4E32A 1VQKZ 1VQ9Z 2QLVB 3CC41 1YJ9Z 3CCUZ 3MZLB 4A3II 1P9NA 2E2II 3IF8A 4E30A 3CQZI 3EERA 1Z02A 5LL6f 2W04A 3VMIA 4NBDA 3J81b 1Y1VI 1VQNZ 1YIT1 3KIHA 2LIYA 2Q4ZA 3JAMf 3S17I 1VQ8Z 1N2FA 2DE6A 2QEX1 1VQLZ 4DK1A 1WIIA 2DE7A 2VUGA 4Y7NI 3CCQZ 3CCQ1 1S7MA 2KPIA 1N8R2 4QTUA 5IT9b 3NH4A 1LQLA 3HOXI 3GTMI 2P28A 2NVTI 2NVQI 1WCMI 1VQOZ 3I55Z 3CPWZ 3OW2Y 4BY7I 5D1PA 2M48A 3CD61 2HF1A 1VQ61 4E2YA 1TWAI 3HOYI 2JR6A 1K83I 1Y1VS 3S14I 1I3QI 2PM9A 2KI7B 1YITZ 3PO2I 1M1K2 4MD8A 1QVFZ 3CCMZ 3CCE1 1SFOI 1YI2Z 3G71Z 1JJ2Y 5C4XI 2QREB 2B63I 1VLAA 2O53A 3CMAZ 2QKDA 2W03A 4A3KI 3BG0B 4BY1I 4A93I 4MXUA 3P5JB 1VQL1 3VMHA 4NB8A 1YJ91 5CM2M 2OOYB 1RO2A 1ZB8A 4MH4A 1M902 2AKLA 5C4JI 2RHBA 3GTMS 1Z01A 1NJI1 3I56Z 3CD6Z 3CCJ1 3CC21 2F4OA 3CMA1 5IP9I 4RVFA 3CCR1 2EGTA 1YIJ1 2E2JI 3KIFA 3S2DI 1YI21 2ZAEB 3PO3I 3TE5B 3CCRZ 3CCSZ 1VQPZ 4E2XA 2QR1B 3CPWY 1KRLA 3NH5A 3J7A4 3HOWI 3S15I 3CC2Z 1KD11 3CC4Z 3TDHB 1YHQ1 3F3FC 2E2HI 3I4MI 4DQYB 2GU2A 1Q7Y1 3GTKI 1Y1WI 2OTLZ 1X3WA 1L1OC 4NBHA 4A3FI 3FKII 1TWGI 4BBSI 1VQN1 5T6BA 2NVXI 4E33A 3CCL1 3CCS1 1USPB 4A3GI 1JWHC 3H3VJ 4NBCA 1KC82
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I4N I;  2HF1 A;  2F4M A;  4NB9 A;  3M3Y I;  3HOY I;  1TWA I;  2JR6 A;  3I07 A;  1K83 I;  1Y1V S;  3S14 I;  3GTL I;  1I3Q I;  1RO4 A;  2DE5 A;  1I6H I;  3S1R I;  2BJO A;  4NBB A;  3H0G I;  3PO2 I;  1TWH I;  3GTJ I;  1QYP A;  4A3E I;  4X6A I;  1TWC I;  2VUM I;  2JA8 I;  3S16 I;  5FLM I;  3S1Q I;  3VMG A;  1SFO I;  3GCF A;  1I50 I;  3M4O I;  4NOZ A;  2R93 I;  1YUA A;  5C44 I;  5C3E I;  5C4X I;  2J6A A;  2B63 I;  1VLA A;  5IP7 I;  4A3K I;  4BY1 I;  4A93 I;  3U50 C;  3VMH A;  2RBL A;  4NB8 A;  2R7Z I;  2K5R A;  1USP A;  1R9T I;  5CM2 M;  1NUI A;  1ZB8 A;  4MH4 A;  4A3I I;  3GTQ I;  1ZB9 A;  2AKL A;  5C4J I;  3ESW A;  2E2I I;  3GTM S;  4BBR I;  4NBE A;  3CQZ I;  3EER A;  3VMI A;  3LUS A;  2F4O A;  4NBD A;  4A3B I;  4A3L I;  5IP9 I;  1Y1V I;  3Q87 A;  1DL6 A;  3GTP I;  2E2J I;  3S2D I;  3D6W A;  4NBF A;  3PO3 I;  2PK7 A;  2YU9 I;  4BXX I;  3HOV I;  2JS4 A;  4A3C I;  3GKQ A;  3S17 I;  3GTO I;  3HOW I;  3HOZ I;  3S15 I;  1N2F A;  2DE6 A;  2JA5 I;  1RLY A;  2E2H I;  3I4M I;  3S1N I;  1X3Z A;  2JNY A;  4QTT A;  2JA6 I;  3K7A I;  3PO3 S;  3GTK I;  1TFI A;  2DE7 A;  4A3J I;  2R92 I;  1Y1W I;  2JA7 I;  1X3W A;  1L1O C;  4NBH A;  4A3F I;  4Y7N I;  3FKI I;  3HOU I;  1PFT A;  4NBA A;  1TWG I;  2P3Y A;  4NBG A;  4A3D I;  4BBS I;  2KPI A;  3VB9 A;  1TWF I;  4QTU A;  3RZO I;  4XX2 A;  2NVX I;  3GTG I;  4A3M I;  3S2H I;  1ML8 A;  1LQL A;  3HOX I;  3GTM I;  3S1M I;  4Y52 I;  3RZD I;  1WW9 A;  2NVT I;  2NVQ I;  1WCM I;  1USP B;  4A3G I;  3H3V J;  4BY7 I;  4NBC A;  2NVY I; 
#chains in the Genus database with same CATH topology
 4NB9 A;  3CCL Z;  1VQ7 1;  2QA4 1;  3J80 f;  1Q82 1;  1N8R 1;  1QVG Y;  3CME Z;  1RO4 A;  3GTL I;  2OTJ 1;  1Q82 2;  2VF1 A;  3H0G I;  1NJI 2;  1TWH I;  4AYB A;  3GTJ I;  1QYP A;  2OTL 1;  2WAQ A;  1Q81 2;  4E31 A;  3NH8 A;  3S16 I;  4S1T A;  4HH4 A;  3S1Q I;  3VMG A;  4NOZ A;  3NDI A;  2V8J A;  2R93 I;  1YHQ Z;  2RIQ A;  3CXC Y;  1WZN A;  1K8A 2;  3G4S 1;  2R7Z I;  2Y0S A;  2K5R A;  1USP A;  3EED A;  4DGL A;  4E2Z A;  4RVH A;  5A2Q b;  3CCE Z;  2WB1 A;  1ZB9 A;  3CCU 1;  4RVD A;  4NFR A;  1VQK 1;  1FDI A;  5A2Q f;  2QEX Z;  3QWU A;  2RPR A;  4HGZ A;  4A3B I;  4A3L I;  1KQS Y;  2PMZ A;  2AYD A;  3Q87 A;  4MON A;  3GTP I;  1DL6 A;  3CCV Z;  3I55 1;  1VQO 1;  5AN9 F;  4NBF A;  2PK7 A;  3CC7 Z;  4BXX I;  3HOV I;  1KQS Z;  4A3C I;  3GKQ A;  4MRI A;  1VQ4 1;  2E9H A;  1Z03 A;  3HOZ I;  1FDO A;  1VQ5 Z;  2JA5 I;  3G71 1;  1RLY A;  4MD7 A;  4HGY A;  2IZ4 A;  3CCV 1;  2G2K A;  2JNY A;  2JA6 I;  3PO3 S;  1TFI A;  4A3J I;  2JA7 I;  3CCM 1;  2GTH A;  3HOU I;  3G6E Z;  1VQ9 1;  1QF8 A;  4NBG A;  4A3D I;  3VB9 A;  3RZO I;  4XX2 A;  3GTG I;  4A3M I;  1ML8 A;  4Y52 I;  3RZD I;  1WW9 A;  3NFZ A;  1Q86 2;  3CXC Z;  1RO0 A;  1Q81 1;  2NVY I;  3I4N I;  2QRC B;  1VQM 1;  3M3Y I;  3JAM b;  5FLX b;  1YJW Z;  1M1K 1;  3MON A;  1YJW 1;  3I07 A;  1VQM Z;  1K9M 1;  3F3P C;  1I6H I;  2DE5 A;  1K8A 1;  2BJO A;  4A3E I;  3D2L A;  1TWC I;  4CL1 A;  2JA8 I;  3NDJ A;  3HKZ A;  5T64 A;  1RQF A;  3GCF A;  3M4O I;  5C3E I;  3G6E 1;  4EWC A;  3BG1 B;  5T67 A;  3IX0 A;  1YJN 1;  2J6A A;  4RVG A;  2JIR A;  1VQ8 1;  5IP7 I;  3U50 C;  1Q7Y 2;  1VQ5 1;  1NUI A;  1Q86 1;  3G4S Z;  3GTQ I;  1KC8 1;  1QVF Y;  3MZK B;  3ESW A;  2V8I A;  4RV9 A;  4BBR I;  4NBE A;  2Q51 A;  3LUS A;  3VTN A;  1RNI A;  1W2B Y;  1YJN Z;  1WJ2 A;  2OOX B;  2OTJ Z;  4E2W A;  2QRD B;  3D6W A;  2YU9 I;  5D1O B;  1K73 2;  2JS4 A;  1VQP 1;  1W2B Z;  3GTO I;  2LFU A;  1NP6 A;  2M6N A;  3IFU A;  3S1N I;  1X3Z A;  1YIJ Z;  4QTT A;  3K7A I;  1ZH1 A;  1QVG Z;  2R92 I;  3CC7 1;  2H85 A;  2RT9 A;  1PFT A;  4NBA A;  2P3Y A;  1K9M 2;  2K3R A;  1TWF I;  3S2H I;  1S72 Z;  3J81 f;  3S1M I;  2V8K A;  1YUK A;  2IZ3 A;  1QXF A;  3J80 b;  3CME 1;  1KD1 2;  2HU9 A;  2F4M A;  4TNU A;  2QA4 Z;  3D9X A;  1VQ7 Z;  1S72 1;  4NH1 C;  2JMO A;  1Q16 A;  3FQQ A;  2OZK A;  2VPW A;  3S1R I;  4NBB A;  1JJ2 Z;  1VQ4 Z;  4X6A I;  4MD9 A;  2VUM I;  2GTI A;  3T4N B;  5FLM I;  2YAD A;  1I50 I;  5FLX f;  1YUA A;  3CCJ Z;  5C44 I;  3FQM A;  3OW2 Z;  3I56 1;  1K73 1;  2JUB A;  5D1O A;  2O4H A;  5IT9 f;  2I3C A;  2R6M A;  1M90 1;  2RBL A;  1VQ6 Z;  1R9T I;  1X0T A;  4RS4 A;  4E32 A;  1VQK Z;  1VQ9 Z;  2QLV B;  3CC4 1;  1Y8C A;  1YJ9 Z;  3CCU Z;  3MZL B;  4A3I I;  2NAP A;  1P9N A;  2E2I I;  3IF8 A;  4E30 A;  3CQZ I;  3EER A;  1Z02 A;  5LL6 f;  2W04 A;  3VMI A;  4NBD A;  2V45 A;  3J81 b;  1Y1V I;  1VQN Z;  1YIT 1;  3KIH A;  2LIY A;  1SIW A;  2Q4Z A;  3JAM f;  3S17 I;  1VQ8 Z;  2JIQ A;  1N2F A;  2DE6 A;  2QEX 1;  1VQL Z;  4DK1 A;  1WII A;  2DE7 A;  2VUG A;  4Y7N I;  3CCQ Z;  3CCQ 1;  1S7M A;  2KPI A;  1N8R 2;  4QTU A;  5IT9 b;  3NH4 A;  1LQL A;  3HOX I;  3GTM I;  2P28 A;  2NVT I;  2NVQ I;  1WCM I;  1VQO Z;  3I55 Z;  3CPW Z;  3OW2 Y;  4BY7 I;  5D1P A;  2M48 A;  3CD6 1;  2HF1 A;  1VQ6 1;  4E2Y A;  1TWA I;  3HOY I;  2JR6 A;  1K83 I;  1Y1V S;  3S14 I;  1I3Q I;  2PM9 A;  2KI7 B;  1YIT Z;  2LEX A;  3PO2 I;  1M1K 2;  4MD8 A;  1QVF Z;  3CCM Z;  3CCE 1;  1SFO I;  1YI2 Z;  2VPY A;  3G71 Z;  1JJ2 Y;  2IV2 X;  5C4X I;  2QRE B;  2B63 I;  1VLA A;  2O53 A;  3CMA Z;  2QKD A;  2W03 A;  4A3K I;  2JIP A;  3BG0 B;  4BY1 I;  4A93 I;  4MXU A;  2V3V A;  2JIM A;  3P5J B;  1VQL 1;  3VMH A;  4NB8 A;  1YJ9 1;  5CM2 M;  2OOY B;  1RO2 A;  1ZB8 A;  4MH4 A;  1M90 2;  2VPZ A;  2AKL A;  5C4J I;  2RHB A;  3GTM S;  1Z01 A;  1NJI 1;  3I56 Z;  3CD6 Z;  3CCJ 1;  3CC2 1;  2E7Z A;  2F4O A;  3CMA 1;  5IP9 I;  4RVF A;  3CCR 1;  2EGT A;  1YIJ 1;  2E2J I;  3KIF A;  3S2D I;  1YI2 1;  2ZAE B;  3PO3 I;  3TE5 B;  3CCR Z;  3CCS Z;  1VQP Z;  4E2X A;  2QR1 B;  3CPW Y;  1KRL A;  3NH5 A;  3J7A 4;  3HOW I;  3S15 I;  3CC2 Z;  1KD1 1;  3CC4 Z;  3TDH B;  1YHQ 1;  3F3F C;  2E2H I;  3I4M I;  4DQY B;  2GU2 A;  1Q7Y 1;  3GTK I;  1Y1W I;  2OTL Z;  1X3W A;  1AA6 A;  1L1O C;  4NBH A;  4A3F I;  3FKI I;  1TWG I;  4BBS I;  1VQN 1;  5T6B A;  3IR7 A;  2NVX I;  4E33 A;  2VPX A;  3CCL 1;  3CCS 1;  2JIO A;  1USP B;  4A3G I;  1JWH C;  3H3V J;  4NBC A;  1KC8 2; 
#chains in the Genus database with same CATH homology
 4NB9 A;  3CCL Z;  1VQ7 1;  2QA4 1;  3J80 f;  1Q82 1;  1N8R 1;  1QVG Y;  3CME Z;  1RO4 A;  3GTL I;  2OTJ 1;  1Q82 2;  2VF1 A;  3H0G I;  1NJI 2;  1TWH I;  4AYB A;  3GTJ I;  1QYP A;  2OTL 1;  2WAQ A;  1Q81 2;  4E31 A;  3NH8 A;  3S16 I;  4S1T A;  4HH4 A;  3S1Q I;  3VMG A;  4NOZ A;  3NDI A;  2V8J A;  2R93 I;  1YHQ Z;  2RIQ A;  3CXC Y;  1K8A 2;  3G4S 1;  2R7Z I;  2Y0S A;  2K5R A;  1USP A;  3EED A;  4DGL A;  4E2Z A;  4RVH A;  5A2Q b;  3CCE Z;  2WB1 A;  1ZB9 A;  3CCU 1;  4RVD A;  4NFR A;  1VQK 1;  5A2Q f;  2QEX Z;  3QWU A;  2RPR A;  4HGZ A;  4A3B I;  4A3L I;  1KQS Y;  2PMZ A;  3Q87 A;  4MON A;  3GTP I;  1DL6 A;  3CCV Z;  3I55 1;  1VQO 1;  5AN9 F;  4NBF A;  2PK7 A;  3CC7 Z;  4BXX I;  3HOV I;  1KQS Z;  4A3C I;  3GKQ A;  4MRI A;  1VQ4 1;  2E9H A;  1Z03 A;  3HOZ I;  1VQ5 Z;  2JA5 I;  3G71 1;  1RLY A;  4MD7 A;  4HGY A;  2IZ4 A;  3CCV 1;  2G2K A;  2JNY A;  2JA6 I;  3PO3 S;  1TFI A;  4A3J I;  2JA7 I;  3CCM 1;  2GTH A;  3HOU I;  3G6E Z;  1VQ9 1;  1QF8 A;  4NBG A;  4A3D I;  3VB9 A;  3RZO I;  4XX2 A;  3GTG I;  4A3M I;  1ML8 A;  4Y52 I;  3RZD I;  1WW9 A;  3NFZ A;  1Q86 2;  3CXC Z;  1RO0 A;  1Q81 1;  2NVY I;  3I4N I;  2QRC B;  1VQM 1;  3M3Y I;  3JAM b;  5FLX b;  1YJW Z;  1M1K 1;  3MON A;  1YJW 1;  3I07 A;  1VQM Z;  1K9M 1;  3F3P C;  1I6H I;  2DE5 A;  1K8A 1;  2BJO A;  4A3E I;  1TWC I;  4CL1 A;  2JA8 I;  3NDJ A;  3HKZ A;  5T64 A;  1RQF A;  3GCF A;  3M4O I;  5C3E I;  3G6E 1;  4EWC A;  3BG1 B;  5T67 A;  3IX0 A;  1YJN 1;  2J6A A;  4RVG A;  1VQ8 1;  5IP7 I;  3U50 C;  1Q7Y 2;  1VQ5 1;  1NUI A;  1Q86 1;  3G4S Z;  3GTQ I;  1KC8 1;  1QVF Y;  3MZK B;  3ESW A;  2V8I A;  4RV9 A;  4BBR I;  4NBE A;  2Q51 A;  3LUS A;  3VTN A;  1RNI A;  1W2B Y;  1YJN Z;  2OOX B;  2OTJ Z;  4E2W A;  2QRD B;  3D6W A;  2YU9 I;  5D1O B;  1K73 2;  2JS4 A;  1VQP 1;  1W2B Z;  3GTO I;  2LFU A;  1NP6 A;  2M6N A;  3IFU A;  3S1N I;  1X3Z A;  1YIJ Z;  4QTT A;  3K7A I;  1ZH1 A;  1QVG Z;  2R92 I;  3CC7 1;  2H85 A;  2RT9 A;  1PFT A;  4NBA A;  2P3Y A;  1K9M 2;  2K3R A;  1TWF I;  3S2H I;  1S72 Z;  3J81 f;  3S1M I;  2V8K A;  1YUK A;  2IZ3 A;  3J80 b;  3CME 1;  1KD1 2;  2HU9 A;  2F4M A;  4TNU A;  2QA4 Z;  3D9X A;  1VQ7 Z;  1S72 1;  4NH1 C;  2JMO A;  3FQQ A;  2OZK A;  3S1R I;  4NBB A;  1JJ2 Z;  1VQ4 Z;  4X6A I;  4MD9 A;  2VUM I;  2GTI A;  3T4N B;  5FLM I;  2YAD A;  1I50 I;  5FLX f;  1YUA A;  3CCJ Z;  5C44 I;  3FQM A;  3OW2 Z;  3I56 1;  1K73 1;  2JUB A;  5D1O A;  2O4H A;  5IT9 f;  2I3C A;  2R6M A;  1M90 1;  2RBL A;  1VQ6 Z;  1R9T I;  1X0T A;  4RS4 A;  4E32 A;  1VQK Z;  1VQ9 Z;  2QLV B;  3CC4 1;  1YJ9 Z;  3CCU Z;  3MZL B;  4A3I I;  1P9N A;  2E2I I;  3IF8 A;  4E30 A;  3CQZ I;  3EER A;  1Z02 A;  5LL6 f;  2W04 A;  3VMI A;  4NBD A;  3J81 b;  1Y1V I;  1VQN Z;  1YIT 1;  3KIH A;  2LIY A;  2Q4Z A;  3JAM f;  3S17 I;  1VQ8 Z;  1N2F A;  2DE6 A;  2QEX 1;  1VQL Z;  4DK1 A;  1WII A;  2DE7 A;  2VUG A;  4Y7N I;  3CCQ Z;  3CCQ 1;  1S7M A;  2KPI A;  1N8R 2;  4QTU A;  5IT9 b;  3NH4 A;  1LQL A;  3HOX I;  3GTM I;  2P28 A;  2NVT I;  2NVQ I;  1WCM I;  1VQO Z;  3I55 Z;  3CPW Z;  3OW2 Y;  4BY7 I;  5D1P A;  2M48 A;  3CD6 1;  2HF1 A;  1VQ6 1;  4E2Y A;  1TWA I;  3HOY I;  2JR6 A;  1K83 I;  1Y1V S;  3S14 I;  1I3Q I;  2PM9 A;  2KI7 B;  1YIT Z;  3PO2 I;  1M1K 2;  4MD8 A;  1QVF Z;  3CCM Z;  3CCE 1;  1SFO I;  1YI2 Z;  3G71 Z;  1JJ2 Y;  5C4X I;  2QRE B;  2B63 I;  1VLA A;  2O53 A;  3CMA Z;  2QKD A;  2W03 A;  4A3K I;  3BG0 B;  4BY1 I;  4A93 I;  4MXU A;  3P5J B;  1VQL 1;  3VMH A;  4NB8 A;  1YJ9 1;  5CM2 M;  2OOY B;  1RO2 A;  1ZB8 A;  4MH4 A;  1M90 2;  2AKL A;  5C4J I;  2RHB A;  3GTM S;  1Z01 A;  1NJI 1;  3I56 Z;  3CD6 Z;  3CCJ 1;  3CC2 1;  2F4O A;  3CMA 1;  5IP9 I;  4RVF A;  3CCR 1;  2EGT A;  1YIJ 1;  2E2J I;  3KIF A;  3S2D I;  1YI2 1;  2ZAE B;  3PO3 I;  3TE5 B;  3CCR Z;  3CCS Z;  1VQP Z;  4E2X A;  2QR1 B;  3CPW Y;  1KRL A;  3NH5 A;  3J7A 4;  3HOW I;  3S15 I;  3CC2 Z;  1KD1 1;  3CC4 Z;  3TDH B;  1YHQ 1;  3F3F C;  2E2H I;  3I4M I;  4DQY B;  2GU2 A;  1Q7Y 1;  3GTK I;  1Y1W I;  2OTL Z;  1X3W A;  1L1O C;  4NBH A;  4A3F I;  3FKI I;  1TWG I;  4BBS I;  1VQN 1;  5T6B A;  2NVX I;  4E33 A;  3CCL 1;  3CCS 1;  1USP B;  4A3G I;  1JWH C;  3H3V J;  4NBC A;  1KC8 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...