3CCS1

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482a
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccs100
1NJI2 1VQ7Z 3CMA1 1M1K2 1K732 3CC41 1VQ51 3G6EZ 1S721 3CD61 1QVFZ 2OTJ1 1YJNZ 1VQ91 1VQ8Z 3CC2Z 2QA41 1JJ2Z 1YITZ 3I551 1YJ9Z 1QVGZ 3CMEZ 3CCVZ 3CCUZ 1VQMZ 1W2BZ 1VQO1 1VQ41 1K8A2 3I561 2QEXZ 3OW2Z 1YIJZ 1YJWZ 1VQN1 1Q862 3CC71 1Q7Y1 3CMAZ 2OTL1 1VQK1 1VQ5Z 3CD6Z 1M1K1 1K731 3CCMZ 1Q812 2OTJZ 1KC81 1N8R2 1VQ9Z 1YI21 3G711 2QA4Z 3CXCZ 1QVFY 1KD12 1VQ6Z 1VQP1 3I56Z 1M902 1YHQZ 3CCQ1 3CCE1 1K8A1 1VQNZ 1W2BY 1Q822 3CCR1 1VQKZ 1VQ71 1Q861 3CCS1 1KQSY 3CC4Z 1NJI1 1S72Z 3CPWZ 3G71Z 1Q811 1YJN1 3G4S1 1N8R1 1VQ81 1VQL1 3I55Z 1K9M2 1KD11 3CXCY 3CCU1 3CCJ1 1VQM1 1VQOZ 1VQ4Z 3CCL1 1JJ2Y 3CCQZ 3CCEZ 1M901 1QVGY 2QEX1 3CCRZ 1YJW1 3CC7Z 1Q821 2OTLZ 3CCSZ 3OW2Y 1KC82 3CCM1 3G6E1 3G4SZ 1YI2Z 1VQLZ 3CPWY 3CC21 1YIT1 3CCJZ 1VQ61 1YJ91 1VQPZ 3CCLZ 3CME1 1K9M1 3CCV1 1YHQ1 1KQSZ 1Q7Y2 1YIJ1
chains in the Genus database with same CATH superfamily
3IFUA 2JMOA 1VQ7Z 1K732 2RT9A 1VQ51 3CQZI 2EGTA 2OTJ1 3GTOI 1ZB9A 3TDHB 2PMZA 3I551 2M6NA 4A3JI 2LFUA 1K8A2 5A2Qb 3T4NB 1I3QI 2W04A 4A3CI 2B63I 2OOXB 2IZ3A 4MONA 2DE5A 3HOYI 2G2KA 4NBBA 1VQ5Z 3H3VJ 1M1K1 4X6AI 4A3KI 1Z02A 2OTJZ 5D1PA 1N8R2 2PM9A 5IT9b 3CXCZ 1QXFA 2F4OA 3IR7A 5FLXf 3QWUA 5C44I 3CCE1 3P5JB 2E2II 3D2LA 4A3FI 1YUKA 3CCR1 1FDOA 5LL6f 1TWFI 3PO3I 3J80b 1WZNA 2NAPA 3CC4Z 3GTGI 4A3GI 2P28A 2QR1B 1TWGI 4NBEA 1Q811 1YJN1 3S15I 3VB9A 1ML8A 4Y7NI 1USPA 1K9M2 2VPXA 2H85A 3CCU1 3CCEZ 1X3ZA 1M901 3CCRZ 1YJW1 2K5RA 2OTLZ 2E9HA 4A93I 2JIOA 4MXUA 2V3VA 1NP6A 2NVQI 4HGZA 3CC21 1VQ61 4MRIA 1YJ91 3MZKB 2GU2A 4BY7I 3GCFA 2Q4ZA 1K83I 1I50I 1YHQ1 4BBSI 3VMGA 1ZH1A 5CM2M 4NBCA 2NVXI 1P9NA 3H0GI 3CD61 1AA6A 2PK7A 3S2DI 5C4XI 1I6HI 1VQ91 3CC2Z 4NBAA 1JJ2Z 1YJ9Z 1Y1WI 4MH4A 1QYPA 2QEXZ 2E2HI 1WIIA 3OW2Z 5D1OB 3NH8A 2M48A 3VMIA 2ZAEB 4NB8A 2JS4A 3CD6Z 1K731 3LUSA 4E31A 1KC81 4NBHA 2JNYA 4MD7A 3TE5B 1VQ9Z 3RZOI 1YI21 1NUIA 3F3PC 2YADA 1QVFY 2JIPA 1VQP1 2O4HA 1X3WA 1K8A1 1W2BY 3FKII 1S7MA 3GTMI 2R6MA 2GTHA 3MZLB 1NJI1 3K7AI 2QRCB 5T67A 3G4S1 1N8R1 1VQ81 3GTKI 3I55Z 3HKZA 3J81f 3D9XA 2F4MA 1VQM1 3CCL1 1JJ2Y 1WW9A 2O53A 2BJOA 1FDIA 3I4MI 2JIRA 3OW2Y 2RIQA 2R92I 3CCM1 4BY1I 3G4SZ 2VUMI 3JAMf 2E2JI 3CPWY 3HOWI 3S1QI 3HOVI 2VUGA 1RLYA 4QTTA 3CCLZ 1K9M1 3CCV1 5FLXb 1KQSZ 3HOXI 1Q7Y2 4Y52I 3S16I 4E30A 1VLAA 4QTUA 4E32A 2LIYA 2Y0SA 4MD9A 1S721 1QVFZ 2E7ZA 2R7ZI 1YJNZ 4A3EI 1Y8CA 2QA41 5AN9F 5T6BA 4E33A 3CCVZ 3CCUZ 4NH1C 4E2YA 1W2BZ 1VQO1 4DK1A 1VQ41 4CL1A 4RV9A 1YJWZ 1Q862 3CC71 5C4JI 1VQK1 1DL6A 4A3DI 3GTPI 3NDJA 4RS4A 3GKQA 3PO2I 2GTIA 2QA4Z 3NH4A 1KD12 2JIMA 2DE7A 2WB1A 1VQ6Z 3EERA 3S14I 1YHQZ 3CCQ1 1SFOI 1Y1VI 3M4OI 1Q822 1QF8A 1YUAA 2VPWA 1VQKZ 2QKDA 4RVGA 1VQ71 2RBLA 3CCS1 3NFZA 1USPB 1KQSY 2RHBA 2NVYI 4NFRA 2KPIA 4NBDA 4E2ZA 3CPWZ 2V45A 3HOZI 4S1TA 3GTQI 1WJ2A 1VQL1 1JWHC 5FLMI 3GTMS 4A3MI 3CCJ1 4A3LI 5A2Qf 4EWCA 4NOZA 3CCQZ 2Q51A 3FQMA 2OOYB 4NBGA 1ZB8A 2JR6A 5IP9I 3Q87A 3CCSZ 1RNIA 1KC82 1L1OC 1TFIA 3I07A 3RZDI 3G6E1 4E2WA 4RVFA 5IT9f 1YI2Z 1VQLZ 4A3BI 2VPZA 1YIT1 2JA7I 3CCJZ 1VQPZ 3CME1 3IF8A 5C3EI 3PO3S 3M3YI 1N2FA 2HF1A 4BBRI 1X0TA 1YIJ1 2LEXA 2R93I 2AKLA 3J80f 1NJI2 3GTLI 3CMA1 2KI7B 1M1K2 1TWAI 1TWCI 1RO4A 3NDIA 3CC41 2VF1A 3G6EZ 1R9TI 1VQ8Z 2JA8I 4E2XA 1YITZ 3FQQA 3KIFA 1KRLA 3KIHA 1QVGZ 3CMEZ 1RO2A 1VQMZ 4DQYB 3HOUI 3J81b 3BG0B 3I561 1RQFA 2AYDA 3F3FC 1YIJZ 3S1MI 4XX2A 1VQN1 2RPRA 1Q7Y1 3CMAZ 2OTL1 3VMHA 1PFTA 4MD8A 2JA6I 3J7A4 3S1NI 3CCMZ 2DE6A 1Q812 3BG1B 5D1OA 1SIWA 4A3II 3G711 4TNUA 4BXXI 3S1RI 3JAMb 4RVHA 5T64A 2V8KA 1Z01A 3I56Z 1M902 2QREB 1VQNZ 3NH5A 2JIQA 3D6WA 1RO0A 1Q861 1WCMI 4RVDA 4NB9A 4AYBA 1S72Z 1LQLA 2V8IA 2V8JA 1TWHI 2P3YA 2IZ4A 3G71Z 3U50C 2OZKA 3S2HI 3MONA 1Y1VS 2J6AA 1KD11 3CXCY 1VQOZ 1VQ4Z 2K3RA 2WAQA 4DGLA 2IV2X 2I3CA 2W03A 2QEX1 1QVGY 3VTNA 3CC7Z 1Q821 2QRDB 3I4NI 2HU9A 2JUBA 3IX0A 3S17I 2NVTI 2JA5I 2QLVB 4HGYA 2VPYA 5IP7I 4NBFA 4HH4A 1Q16A 3EEDA 2YU9I 3ESWA 1Z03A 3GTJI
chains in the Genus database with same CATH topology
3IFUA 2JMOA 1VQ7Z 1K732 2RT9A 1VQ51 3CQZI 2EGTA 2OTJ1 3GTOI 1ZB9A 3TDHB 2PMZA 3I551 2M6NA 4A3JI 2LFUA 1K8A2 5A2Qb 3T4NB 1I3QI 2W04A 4A3CI 2B63I 2OOXB 2IZ3A 4MONA 2DE5A 3HOYI 2G2KA 4NBBA 1VQ5Z 3H3VJ 1M1K1 4X6AI 4A3KI 1Z02A 2OTJZ 5D1PA 1N8R2 2PM9A 5IT9b 3CXCZ 2F4OA 5FLXf 3QWUA 5C44I 3CCE1 3P5JB 2E2II 4A3FI 1YUKA 3CCR1 5LL6f 1TWFI 3PO3I 3J80b 3CC4Z 3GTGI 4A3GI 2P28A 2QR1B 1TWGI 4NBEA 1Q811 1YJN1 3S15I 3VB9A 1ML8A 4Y7NI 1USPA 1K9M2 2H85A 3CCU1 3CCEZ 1X3ZA 1M901 3CCRZ 1YJW1 2K5RA 2OTLZ 2E9HA 4A93I 4MXUA 1NP6A 2NVQI 4HGZA 3CC21 1VQ61 4MRIA 1YJ91 3MZKB 2GU2A 4BY7I 3GCFA 2Q4ZA 1K83I 1I50I 1YHQ1 4BBSI 3VMGA 1ZH1A 5CM2M 4NBCA 2NVXI 1P9NA 3H0GI 3CD61 2PK7A 3S2DI 5C4XI 1I6HI 1VQ91 3CC2Z 4NBAA 1JJ2Z 1YJ9Z 1Y1WI 4MH4A 1QYPA 2QEXZ 2E2HI 1WIIA 3OW2Z 5D1OB 3NH8A 2M48A 3VMIA 2ZAEB 4NB8A 2JS4A 3CD6Z 1K731 3LUSA 4E31A 1KC81 4NBHA 2JNYA 4MD7A 3TE5B 1VQ9Z 3RZOI 1YI21 1NUIA 3F3PC 2YADA 1QVFY 1VQP1 2O4HA 1X3WA 1K8A1 1W2BY 3FKII 1S7MA 3GTMI 2R6MA 2GTHA 3MZLB 1NJI1 3K7AI 2QRCB 5T67A 3G4S1 1N8R1 1VQ81 3GTKI 3I55Z 3HKZA 3J81f 3D9XA 2F4MA 1VQM1 3CCL1 1JJ2Y 1WW9A 2O53A 2BJOA 3I4MI 3OW2Y 2RIQA 2R92I 3CCM1 4BY1I 3G4SZ 2VUMI 3JAMf 2E2JI 3CPWY 3HOWI 3S1QI 3HOVI 2VUGA 1RLYA 4QTTA 3CCLZ 1K9M1 3CCV1 5FLXb 1KQSZ 3HOXI 1Q7Y2 4Y52I 3S16I 4E30A 1VLAA 4QTUA 4E32A 2LIYA 2Y0SA 4MD9A 1S721 1QVFZ 2R7ZI 1YJNZ 4A3EI 2QA41 5AN9F 5T6BA 4E33A 3CCVZ 3CCUZ 4NH1C 4E2YA 1W2BZ 1VQO1 4DK1A 1VQ41 4CL1A 4RV9A 1YJWZ 1Q862 3CC71 5C4JI 1VQK1 1DL6A 4A3DI 3GTPI 3NDJA 4RS4A 3GKQA 3PO2I 2GTIA 2QA4Z 3NH4A 1KD12 2DE7A 2WB1A 1VQ6Z 3EERA 3S14I 1YHQZ 3CCQ1 1SFOI 1Y1VI 3M4OI 1Q822 1QF8A 1YUAA 1VQKZ 2QKDA 4RVGA 1VQ71 2RBLA 3CCS1 3NFZA 1USPB 1KQSY 2RHBA 2NVYI 4NFRA 2KPIA 4NBDA 4E2ZA 3CPWZ 3HOZI 4S1TA 3GTQI 1VQL1 1JWHC 5FLMI 3GTMS 4A3MI 3CCJ1 4A3LI 5A2Qf 4EWCA 4NOZA 3CCQZ 2Q51A 3FQMA 2OOYB 4NBGA 1ZB8A 2JR6A 5IP9I 3Q87A 3CCSZ 1RNIA 1KC82 1L1OC 1TFIA 3I07A 3RZDI 3G6E1 4E2WA 4RVFA 5IT9f 1YI2Z 1VQLZ 4A3BI 1YIT1 2JA7I 3CCJZ 1VQPZ 3CME1 3IF8A 5C3EI 3PO3S 3M3YI 1N2FA 2HF1A 4BBRI 1X0TA 1YIJ1 2R93I 2AKLA 3J80f 1NJI2 3GTLI 3CMA1 2KI7B 1M1K2 1TWAI 1TWCI 1RO4A 3NDIA 3CC41 2VF1A 3G6EZ 1R9TI 1VQ8Z 2JA8I 4E2XA 1YITZ 3FQQA 3KIFA 1KRLA 3KIHA 1QVGZ 3CMEZ 1RO2A 1VQMZ 4DQYB 3HOUI 3J81b 3BG0B 3I561 1RQFA 3F3FC 1YIJZ 3S1MI 4XX2A 1VQN1 2RPRA 1Q7Y1 3CMAZ 2OTL1 3VMHA 1PFTA 4MD8A 2JA6I 3J7A4 3S1NI 3CCMZ 2DE6A 1Q812 3BG1B 5D1OA 4A3II 3G711 4TNUA 4BXXI 3S1RI 3JAMb 4RVHA 5T64A 2V8KA 1Z01A 3I56Z 1M902 2QREB 1VQNZ 3NH5A 3D6WA 1RO0A 1Q861 1WCMI 4RVDA 4NB9A 4AYBA 1S72Z 1LQLA 2V8IA 2V8JA 1TWHI 2P3YA 2IZ4A 3G71Z 3U50C 2OZKA 3S2HI 3MONA 1Y1VS 2J6AA 1KD11 3CXCY 1VQOZ 1VQ4Z 2K3RA 2WAQA 4DGLA 2I3CA 2W03A 2QEX1 1QVGY 3VTNA 3CC7Z 1Q821 2QRDB 3I4NI 2HU9A 2JUBA 3IX0A 3S17I 2NVTI 2JA5I 2QLVB 4HGYA 5IP7I 4NBFA 4HH4A 3EEDA 2YU9I 3ESWA 1Z03A 3GTJI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NJI 2;  1VQ7 Z;  3CMA 1;  1M1K 2;  1K73 2;  3CC4 1;  1VQ5 1;  3G6E Z;  1S72 1;  3CD6 1;  1QVF Z;  2OTJ 1;  1YJN Z;  1VQ9 1;  1VQ8 Z;  3CC2 Z;  2QA4 1;  1JJ2 Z;  1YIT Z;  3I55 1;  1YJ9 Z;  1QVG Z;  3CME Z;  3CCV Z;  3CCU Z;  1VQM Z;  1W2B Z;  1VQO 1;  1VQ4 1;  1K8A 2;  3I56 1;  2QEX Z;  3OW2 Z;  1YIJ Z;  1YJW Z;  1VQN 1;  1Q86 2;  3CC7 1;  1Q7Y 1;  3CMA Z;  2OTL 1;  1VQK 1;  1VQ5 Z;  3CD6 Z;  1M1K 1;  1K73 1;  3CCM Z;  1Q81 2;  2OTJ Z;  1KC8 1;  1N8R 2;  1VQ9 Z;  1YI2 1;  3G71 1;  2QA4 Z;  3CXC Z;  1QVF Y;  1KD1 2;  1VQ6 Z;  1VQP 1;  3I56 Z;  1M90 2;  1YHQ Z;  3CCQ 1;  3CCE 1;  1K8A 1;  1VQN Z;  1W2B Y;  1Q82 2;  3CCR 1;  1VQK Z;  1VQ7 1;  1Q86 1;  3CCS 1;  1KQS Y;  3CC4 Z;  1NJI 1;  1S72 Z;  3CPW Z;  3G71 Z;  1Q81 1;  1YJN 1;  3G4S 1;  1N8R 1;  1VQ8 1;  1VQL 1;  3I55 Z;  1K9M 2;  1KD1 1;  3CXC Y;  3CCU 1;  3CCJ 1;  1VQM 1;  1VQO Z;  1VQ4 Z;  3CCL 1;  1JJ2 Y;  3CCQ Z;  3CCE Z;  1M90 1;  1QVG Y;  2QEX 1;  3CCR Z;  1YJW 1;  3CC7 Z;  1Q82 1;  2OTL Z;  3CCS Z;  3OW2 Y;  1KC8 2;  3CCM 1;  3G6E 1;  3G4S Z;  1YI2 Z;  1VQL Z;  3CPW Y;  3CC2 1;  1YIT 1;  3CCJ Z;  1VQ6 1;  1YJ9 1;  1VQP Z;  3CCL Z;  3CME 1;  1K9M 1;  3CCV 1;  1YHQ 1;  1KQS Z;  1Q7Y 2;  1YIJ 1; 
#chains in the Genus database with same CATH topology
 3IFU A;  2JMO A;  1VQ7 Z;  1K73 2;  2RT9 A;  1VQ5 1;  3CQZ I;  2EGT A;  2OTJ 1;  3GTO I;  1ZB9 A;  3TDH B;  2PMZ A;  3I55 1;  2M6N A;  4A3J I;  2LFU A;  1K8A 2;  5A2Q b;  3T4N B;  1I3Q I;  2W04 A;  4A3C I;  2B63 I;  2OOX B;  2IZ3 A;  4MON A;  2DE5 A;  3HOY I;  2G2K A;  4NBB A;  1VQ5 Z;  3H3V J;  1M1K 1;  4X6A I;  4A3K I;  1Z02 A;  2OTJ Z;  5D1P A;  1N8R 2;  2PM9 A;  5IT9 b;  3CXC Z;  1QXF A;  2F4O A;  3IR7 A;  5FLX f;  3QWU A;  5C44 I;  3CCE 1;  3P5J B;  2E2I I;  3D2L A;  4A3F I;  1YUK A;  3CCR 1;  1FDO A;  5LL6 f;  1TWF I;  3PO3 I;  3J80 b;  1WZN A;  2NAP A;  3CC4 Z;  3GTG I;  4A3G I;  2P28 A;  2QR1 B;  1TWG I;  4NBE A;  1Q81 1;  1YJN 1;  3S15 I;  3VB9 A;  1ML8 A;  4Y7N I;  1USP A;  1K9M 2;  2VPX A;  2H85 A;  3CCU 1;  3CCE Z;  1X3Z A;  1M90 1;  3CCR Z;  1YJW 1;  2K5R A;  2OTL Z;  2E9H A;  4A93 I;  2JIO A;  4MXU A;  2V3V A;  1NP6 A;  2NVQ I;  4HGZ A;  3CC2 1;  1VQ6 1;  4MRI A;  1YJ9 1;  3MZK B;  2GU2 A;  4BY7 I;  3GCF A;  2Q4Z A;  1K83 I;  1I50 I;  1YHQ 1;  4BBS I;  3VMG A;  1ZH1 A;  5CM2 M;  4NBC A;  2NVX I;  1P9N A;  3H0G I;  3CD6 1;  1AA6 A;  2PK7 A;  3S2D I;  5C4X I;  1I6H I;  1VQ9 1;  3CC2 Z;  4NBA A;  1JJ2 Z;  1YJ9 Z;  1Y1W I;  4MH4 A;  1QYP A;  2QEX Z;  2E2H I;  1WII A;  3OW2 Z;  5D1O B;  3NH8 A;  2M48 A;  3VMI A;  2ZAE B;  4NB8 A;  2JS4 A;  3CD6 Z;  1K73 1;  3LUS A;  4E31 A;  1KC8 1;  4NBH A;  2JNY A;  4MD7 A;  3TE5 B;  1VQ9 Z;  3RZO I;  1YI2 1;  1NUI A;  3F3P C;  2YAD A;  1QVF Y;  2JIP A;  1VQP 1;  2O4H A;  1X3W A;  1K8A 1;  1W2B Y;  3FKI I;  1S7M A;  3GTM I;  2R6M A;  2GTH A;  3MZL B;  1NJI 1;  3K7A I;  2QRC B;  5T67 A;  3G4S 1;  1N8R 1;  1VQ8 1;  3GTK I;  3I55 Z;  3HKZ A;  3J81 f;  3D9X A;  2F4M A;  1VQM 1;  3CCL 1;  1JJ2 Y;  1WW9 A;  2O53 A;  2BJO A;  1FDI A;  3I4M I;  2JIR A;  3OW2 Y;  2RIQ A;  2R92 I;  3CCM 1;  4BY1 I;  3G4S Z;  2VUM I;  3JAM f;  2E2J I;  3CPW Y;  3HOW I;  3S1Q I;  3HOV I;  2VUG A;  1RLY A;  4QTT A;  3CCL Z;  1K9M 1;  3CCV 1;  5FLX b;  1KQS Z;  3HOX I;  1Q7Y 2;  4Y52 I;  3S16 I;  4E30 A;  1VLA A;  4QTU A;  4E32 A;  2LIY A;  2Y0S A;  4MD9 A;  1S72 1;  1QVF Z;  2E7Z A;  2R7Z I;  1YJN Z;  4A3E I;  1Y8C A;  2QA4 1;  5AN9 F;  5T6B A;  4E33 A;  3CCV Z;  3CCU Z;  4NH1 C;  4E2Y A;  1W2B Z;  1VQO 1;  4DK1 A;  1VQ4 1;  4CL1 A;  4RV9 A;  1YJW Z;  1Q86 2;  3CC7 1;  5C4J I;  1VQK 1;  1DL6 A;  4A3D I;  3GTP I;  3NDJ A;  4RS4 A;  3GKQ A;  3PO2 I;  2GTI A;  2QA4 Z;  3NH4 A;  1KD1 2;  2JIM A;  2DE7 A;  2WB1 A;  1VQ6 Z;  3EER A;  3S14 I;  1YHQ Z;  3CCQ 1;  1SFO I;  1Y1V I;  3M4O I;  1Q82 2;  1QF8 A;  1YUA A;  2VPW A;  1VQK Z;  2QKD A;  4RVG A;  1VQ7 1;  2RBL A;  3CCS 1;  3NFZ A;  1USP B;  1KQS Y;  2RHB A;  2NVY I;  4NFR A;  2KPI A;  4NBD A;  4E2Z A;  3CPW Z;  2V45 A;  3HOZ I;  4S1T A;  3GTQ I;  1WJ2 A;  1VQL 1;  1JWH C;  5FLM I;  3GTM S;  4A3M I;  3CCJ 1;  4A3L I;  5A2Q f;  4EWC A;  4NOZ A;  3CCQ Z;  2Q51 A;  3FQM A;  2OOY B;  4NBG A;  1ZB8 A;  2JR6 A;  5IP9 I;  3Q87 A;  3CCS Z;  1RNI A;  1KC8 2;  1L1O C;  1TFI A;  3I07 A;  3RZD I;  3G6E 1;  4E2W A;  4RVF A;  5IT9 f;  1YI2 Z;  1VQL Z;  4A3B I;  2VPZ A;  1YIT 1;  2JA7 I;  3CCJ Z;  1VQP Z;  3CME 1;  3IF8 A;  5C3E I;  3PO3 S;  3M3Y I;  1N2F A;  2HF1 A;  4BBR I;  1X0T A;  1YIJ 1;  2LEX A;  2R93 I;  2AKL A;  3J80 f;  1NJI 2;  3GTL I;  3CMA 1;  2KI7 B;  1M1K 2;  1TWA I;  1TWC I;  1RO4 A;  3NDI A;  3CC4 1;  2VF1 A;  3G6E Z;  1R9T I;  1VQ8 Z;  2JA8 I;  4E2X A;  1YIT Z;  3FQQ A;  3KIF A;  1KRL A;  3KIH A;  1QVG Z;  3CME Z;  1RO2 A;  1VQM Z;  4DQY B;  3HOU I;  3J81 b;  3BG0 B;  3I56 1;  1RQF A;  2AYD A;  3F3F C;  1YIJ Z;  3S1M I;  4XX2 A;  1VQN 1;  2RPR A;  1Q7Y 1;  3CMA Z;  2OTL 1;  3VMH A;  1PFT A;  4MD8 A;  2JA6 I;  3J7A 4;  3S1N I;  3CCM Z;  2DE6 A;  1Q81 2;  3BG1 B;  5D1O A;  1SIW A;  4A3I I;  3G71 1;  4TNU A;  4BXX I;  3S1R I;  3JAM b;  4RVH A;  5T64 A;  2V8K A;  1Z01 A;  3I56 Z;  1M90 2;  2QRE B;  1VQN Z;  3NH5 A;  2JIQ A;  3D6W A;  1RO0 A;  1Q86 1;  1WCM I;  4RVD A;  4NB9 A;  4AYB A;  1S72 Z;  1LQL A;  2V8I A;  2V8J A;  1TWH I;  2P3Y A;  2IZ4 A;  3G71 Z;  3U50 C;  2OZK A;  3S2H I;  3MON A;  1Y1V S;  2J6A A;  1KD1 1;  3CXC Y;  1VQO Z;  1VQ4 Z;  2K3R A;  2WAQ A;  4DGL A;  2IV2 X;  2I3C A;  2W03 A;  2QEX 1;  1QVG Y;  3VTN A;  3CC7 Z;  1Q82 1;  2QRD B;  3I4N I;  2HU9 A;  2JUB A;  3IX0 A;  3S17 I;  2NVT I;  2JA5 I;  2QLV B;  4HGY A;  2VPY A;  5IP7 I;  4NBF A;  4HH4 A;  1Q16 A;  3EED A;  2YU9 I;  3ESW A;  1Z03 A;  3GTJ I; 
#chains in the Genus database with same CATH homology
 3IFU A;  2JMO A;  1VQ7 Z;  1K73 2;  2RT9 A;  1VQ5 1;  3CQZ I;  2EGT A;  2OTJ 1;  3GTO I;  1ZB9 A;  3TDH B;  2PMZ A;  3I55 1;  2M6N A;  4A3J I;  2LFU A;  1K8A 2;  5A2Q b;  3T4N B;  1I3Q I;  2W04 A;  4A3C I;  2B63 I;  2OOX B;  2IZ3 A;  4MON A;  2DE5 A;  3HOY I;  2G2K A;  4NBB A;  1VQ5 Z;  3H3V J;  1M1K 1;  4X6A I;  4A3K I;  1Z02 A;  2OTJ Z;  5D1P A;  1N8R 2;  2PM9 A;  5IT9 b;  3CXC Z;  2F4O A;  5FLX f;  3QWU A;  5C44 I;  3CCE 1;  3P5J B;  2E2I I;  4A3F I;  1YUK A;  3CCR 1;  5LL6 f;  1TWF I;  3PO3 I;  3J80 b;  3CC4 Z;  3GTG I;  4A3G I;  2P28 A;  2QR1 B;  1TWG I;  4NBE A;  1Q81 1;  1YJN 1;  3S15 I;  3VB9 A;  1ML8 A;  4Y7N I;  1USP A;  1K9M 2;  2H85 A;  3CCU 1;  3CCE Z;  1X3Z A;  1M90 1;  3CCR Z;  1YJW 1;  2K5R A;  2OTL Z;  2E9H A;  4A93 I;  4MXU A;  1NP6 A;  2NVQ I;  4HGZ A;  3CC2 1;  1VQ6 1;  4MRI A;  1YJ9 1;  3MZK B;  2GU2 A;  4BY7 I;  3GCF A;  2Q4Z A;  1K83 I;  1I50 I;  1YHQ 1;  4BBS I;  3VMG A;  1ZH1 A;  5CM2 M;  4NBC A;  2NVX I;  1P9N A;  3H0G I;  3CD6 1;  2PK7 A;  3S2D I;  5C4X I;  1I6H I;  1VQ9 1;  3CC2 Z;  4NBA A;  1JJ2 Z;  1YJ9 Z;  1Y1W I;  4MH4 A;  1QYP A;  2QEX Z;  2E2H I;  1WII A;  3OW2 Z;  5D1O B;  3NH8 A;  2M48 A;  3VMI A;  2ZAE B;  4NB8 A;  2JS4 A;  3CD6 Z;  1K73 1;  3LUS A;  4E31 A;  1KC8 1;  4NBH A;  2JNY A;  4MD7 A;  3TE5 B;  1VQ9 Z;  3RZO I;  1YI2 1;  1NUI A;  3F3P C;  2YAD A;  1QVF Y;  1VQP 1;  2O4H A;  1X3W A;  1K8A 1;  1W2B Y;  3FKI I;  1S7M A;  3GTM I;  2R6M A;  2GTH A;  3MZL B;  1NJI 1;  3K7A I;  2QRC B;  5T67 A;  3G4S 1;  1N8R 1;  1VQ8 1;  3GTK I;  3I55 Z;  3HKZ A;  3J81 f;  3D9X A;  2F4M A;  1VQM 1;  3CCL 1;  1JJ2 Y;  1WW9 A;  2O53 A;  2BJO A;  3I4M I;  3OW2 Y;  2RIQ A;  2R92 I;  3CCM 1;  4BY1 I;  3G4S Z;  2VUM I;  3JAM f;  2E2J I;  3CPW Y;  3HOW I;  3S1Q I;  3HOV I;  2VUG A;  1RLY A;  4QTT A;  3CCL Z;  1K9M 1;  3CCV 1;  5FLX b;  1KQS Z;  3HOX I;  1Q7Y 2;  4Y52 I;  3S16 I;  4E30 A;  1VLA A;  4QTU A;  4E32 A;  2LIY A;  2Y0S A;  4MD9 A;  1S72 1;  1QVF Z;  2R7Z I;  1YJN Z;  4A3E I;  2QA4 1;  5AN9 F;  5T6B A;  4E33 A;  3CCV Z;  3CCU Z;  4NH1 C;  4E2Y A;  1W2B Z;  1VQO 1;  4DK1 A;  1VQ4 1;  4CL1 A;  4RV9 A;  1YJW Z;  1Q86 2;  3CC7 1;  5C4J I;  1VQK 1;  1DL6 A;  4A3D I;  3GTP I;  3NDJ A;  4RS4 A;  3GKQ A;  3PO2 I;  2GTI A;  2QA4 Z;  3NH4 A;  1KD1 2;  2DE7 A;  2WB1 A;  1VQ6 Z;  3EER A;  3S14 I;  1YHQ Z;  3CCQ 1;  1SFO I;  1Y1V I;  3M4O I;  1Q82 2;  1QF8 A;  1YUA A;  1VQK Z;  2QKD A;  4RVG A;  1VQ7 1;  2RBL A;  3CCS 1;  3NFZ A;  1USP B;  1KQS Y;  2RHB A;  2NVY I;  4NFR A;  2KPI A;  4NBD A;  4E2Z A;  3CPW Z;  3HOZ I;  4S1T A;  3GTQ I;  1VQL 1;  1JWH C;  5FLM I;  3GTM S;  4A3M I;  3CCJ 1;  4A3L I;  5A2Q f;  4EWC A;  4NOZ A;  3CCQ Z;  2Q51 A;  3FQM A;  2OOY B;  4NBG A;  1ZB8 A;  2JR6 A;  5IP9 I;  3Q87 A;  3CCS Z;  1RNI A;  1KC8 2;  1L1O C;  1TFI A;  3I07 A;  3RZD I;  3G6E 1;  4E2W A;  4RVF A;  5IT9 f;  1YI2 Z;  1VQL Z;  4A3B I;  1YIT 1;  2JA7 I;  3CCJ Z;  1VQP Z;  3CME 1;  3IF8 A;  5C3E I;  3PO3 S;  3M3Y I;  1N2F A;  2HF1 A;  4BBR I;  1X0T A;  1YIJ 1;  2R93 I;  2AKL A;  3J80 f;  1NJI 2;  3GTL I;  3CMA 1;  2KI7 B;  1M1K 2;  1TWA I;  1TWC I;  1RO4 A;  3NDI A;  3CC4 1;  2VF1 A;  3G6E Z;  1R9T I;  1VQ8 Z;  2JA8 I;  4E2X A;  1YIT Z;  3FQQ A;  3KIF A;  1KRL A;  3KIH A;  1QVG Z;  3CME Z;  1RO2 A;  1VQM Z;  4DQY B;  3HOU I;  3J81 b;  3BG0 B;  3I56 1;  1RQF A;  3F3F C;  1YIJ Z;  3S1M I;  4XX2 A;  1VQN 1;  2RPR A;  1Q7Y 1;  3CMA Z;  2OTL 1;  3VMH A;  1PFT A;  4MD8 A;  2JA6 I;  3J7A 4;  3S1N I;  3CCM Z;  2DE6 A;  1Q81 2;  3BG1 B;  5D1O A;  4A3I I;  3G71 1;  4TNU A;  4BXX I;  3S1R I;  3JAM b;  4RVH A;  5T64 A;  2V8K A;  1Z01 A;  3I56 Z;  1M90 2;  2QRE B;  1VQN Z;  3NH5 A;  3D6W A;  1RO0 A;  1Q86 1;  1WCM I;  4RVD A;  4NB9 A;  4AYB A;  1S72 Z;  1LQL A;  2V8I A;  2V8J A;  1TWH I;  2P3Y A;  2IZ4 A;  3G71 Z;  3U50 C;  2OZK A;  3S2H I;  3MON A;  1Y1V S;  2J6A A;  1KD1 1;  3CXC Y;  1VQO Z;  1VQ4 Z;  2K3R A;  2WAQ A;  4DGL A;  2I3C A;  2W03 A;  2QEX 1;  1QVG Y;  3VTN A;  3CC7 Z;  1Q82 1;  2QRD B;  3I4N I;  2HU9 A;  2JUB A;  3IX0 A;  3S17 I;  2NVT I;  2JA5 I;  2QLV B;  4HGY A;  5IP7 I;  4NBF A;  4HH4 A;  3EED A;  2YU9 I;  3ESW A;  1Z03 A;  3GTJ I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...