1TWFI

Rna polymerase ii complexed with utp at 2.3 a resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
122
structure length
122
Chain Sequence
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
total genus 17
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1twfI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1twfI02
2JA8I 1N2FA 5CM2M 3GTMI 3GTJI 2E2II 4NBFA 3PO3I 2F4OA 3H3VJ 3VMGA 1QYPA 5FLMI 2JR6A 4NBCA 4BBRI 4A3KI 3I4NI 3S17I 4MH4A 4A3EI 3HOUI 2NVTI 1NUIA 3D6WA 4NBAA 3GTMS 4A3CI 2F4MA 3GTOI 4BY1I 2VUMI 4A3FI 2R7ZI 3S1RI 2KPIA 3GTLI 4A93I 2NVQI 1TWCI 2HF1A 2RBLA 3GTKI 3VMIA 4NBBA 3FKII 1TWHI 2E2HI 3CQZI 4BY7I 3S1MI 5C3EI 3VMHA 2DE7A 3HOVI 4NBHA 4Y7NI 1L1OC 4XX2A 2B63I 1RO4A 2E2JI 3U50C 3Q87A 2JA5I 2YU9I 4A3JI 1I50I 1RLYA 2NVYI 4A3DI 2DE6A 1Y1WI 1I3QI 4NB9A 1PFTA 4NBGA 3PO2I 1DL6A 2DE5A 1WW9A 3ESWA 4BXXI 4NOZA 5C44I 3RZOI 2R93I 1WCMI 1TWAI 2JA7I 2J6AA 2P3YA 4BBSI 1TWGI 3HOZI 3M4OI 4QTTA 3S16I 4Y52I 5IP7I 4A3LI 3GTGI 1ZB9A 2NVXI 3GTQI 1X3ZA 1I6HI 4A3MI 4NBDA 5IP9I 2R92I 1VLAA 1YUAA 2JA6I 2PK7A 1USPA 3HOXI 3GTPI 3S1NI 3S15I 1TFIA 1K83I 2JNYA 1Y1VS 3H0GI 3GKQA 2JS4A 3S14I 3I07A 4A3BI 2K5RA 4QTUA 5C4XI 4A3GI 3HOYI 3VB9A 3HOWI 5C4JI 1ML8A 4NBEA 1X3WA 2AKLA 2BJOA 1SFOI 3I4MI 3RZDI 1USPB 4NB8A 1Y1VI 1R9TI 1LQLA 1TWFI 4A3II 3EERA 3S1QI 3PO3S 3S2HI 3S2DI 3M3YI 1ZB8A 3LUSA 3K7AI 3GCFA 4X6AI
chains in the Genus database with same CATH superfamily
2JA8I 1N2FA 2E2II 3PO3I 2E7ZA 2JIRA 3S17I 4A3EI 2NVTI 1NUIA 3GTMS 3CCSZ 3CCQZ 1VQ61 1M1K1 3OW2Y 3CMAZ 4A3FI 2R7ZI 1M901 5D1OB 1SIWA 1VQ81 1KD12 1YIJZ 4A93I 4RS4A 4DQYB 4NBBA 4MD7A 3I55Z 1YJW1 3CQZI 1Q7Y2 1S7MA 3HOVI 4MXUA 4NBHA 4XX2A 3CCVZ 1RO4A 4E2XA 3NH4A 2RIQA 3CME1 3Q87A 3CPWY 3MZKB 1YIT1 2JA5I 2VPYA 4HGYA 2NVYI 1Q821 2DE6A 4A3DI 2QLVB 1Y1WI 4MONA 2QEXZ 3IF8A 2DE5A 3CC41 1YI2Z 4NOZA 2V8IA 2R93I 2JIQA 1WCMI 4E2YA 2J6AA 1WJ2A 2GU2A 2Q4ZA 1VQO1 4BBSI 1NJI2 1KQSZ 1K8A2 3S16I 1ZB9A 2JMOA 1X3ZA 3J80f 2RT9A 1QVFY 1VLAA 1YUAA 2JA6I 2PK7A 1USPA 3CCL1 3S1NI 2KI7B 3IR7A 2JNYA 3H0GI 2JS4A 2VPWA 3S14I 3I07A 4A3GI 3TE5B 2V3VA 1N8R1 1VQ6Z 1K9M1 1LQLA 2AYDA 1TWFI 1Z02A 3IX0A 4RVDA 3M3YI 1ZB8A 3CCM1 2V8JA 1YJWZ 3KIFA 2V45A 3GTJI 4NBFA 3H3VJ 1FDIA 1QYPA 2IZ3A 4BBRI 4A3KI 3CMEZ 2OTJ1 4MH4A 3HOUI 1YITZ 3JAMb 5T6BA 2F4MA 3GTOI 1X0TA 4BY1I 2VUMI 4E30A 2KPIA 1JWHC 3I561 3CC4Z 2HF1A 3MONA 1VQM1 1VQOZ 1Y8CA 1K732 2VPZA 1FDOA 5C3EI 1NJI1 2O53A 4Y7NI 2G2KA 3KIHA 3CCR1 1JJ2Z 1L1OC 1ZH1A 2YADA 2B63I 1AA6A 1VQL1 2E2JI 4MD8A 3CCLZ 2YU9I 1S721 1Q861 2V8KA 3F3FC 2PM9A 3QWUA 4NB9A 2M6NA 2O4HA 1PFTA 3PO2I 1WW9A 3ESWA 3CCU1 1KC82 2QR1B 1TWAI 3OW2Z 2P3YA 3TDHB 3M4OI 3D9XA 4NH1C 2EGTA 4Y52I 3GTGI 3GTQI 1I6HI 3CCMZ 1RO2A 3G4S1 2LEXA 1W2BZ 2WAQA 1QXFA 3J81b 4MRIA 3D2LA 5LL6f 1YUKA 3HOYI 3CPWZ 3HOWI 2OTJZ 3BG1B 3NH8A 2H85A 2BJOA 1SFOI 4E31A 1R9TI 3FQQA 4A3II 2IZ4A 3S1QI 3S2HI 3NH5A 2I3CA 2LIYA 4TNUA 3T4NB 3I56Z 1KRLA 4RVFA 3GCFA 1Z01A 2QKDA 3CCJ1 4X6AI 1VQMZ 1VQP1 3JAMf 1QVFZ 3G711 2JR6A 3CCRZ 4NFRA 1VQLZ 3D6WA 4NBAA 1M1K2 1M902 1S72Z 3G6E1 3CCQ1 2QRCB 1VQ8Z 3CMA1 3J7A4 2QREB 1YJN1 3GTLI 1QVGY 3CCUZ 2RBLA 2VPXA 1KD11 2PMZA 2QA41 3FKII 1TWHI 2E2HI 2OTL1 1VQK1 4BY7I 2IV2X 3S1MI 1Q7Y1 3VMHA 4DK1A 1Q812 3U50C 3G4SZ 3CXCY 2VF1A 1Q822 2RPRA 4A3JI 1I50I 5A2Qb 1P9NA 1I3QI 1RQFA 4EWCA 4NBGA 5D1PA 1VQ51 1DL6A 4AYBA 4BXXI 5C44I 2JA7I 2M48A 2OZKA 4DGLA 1VQ71 1RNIA 1Z03A 5IP7I 3F3PC 2NVXI 4NBDA 4RV9A 5IP9I 3J81f 1K8A1 3CC71 2W03A 2GTHA 3CCJZ 3GTPI 1YHQ1 3P5JB 4MD9A 3S15I 1TFIA 3GKQA 1VQPZ 5FLXb 3G71Z 3VB9A 2GTIA 2P28A 1N8R2 3NDJA 5C4JI 5IT9b 1X3WA 2AKLA 1VQN1 1K9M2 4HH4A 2LFUA 3RZDI 1USPB 3G6EZ 2HU9A 1Q16A 1YJ9Z 1YJNZ 1VQ91 2QA4Z 1VQ41 2RHBA 5CM2M 3GTMI 2OTLZ 1VQKZ 2F4OA 1W2BY 3VMGA 3CD61 5FLMI 4NBCA 3I4NI 3CC21 1Q811 4A3CI 3CCE1 2JIOA 2WB1A 3S1RI 1KQSY 1VQ5Z 2NVQI 1TWCI 2K3RA 3GTKI 5D1OA 3VMIA 1YJ91 4E32A 1VQ7Z 3VTNA 1K731 2JIPA 2DE7A 4RVHA 5A2Qf 3IFUA 2E9HA 3NDIA 1NP6A 1QF8A 4CL1A 3CC7Z 3NFZA 1Q862 5T64A 1WZNA 1YHQZ 3CCS1 4E33A 5AN9F 1RLYA 3FQMA 2JIMA 2NAPA 1YIJ1 4HGZA 4E2ZA 1VQNZ 3RZOI 3HKZA 1KC81 2R6MA 1TWGI 3I551 3HOZI 4QTTA 4A3LI 1QVGZ 4A3MI 2R92I 2Q51A 1VQ9Z 3CCV1 5FLXf 1VQ4Z 3HOXI 2VUGA 2Y0SA 3EEDA 3J80b 1K83I 5IT9f 1Y1VS 4E2WA 2OOXB 4A3BI 3CD6Z 2K5RA 4QTUA 5C4XI 2QEX1 4S1TA 3CXCZ 3BG0B 3MZLB 1ML8A 4NBEA 1YI21 2ZAEB 5T67A 2QRDB 3CC2Z 3I4MI 1RO0A 4NB8A 1Y1VI 3CCEZ 3EERA 3PO3S 2OOYB 3S2DI 2W04A 1WIIA 4RVGA 3LUSA 3K7AI 1JJ2Y 2JUBA
chains in the Genus database with same CATH topology
2JA8I 1N2FA 2E2II 3PO3I 3S17I 4A3EI 2NVTI 1NUIA 3GTMS 3CCSZ 3CCQZ 1VQ61 1M1K1 3OW2Y 3CMAZ 4A3FI 2R7ZI 1M901 5D1OB 1VQ81 1KD12 1YIJZ 4A93I 4RS4A 4DQYB 4NBBA 4MD7A 3I55Z 1YJW1 3CQZI 1Q7Y2 1S7MA 3HOVI 4MXUA 4NBHA 4XX2A 3CCVZ 1RO4A 4E2XA 3NH4A 2RIQA 3CME1 3Q87A 3CPWY 3MZKB 1YIT1 2JA5I 4HGYA 2NVYI 1Q821 2DE6A 4A3DI 2QLVB 1Y1WI 4MONA 2QEXZ 3IF8A 2DE5A 3CC41 1YI2Z 4NOZA 2V8IA 2R93I 4E2YA 1WCMI 2J6AA 2GU2A 2Q4ZA 1VQO1 4BBSI 1NJI2 1KQSZ 1K8A2 3S16I 1ZB9A 2JMOA 1X3ZA 3J80f 2RT9A 1QVFY 1VLAA 1YUAA 2JA6I 2PK7A 1USPA 3CCL1 3S1NI 2KI7B 2JNYA 3H0GI 2JS4A 3S14I 3I07A 4A3GI 3TE5B 1N8R1 1VQ6Z 1K9M1 1LQLA 1TWFI 1Z02A 3IX0A 4RVDA 3M3YI 1ZB8A 3CCM1 2V8JA 1YJWZ 3KIFA 3GTJI 4NBFA 3H3VJ 1QYPA 2IZ3A 4BBRI 4A3KI 3CMEZ 2OTJ1 4MH4A 3HOUI 1YITZ 3JAMb 5T6BA 2F4MA 3GTOI 1X0TA 4BY1I 2VUMI 4E30A 2KPIA 1JWHC 3I561 3CC4Z 2HF1A 3MONA 1VQM1 1VQOZ 1K732 5C3EI 1NJI1 2O53A 4Y7NI 2G2KA 3KIHA 3CCR1 1JJ2Z 1L1OC 1ZH1A 2YADA 2B63I 1VQL1 2E2JI 4MD8A 3CCLZ 2YU9I 1S721 1Q861 2V8KA 3F3FC 2PM9A 3QWUA 4NB9A 2M6NA 2O4HA 1PFTA 3PO2I 1WW9A 3ESWA 3CCU1 1KC82 2QR1B 1TWAI 3OW2Z 2P3YA 3TDHB 3M4OI 3D9XA 4NH1C 2EGTA 4Y52I 3GTGI 3GTQI 1I6HI 3CCMZ 1RO2A 3G4S1 1W2BZ 2WAQA 3J81b 4MRIA 5LL6f 1YUKA 3HOYI 3CPWZ 3HOWI 2OTJZ 3BG1B 3NH8A 2H85A 2BJOA 1SFOI 4E31A 1R9TI 3FQQA 4A3II 2IZ4A 3S1QI 3S2HI 3NH5A 2I3CA 2LIYA 4TNUA 3T4NB 3I56Z 1KRLA 4RVFA 3GCFA 1Z01A 2QKDA 3CCJ1 4X6AI 1VQMZ 1VQP1 3JAMf 1QVFZ 3G711 2JR6A 3CCRZ 4NFRA 1VQLZ 3D6WA 4NBAA 1M1K2 1M902 1S72Z 3G6E1 3CCQ1 2QRCB 1VQ8Z 3CMA1 3J7A4 2QREB 1YJN1 3GTLI 1QVGY 3CCUZ 2RBLA 1KD11 2PMZA 2QA41 3FKII 1TWHI 2E2HI 2OTL1 1VQK1 4BY7I 3S1MI 1Q7Y1 3VMHA 4DK1A 1Q812 3U50C 3G4SZ 3CXCY 2VF1A 1Q822 2RPRA 4A3JI 1I50I 5A2Qb 1P9NA 1I3QI 1RQFA 4EWCA 4NBGA 5D1PA 1VQ51 1DL6A 4AYBA 4BXXI 5C44I 2JA7I 2M48A 2OZKA 4DGLA 1VQ71 1RNIA 1Z03A 5IP7I 3F3PC 2NVXI 4NBDA 4RV9A 5IP9I 3J81f 1K8A1 3CC71 2W03A 2GTHA 3CCJZ 3GTPI 1YHQ1 3P5JB 4MD9A 3S15I 1TFIA 3GKQA 1VQPZ 5FLXb 3G71Z 3VB9A 2GTIA 2P28A 1N8R2 3NDJA 5C4JI 5IT9b 1X3WA 2AKLA 1VQN1 1K9M2 4HH4A 2LFUA 3RZDI 1USPB 3G6EZ 2HU9A 1YJ9Z 1YJNZ 1VQ91 2QA4Z 1VQ41 2RHBA 5CM2M 3GTMI 2OTLZ 1VQKZ 2F4OA 1W2BY 3VMGA 3CD61 5FLMI 4NBCA 3I4NI 3CC21 1Q811 4A3CI 3CCE1 2WB1A 3S1RI 1KQSY 1VQ5Z 2NVQI 1TWCI 2K3RA 3GTKI 5D1OA 3VMIA 1YJ91 4E32A 1VQ7Z 3VTNA 1K731 2DE7A 4RVHA 5A2Qf 3IFUA 2E9HA 3NDIA 1NP6A 1QF8A 4CL1A 3CC7Z 3NFZA 1Q862 5T64A 1YHQZ 3CCS1 4E33A 5AN9F 1RLYA 3FQMA 1YIJ1 4HGZA 4E2ZA 1VQNZ 3RZOI 3HKZA 1KC81 2R6MA 1TWGI 3I551 3HOZI 4QTTA 4A3LI 1QVGZ 4A3MI 2R92I 2Q51A 1VQ9Z 3CCV1 5FLXf 1VQ4Z 3HOXI 2VUGA 2Y0SA 3EEDA 3J80b 1K83I 5IT9f 1Y1VS 4E2WA 2OOXB 4A3BI 3CD6Z 2K5RA 4QTUA 5C4XI 2QEX1 4S1TA 3CXCZ 3BG0B 3MZLB 1ML8A 4NBEA 1YI21 2ZAEB 5T67A 2QRDB 3CC2Z 3I4MI 1RO0A 4NB8A 1Y1VI 3CCEZ 3EERA 3PO3S 2OOYB 3S2DI 2W04A 1WIIA 4RVGA 3LUSA 3K7AI 1JJ2Y 2JUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA8 I;  1N2F A;  5CM2 M;  3GTM I;  3GTJ I;  2E2I I;  4NBF A;  3PO3 I;  2F4O A;  3H3V J;  3VMG A;  1QYP A;  5FLM I;  2JR6 A;  4NBC A;  4BBR I;  4A3K I;  3I4N I;  3S17 I;  4MH4 A;  4A3E I;  3HOU I;  2NVT I;  1NUI A;  3D6W A;  4NBA A;  3GTM S;  4A3C I;  2F4M A;  3GTO I;  4BY1 I;  2VUM I;  4A3F I;  2R7Z I;  3S1R I;  2KPI A;  3GTL I;  4A93 I;  2NVQ I;  1TWC I;  2HF1 A;  2RBL A;  3GTK I;  3VMI A;  4NBB A;  3FKI I;  1TWH I;  2E2H I;  3CQZ I;  4BY7 I;  3S1M I;  5C3E I;  3VMH A;  2DE7 A;  3HOV I;  4NBH A;  4Y7N I;  1L1O C;  4XX2 A;  2B63 I;  1RO4 A;  2E2J I;  3U50 C;  3Q87 A;  2JA5 I;  2YU9 I;  4A3J I;  1I50 I;  1RLY A;  2NVY I;  4A3D I;  2DE6 A;  1Y1W I;  1I3Q I;  4NB9 A;  1PFT A;  4NBG A;  3PO2 I;  1DL6 A;  2DE5 A;  1WW9 A;  3ESW A;  4BXX I;  4NOZ A;  5C44 I;  3RZO I;  2R93 I;  1WCM I;  1TWA I;  2JA7 I;  2J6A A;  2P3Y A;  4BBS I;  1TWG I;  3HOZ I;  3M4O I;  4QTT A;  3S16 I;  4Y52 I;  5IP7 I;  4A3L I;  3GTG I;  1ZB9 A;  2NVX I;  3GTQ I;  1X3Z A;  1I6H I;  4A3M I;  4NBD A;  5IP9 I;  2R92 I;  1VLA A;  1YUA A;  2JA6 I;  2PK7 A;  1USP A;  3HOX I;  3GTP I;  3S1N I;  3S15 I;  1TFI A;  1K83 I;  2JNY A;  1Y1V S;  3H0G I;  3GKQ A;  2JS4 A;  3S14 I;  3I07 A;  4A3B I;  2K5R A;  4QTU A;  5C4X I;  4A3G I;  3HOY I;  3VB9 A;  3HOW I;  5C4J I;  1ML8 A;  4NBE A;  1X3W A;  2AKL A;  2BJO A;  1SFO I;  3I4M I;  3RZD I;  1USP B;  4NB8 A;  1Y1V I;  1R9T I;  1LQL A;  1TWF I;  4A3I I;  3EER A;  3S1Q I;  3PO3 S;  3S2H I;  3S2D I;  3M3Y I;  1ZB8 A;  3LUS A;  3K7A I;  3GCF A;  4X6A I; 
#chains in the Genus database with same CATH topology
 2JA8 I;  1N2F A;  2E2I I;  3PO3 I;  2E7Z A;  2JIR A;  3S17 I;  4A3E I;  2NVT I;  1NUI A;  3GTM S;  3CCS Z;  3CCQ Z;  1VQ6 1;  1M1K 1;  3OW2 Y;  3CMA Z;  4A3F I;  2R7Z I;  1M90 1;  5D1O B;  1SIW A;  1VQ8 1;  1KD1 2;  1YIJ Z;  4A93 I;  4RS4 A;  4DQY B;  4NBB A;  4MD7 A;  3I55 Z;  1YJW 1;  3CQZ I;  1Q7Y 2;  1S7M A;  3HOV I;  4MXU A;  4NBH A;  4XX2 A;  3CCV Z;  1RO4 A;  4E2X A;  3NH4 A;  2RIQ A;  3CME 1;  3Q87 A;  3CPW Y;  3MZK B;  1YIT 1;  2JA5 I;  2VPY A;  4HGY A;  2NVY I;  1Q82 1;  2DE6 A;  4A3D I;  2QLV B;  1Y1W I;  4MON A;  2QEX Z;  3IF8 A;  2DE5 A;  3CC4 1;  1YI2 Z;  4NOZ A;  2V8I A;  2R93 I;  2JIQ A;  1WCM I;  4E2Y A;  2J6A A;  1WJ2 A;  2GU2 A;  2Q4Z A;  1VQO 1;  4BBS I;  1NJI 2;  1KQS Z;  1K8A 2;  3S16 I;  1ZB9 A;  2JMO A;  1X3Z A;  3J80 f;  2RT9 A;  1QVF Y;  1VLA A;  1YUA A;  2JA6 I;  2PK7 A;  1USP A;  3CCL 1;  3S1N I;  2KI7 B;  3IR7 A;  2JNY A;  3H0G I;  2JS4 A;  2VPW A;  3S14 I;  3I07 A;  4A3G I;  3TE5 B;  2V3V A;  1N8R 1;  1VQ6 Z;  1K9M 1;  1LQL A;  2AYD A;  1TWF I;  1Z02 A;  3IX0 A;  4RVD A;  3M3Y I;  1ZB8 A;  3CCM 1;  2V8J A;  1YJW Z;  3KIF A;  2V45 A;  3GTJ I;  4NBF A;  3H3V J;  1FDI A;  1QYP A;  2IZ3 A;  4BBR I;  4A3K I;  3CME Z;  2OTJ 1;  4MH4 A;  3HOU I;  1YIT Z;  3JAM b;  5T6B A;  2F4M A;  3GTO I;  1X0T A;  4BY1 I;  2VUM I;  4E30 A;  2KPI A;  1JWH C;  3I56 1;  3CC4 Z;  2HF1 A;  3MON A;  1VQM 1;  1VQO Z;  1Y8C A;  1K73 2;  2VPZ A;  1FDO A;  5C3E I;  1NJI 1;  2O53 A;  4Y7N I;  2G2K A;  3KIH A;  3CCR 1;  1JJ2 Z;  1L1O C;  1ZH1 A;  2YAD A;  2B63 I;  1AA6 A;  1VQL 1;  2E2J I;  4MD8 A;  3CCL Z;  2YU9 I;  1S72 1;  1Q86 1;  2V8K A;  3F3F C;  2PM9 A;  3QWU A;  4NB9 A;  2M6N A;  2O4H A;  1PFT A;  3PO2 I;  1WW9 A;  3ESW A;  3CCU 1;  1KC8 2;  2QR1 B;  1TWA I;  3OW2 Z;  2P3Y A;  3TDH B;  3M4O I;  3D9X A;  4NH1 C;  2EGT A;  4Y52 I;  3GTG I;  3GTQ I;  1I6H I;  3CCM Z;  1RO2 A;  3G4S 1;  2LEX A;  1W2B Z;  2WAQ A;  1QXF A;  3J81 b;  4MRI A;  3D2L A;  5LL6 f;  1YUK A;  3HOY I;  3CPW Z;  3HOW I;  2OTJ Z;  3BG1 B;  3NH8 A;  2H85 A;  2BJO A;  1SFO I;  4E31 A;  1R9T I;  3FQQ A;  4A3I I;  2IZ4 A;  3S1Q I;  3S2H I;  3NH5 A;  2I3C A;  2LIY A;  4TNU A;  3T4N B;  3I56 Z;  1KRL A;  4RVF A;  3GCF A;  1Z01 A;  2QKD A;  3CCJ 1;  4X6A I;  1VQM Z;  1VQP 1;  3JAM f;  1QVF Z;  3G71 1;  2JR6 A;  3CCR Z;  4NFR A;  1VQL Z;  3D6W A;  4NBA A;  1M1K 2;  1M90 2;  1S72 Z;  3G6E 1;  3CCQ 1;  2QRC B;  1VQ8 Z;  3CMA 1;  3J7A 4;  2QRE B;  1YJN 1;  3GTL I;  1QVG Y;  3CCU Z;  2RBL A;  2VPX A;  1KD1 1;  2PMZ A;  2QA4 1;  3FKI I;  1TWH I;  2E2H I;  2OTL 1;  1VQK 1;  4BY7 I;  2IV2 X;  3S1M I;  1Q7Y 1;  3VMH A;  4DK1 A;  1Q81 2;  3U50 C;  3G4S Z;  3CXC Y;  2VF1 A;  1Q82 2;  2RPR A;  4A3J I;  1I50 I;  5A2Q b;  1P9N A;  1I3Q I;  1RQF A;  4EWC A;  4NBG A;  5D1P A;  1VQ5 1;  1DL6 A;  4AYB A;  4BXX I;  5C44 I;  2JA7 I;  2M48 A;  2OZK A;  4DGL A;  1VQ7 1;  1RNI A;  1Z03 A;  5IP7 I;  3F3P C;  2NVX I;  4NBD A;  4RV9 A;  5IP9 I;  3J81 f;  1K8A 1;  3CC7 1;  2W03 A;  2GTH A;  3CCJ Z;  3GTP I;  1YHQ 1;  3P5J B;  4MD9 A;  3S15 I;  1TFI A;  3GKQ A;  1VQP Z;  5FLX b;  3G71 Z;  3VB9 A;  2GTI A;  2P28 A;  1N8R 2;  3NDJ A;  5C4J I;  5IT9 b;  1X3W A;  2AKL A;  1VQN 1;  1K9M 2;  4HH4 A;  2LFU A;  3RZD I;  1USP B;  3G6E Z;  2HU9 A;  1Q16 A;  1YJ9 Z;  1YJN Z;  1VQ9 1;  2QA4 Z;  1VQ4 1;  2RHB A;  5CM2 M;  3GTM I;  2OTL Z;  1VQK Z;  2F4O A;  1W2B Y;  3VMG A;  3CD6 1;  5FLM I;  4NBC A;  3I4N I;  3CC2 1;  1Q81 1;  4A3C I;  3CCE 1;  2JIO A;  2WB1 A;  3S1R I;  1KQS Y;  1VQ5 Z;  2NVQ I;  1TWC I;  2K3R A;  3GTK I;  5D1O A;  3VMI A;  1YJ9 1;  4E32 A;  1VQ7 Z;  3VTN A;  1K73 1;  2JIP A;  2DE7 A;  4RVH A;  5A2Q f;  3IFU A;  2E9H A;  3NDI A;  1NP6 A;  1QF8 A;  4CL1 A;  3CC7 Z;  3NFZ A;  1Q86 2;  5T64 A;  1WZN A;  1YHQ Z;  3CCS 1;  4E33 A;  5AN9 F;  1RLY A;  3FQM A;  2JIM A;  2NAP A;  1YIJ 1;  4HGZ A;  4E2Z A;  1VQN Z;  3RZO I;  3HKZ A;  1KC8 1;  2R6M A;  1TWG I;  3I55 1;  3HOZ I;  4QTT A;  4A3L I;  1QVG Z;  4A3M I;  2R92 I;  2Q51 A;  1VQ9 Z;  3CCV 1;  5FLX f;  1VQ4 Z;  3HOX I;  2VUG A;  2Y0S A;  3EED A;  3J80 b;  1K83 I;  5IT9 f;  1Y1V S;  4E2W A;  2OOX B;  4A3B I;  3CD6 Z;  2K5R A;  4QTU A;  5C4X I;  2QEX 1;  4S1T A;  3CXC Z;  3BG0 B;  3MZL B;  1ML8 A;  4NBE A;  1YI2 1;  2ZAE B;  5T67 A;  2QRD B;  3CC2 Z;  3I4M I;  1RO0 A;  4NB8 A;  1Y1V I;  3CCE Z;  3EER A;  3PO3 S;  2OOY B;  3S2D I;  2W04 A;  1WII A;  4RVG A;  3LUS A;  3K7A I;  1JJ2 Y;  2JUB A; 
#chains in the Genus database with same CATH homology
 2JA8 I;  1N2F A;  2E2I I;  3PO3 I;  3S17 I;  4A3E I;  2NVT I;  1NUI A;  3GTM S;  3CCS Z;  3CCQ Z;  1VQ6 1;  1M1K 1;  3OW2 Y;  3CMA Z;  4A3F I;  2R7Z I;  1M90 1;  5D1O B;  1VQ8 1;  1KD1 2;  1YIJ Z;  4A93 I;  4RS4 A;  4DQY B;  4NBB A;  4MD7 A;  3I55 Z;  1YJW 1;  3CQZ I;  1Q7Y 2;  1S7M A;  3HOV I;  4MXU A;  4NBH A;  4XX2 A;  3CCV Z;  1RO4 A;  4E2X A;  3NH4 A;  2RIQ A;  3CME 1;  3Q87 A;  3CPW Y;  3MZK B;  1YIT 1;  2JA5 I;  4HGY A;  2NVY I;  1Q82 1;  2DE6 A;  4A3D I;  2QLV B;  1Y1W I;  4MON A;  2QEX Z;  3IF8 A;  2DE5 A;  3CC4 1;  1YI2 Z;  4NOZ A;  2V8I A;  2R93 I;  4E2Y A;  1WCM I;  2J6A A;  2GU2 A;  2Q4Z A;  1VQO 1;  4BBS I;  1NJI 2;  1KQS Z;  1K8A 2;  3S16 I;  1ZB9 A;  2JMO A;  1X3Z A;  3J80 f;  2RT9 A;  1QVF Y;  1VLA A;  1YUA A;  2JA6 I;  2PK7 A;  1USP A;  3CCL 1;  3S1N I;  2KI7 B;  2JNY A;  3H0G I;  2JS4 A;  3S14 I;  3I07 A;  4A3G I;  3TE5 B;  1N8R 1;  1VQ6 Z;  1K9M 1;  1LQL A;  1TWF I;  1Z02 A;  3IX0 A;  4RVD A;  3M3Y I;  1ZB8 A;  3CCM 1;  2V8J A;  1YJW Z;  3KIF A;  3GTJ I;  4NBF A;  3H3V J;  1QYP A;  2IZ3 A;  4BBR I;  4A3K I;  3CME Z;  2OTJ 1;  4MH4 A;  3HOU I;  1YIT Z;  3JAM b;  5T6B A;  2F4M A;  3GTO I;  1X0T A;  4BY1 I;  2VUM I;  4E30 A;  2KPI A;  1JWH C;  3I56 1;  3CC4 Z;  2HF1 A;  3MON A;  1VQM 1;  1VQO Z;  1K73 2;  5C3E I;  1NJI 1;  2O53 A;  4Y7N I;  2G2K A;  3KIH A;  3CCR 1;  1JJ2 Z;  1L1O C;  1ZH1 A;  2YAD A;  2B63 I;  1VQL 1;  2E2J I;  4MD8 A;  3CCL Z;  2YU9 I;  1S72 1;  1Q86 1;  2V8K A;  3F3F C;  2PM9 A;  3QWU A;  4NB9 A;  2M6N A;  2O4H A;  1PFT A;  3PO2 I;  1WW9 A;  3ESW A;  3CCU 1;  1KC8 2;  2QR1 B;  1TWA I;  3OW2 Z;  2P3Y A;  3TDH B;  3M4O I;  3D9X A;  4NH1 C;  2EGT A;  4Y52 I;  3GTG I;  3GTQ I;  1I6H I;  3CCM Z;  1RO2 A;  3G4S 1;  1W2B Z;  2WAQ A;  3J81 b;  4MRI A;  5LL6 f;  1YUK A;  3HOY I;  3CPW Z;  3HOW I;  2OTJ Z;  3BG1 B;  3NH8 A;  2H85 A;  2BJO A;  1SFO I;  4E31 A;  1R9T I;  3FQQ A;  4A3I I;  2IZ4 A;  3S1Q I;  3S2H I;  3NH5 A;  2I3C A;  2LIY A;  4TNU A;  3T4N B;  3I56 Z;  1KRL A;  4RVF A;  3GCF A;  1Z01 A;  2QKD A;  3CCJ 1;  4X6A I;  1VQM Z;  1VQP 1;  3JAM f;  1QVF Z;  3G71 1;  2JR6 A;  3CCR Z;  4NFR A;  1VQL Z;  3D6W A;  4NBA A;  1M1K 2;  1M90 2;  1S72 Z;  3G6E 1;  3CCQ 1;  2QRC B;  1VQ8 Z;  3CMA 1;  3J7A 4;  2QRE B;  1YJN 1;  3GTL I;  1QVG Y;  3CCU Z;  2RBL A;  1KD1 1;  2PMZ A;  2QA4 1;  3FKI I;  1TWH I;  2E2H I;  2OTL 1;  1VQK 1;  4BY7 I;  3S1M I;  1Q7Y 1;  3VMH A;  4DK1 A;  1Q81 2;  3U50 C;  3G4S Z;  3CXC Y;  2VF1 A;  1Q82 2;  2RPR A;  4A3J I;  1I50 I;  5A2Q b;  1P9N A;  1I3Q I;  1RQF A;  4EWC A;  4NBG A;  5D1P A;  1VQ5 1;  1DL6 A;  4AYB A;  4BXX I;  5C44 I;  2JA7 I;  2M48 A;  2OZK A;  4DGL A;  1VQ7 1;  1RNI A;  1Z03 A;  5IP7 I;  3F3P C;  2NVX I;  4NBD A;  4RV9 A;  5IP9 I;  3J81 f;  1K8A 1;  3CC7 1;  2W03 A;  2GTH A;  3CCJ Z;  3GTP I;  1YHQ 1;  3P5J B;  4MD9 A;  3S15 I;  1TFI A;  3GKQ A;  1VQP Z;  5FLX b;  3G71 Z;  3VB9 A;  2GTI A;  2P28 A;  1N8R 2;  3NDJ A;  5C4J I;  5IT9 b;  1X3W A;  2AKL A;  1VQN 1;  1K9M 2;  4HH4 A;  2LFU A;  3RZD I;  1USP B;  3G6E Z;  2HU9 A;  1YJ9 Z;  1YJN Z;  1VQ9 1;  2QA4 Z;  1VQ4 1;  2RHB A;  5CM2 M;  3GTM I;  2OTL Z;  1VQK Z;  2F4O A;  1W2B Y;  3VMG A;  3CD6 1;  5FLM I;  4NBC A;  3I4N I;  3CC2 1;  1Q81 1;  4A3C I;  3CCE 1;  2WB1 A;  3S1R I;  1KQS Y;  1VQ5 Z;  2NVQ I;  1TWC I;  2K3R A;  3GTK I;  5D1O A;  3VMI A;  1YJ9 1;  4E32 A;  1VQ7 Z;  3VTN A;  1K73 1;  2DE7 A;  4RVH A;  5A2Q f;  3IFU A;  2E9H A;  3NDI A;  1NP6 A;  1QF8 A;  4CL1 A;  3CC7 Z;  3NFZ A;  1Q86 2;  5T64 A;  1YHQ Z;  3CCS 1;  4E33 A;  5AN9 F;  1RLY A;  3FQM A;  1YIJ 1;  4HGZ A;  4E2Z A;  1VQN Z;  3RZO I;  3HKZ A;  1KC8 1;  2R6M A;  1TWG I;  3I55 1;  3HOZ I;  4QTT A;  4A3L I;  1QVG Z;  4A3M I;  2R92 I;  2Q51 A;  1VQ9 Z;  3CCV 1;  5FLX f;  1VQ4 Z;  3HOX I;  2VUG A;  2Y0S A;  3EED A;  3J80 b;  1K83 I;  5IT9 f;  1Y1V S;  4E2W A;  2OOX B;  4A3B I;  3CD6 Z;  2K5R A;  4QTU A;  5C4X I;  2QEX 1;  4S1T A;  3CXC Z;  3BG0 B;  3MZL B;  1ML8 A;  4NBE A;  1YI2 1;  2ZAE B;  5T67 A;  2QRD B;  3CC2 Z;  3I4M I;  1RO0 A;  4NB8 A;  1Y1V I;  3CCE Z;  3EER A;  3PO3 S;  2OOY B;  3S2D I;  2W04 A;  1WII A;  4RVG A;  3LUS A;  3K7A I;  1JJ2 Y;  2JUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...