3CCS1

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482a
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
b'TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccs100
1K8A2 3CMEZ 3CCU1 1YJWZ 1YIJZ 3CME1 3CMAZ 1YJW1 1YIJ1 1KC81 1K9M1 3CCRZ 1K8A1 3CCSZ 1QVFY 1NJI1 1KD12 2QEX1 3CCR1 3CCS1 1VQKZ 3CPWZ 1Q7Y2 1W2BZ 1VQK1 3G71Z 1Q862 1N8R1 3G6EZ 3G711 3CCMZ 1JJ2Z 1QVGY 3G6E1 1Q7Y1 3CCM1 1VQ8Z 3CMA1 1VQ81 2QA4Z 1YI2Z 3OW2Y 3CD6Z 1VQ6Z 3I56Z 3CXCY 3CCVZ 1KQSY 1VQ7Z 3CC7Z 1Q822 2QA41 2OTJZ 1YI21 1VQ61 3I561 3CCV1 1M902 1VQ71 1VQMZ 1KD11 2OTJ1 1YJNZ 1S72Z 3CCQZ 1VQM1 1Q812 1VQ9Z 1YJN1 1S721 3CC2Z 1Q821 3CCQ1 3G4SZ 3CC4Z 1M901 3CCLZ 1VQ91 3CC21 1Q861 1YHQZ 3G4S1 1VQ5Z 3CC41 3CCL1 1QVFZ 1Q811 1YHQ1 3CPWY 1VQ51 1VQOZ 1W2BY 2OTLZ 3CD61 1VQO1 1VQLZ 2OTL1 3CCEZ 1VQPZ 1NJI2 3CC71 1JJ2Y 1YITZ 1M1K2 1VQL1 3CCJZ 3CCE1 1VQP1 1YIT1 2QEXZ 1K732 3CCJ1 1QVGZ 1VQ4Z 3I55Z 1YJ9Z 1M1K1 1N8R2 1VQ41 3I551 1YJ91 1VQNZ 1K731 3OW2Z 3CCUZ 1KC82 1KQSZ 3CXCZ 1VQN1 1K9M2
chains in the Genus database with same CATH superfamily
4NOZA 1K8A2 2WB1A 1WCMI 4NH1C 4RVDA 1TWAI 5D1PA 3VMIA 3CMAZ 1KC81 1K9M1 2R6MA 1NJI1 2OOYB 3CCR1 3JAMb 3CCS1 1TWCI 1VQKZ 5D1OB 2Q4ZA 1ZH1A 4Y7NI 3PO3S 4CL1A 3GTMS 3G6EZ 1TFIA 2AYDA 3M4OI 4A3II 3NH8A 3JAMf 1Q7Y1 1Y1VS 3NFZA 3CMA1 3IF8A 3TDHB 3J7A4 3HOWI 1R9TI 4S1TA 1VQ81 4DQYB 3CCVZ 1VQ7Z 2M6NA 2O53A 3VMHA 2QA41 4BBRI 1I50I 2V3VA 2VPZA 4A3MI 1I3QI 1YI21 1M902 2BJOA 2JIPA 1VQMZ 2OTJ1 1YJNZ 2QRDB 2O4HA 3D2LA 3HOXI 1VQ9Z 5CM2M 1S721 2RT9A 1Q861 3VTNA 3NH5A 3G4S1 3PO3I 2E7ZA 4HGYA 3GTJI 1L1OC 1Q811 3GTMI 4HGZA 2OTLZ 2EGTA 4NBHA 3S1MI 1VQO1 5C4JI 3CCEZ 1Y1VI 3LUSA 1NP6A 1VLAA 1VQL1 3F3PC 1RO4A 2K5RA 4XX2A 4TNUA 3RZOI 2QEXZ 3BG1B 3MONA 1K732 1VQ4Z 2NVQI 1SFOI 4X6AI 5T67A 2PM9A 1N8R2 4E33A 1VQNZ 2Y0SA 2E2JI 2LEXA 3MZLB 5LL6f 4NBGA 3S16I 2I3CA 1LQLA 2HF1A 4EWCA 1YJW1 1YIJ1 3CCRZ 1K8A1 3CCSZ 1QVFY 2QEX1 2M48A 1Z02A 4A3BI 3J81b 3EERA 4MD8A 3S1NI 2F4MA 2RIQA 2QKDA 3T4NB 3J80f 3G711 4QTTA 2OZKA 1QVGY 3GTOI 4A3FI 1NUIA 3TE5B 3J81f 3CCM1 4MD9A 1VQ8Z 3NDIA 2W04A 1WJ2A 1N2FA 3Q87A 1S7MA 4BY7I 2QA4Z 1YI2Z 5T64A 3CC7Z 2OTJZ 3EEDA 1VQ61 4NBCA 1KD11 2WAQA 1S72Z 1X3WA 5C3EI 2QLVB 3VB9A 2E2II 1I6HI 4E2ZA 4NBBA 3CQZI 3CCQ1 4MD7A 3S14I 3G4SZ 1ML8A 1M901 1P9NA 3K7AI 3S15I 1KRLA 3U50C 3CCL1 2LFUA 1QVFZ 3S1QI 1VQOZ 2NVXI 2JMOA 2JR6A 2NVYI 2YADA 3BG0B 1SIWA 1VQLZ 3GTGI 2JIOA 1NJI2 2QRCB 3CC71 1JJ2Y 5C4XI 1M1K2 4E2XA 2R93I 2VUMI 5A2Qf 1Z01A 1FDOA 4NBDA 4QTUA 4NBEA 1QVGZ 2IZ4A 3KIFA 4RS4A 4BXXI 2JA7I 3I551 1RQFA 2JS4A 1TWGI 2LIYA 4Y52I 1K731 4A3GI 1WZNA 4E30A 1AA6A 1TWFI 3S1RI 3CCU1 1YJWZ 1YIJZ 4HH4A 3S2HI 2VPWA 3I4MI 3CME1 2RBLA 5FLXb 4MXUA 4A3KI 3IR7A 3GTLI 5FLMI 2NAPA 4E31A 3I4NI 3KIHA 2DE5A 3MZKB 5AN9F 1YUKA 3D9XA 2R7ZI 1WIIA 2GTIA 2NVTI 5C44I 3G71Z 1Q862 2F4OA 5FLXf 2R92I 1ZB8A 2KI7B 3S17I 2DE7A 3CCMZ 2J6AA 1JJ2Z 1TWHI 4RVGA 1YUAA 3J80b 4A3CI 3RZDI 3OW2Y 3CD6Z 1VQ6Z 1KQSY 3CXCY 1Q822 3GKQA 3I561 1X0TA 3GTPI 3CCQZ 2E9HA 2GTHA 3CCLZ 3D6WA 3PO2I 2JA5I 3CC21 4MRIA 4E2YA 3CC41 1YHQ1 3CPWY 1VQ51 1W2BY 4RVHA 1QF8A 2VUGA 3GTQI 1FDIA 4A93I 2JA8I 2B63I 3CD61 3FKII 2AKLA 4RV9A 2P28A 2P3YA 3P5JB 4A3LI 3QWUA 1VQP1 1YIT1 3IX0A 1QYPA 3CCJ1 4A3JI 3I55Z 4NFRA 3GTKI 1M1K1 1PFTA 1RO0A 5A2Qb 1ZB9A 1YJ91 2KPIA 2V8JA 3OW2Z 3HKZA 3CCUZ 1KC82 1KQSZ 3CXCZ 1K9M2 3FQQA 3CMEZ 5IP9I 4MONA 2JNYA 1JWHC 3IFUA 4NBFA 4A3DI 3NH4A 4A3EI 3NDJA 2K3RA 3HOZI 2RHBA 2PK7A 4DK1A 1K83I 3FQMA 1KD12 1USPA 3HOYI 3CPWZ 1Q7Y2 4NB8A 1W2BZ 2HU9A 1VQK1 2JIRA 3I07A 1N8R1 1RNIA 1Y8CA 2W03A 1RO2A 1DL6A 3H0GI 4AYBA 3G6E1 4BBSI 3HOVI 3M3YI 2JIMA 3H3VJ 5D1OA 5IT9b 5IP7I 2VPYA 2DE6A 3I56Z 4E32A 4RVFA 2YU9I 2PMZA 3CCV1 1VQ71 4MH4A 4BY1I 2VPXA 1VQM1 1Q812 5IT9f 3S2DI 2JA6I 1YJN1 1Q821 3CC2Z 2V8KA 2VF1A 3CC4Z 1Z03A 1VQ91 2V45A 2Q51A 1YHQZ 1VQ5Z 3F3FC 1QXFA 1X3ZA 5T6BA 2GU2A 4DGLA 4NBAA 4E2WA 2OTL1 1VQPZ 1YITZ 3CCJZ 3CCE1 2G2KA 2IV2X 2JIQA 3ESWA 3VMGA 1RLYA 2V8IA 2IZ3A 1Y1WI 2QREB 2H85A 3HOUI 2JUBA 1YJ9Z 1VQ41 1WW9A 2E2HI 2ZAEB 2OOXB 3GCFA 4NB9A 1USPB 2QR1B 1Q16A 1VQN1 2RPRA
chains in the Genus database with same CATH topology
4NOZA 1K8A2 2WB1A 1WCMI 4NH1C 4RVDA 1TWAI 5D1PA 3VMIA 3CMAZ 1KC81 1K9M1 2R6MA 1NJI1 2OOYB 3CCR1 3JAMb 3CCS1 1TWCI 1VQKZ 5D1OB 2Q4ZA 1ZH1A 4Y7NI 3PO3S 4CL1A 3GTMS 3G6EZ 1TFIA 3M4OI 4A3II 3NH8A 3JAMf 1Q7Y1 1Y1VS 3NFZA 3CMA1 3IF8A 3TDHB 3J7A4 3HOWI 1R9TI 4S1TA 1VQ81 4DQYB 3CCVZ 1VQ7Z 2M6NA 2O53A 3VMHA 2QA41 4BBRI 1I50I 4A3MI 1YI21 1I3QI 1M902 2BJOA 1VQMZ 2OTJ1 1YJNZ 2QRDB 2O4HA 3HOXI 1VQ9Z 5CM2M 1S721 2RT9A 1Q861 3VTNA 3NH5A 3G4S1 3PO3I 4HGYA 3GTJI 1L1OC 1Q811 3GTMI 4HGZA 2OTLZ 2EGTA 4NBHA 3S1MI 1VQO1 5C4JI 3CCEZ 1Y1VI 3LUSA 1NP6A 1VLAA 1VQL1 3F3PC 1RO4A 2K5RA 4XX2A 4TNUA 3RZOI 2QEXZ 3BG1B 3MONA 1K732 1VQ4Z 2NVQI 1SFOI 4X6AI 5T67A 2PM9A 1N8R2 4E33A 1VQNZ 2Y0SA 2E2JI 3MZLB 5LL6f 4NBGA 3S16I 2I3CA 1LQLA 2HF1A 4EWCA 1YJW1 1YIJ1 3CCRZ 1K8A1 3CCSZ 1QVFY 2QEX1 2M48A 1Z02A 4A3BI 3J81b 3EERA 4MD8A 3S1NI 2F4MA 2RIQA 2QKDA 3T4NB 3J80f 3G711 4QTTA 2OZKA 1QVGY 3GTOI 4A3FI 1NUIA 3TE5B 3J81f 3CCM1 4MD9A 1VQ8Z 3NDIA 2W04A 1N2FA 3Q87A 1S7MA 4BY7I 2QA4Z 1YI2Z 5T64A 3CC7Z 2OTJZ 3EEDA 1VQ61 4NBCA 1KD11 2WAQA 1S72Z 1X3WA 5C3EI 2QLVB 3VB9A 2E2II 1I6HI 4E2ZA 4NBBA 3CQZI 3CCQ1 4MD7A 3S14I 3G4SZ 1ML8A 1M901 1P9NA 3K7AI 3S15I 1KRLA 3U50C 3CCL1 2LFUA 1QVFZ 3S1QI 1VQOZ 2NVXI 2JMOA 2JR6A 2NVYI 2YADA 3BG0B 1VQLZ 3GTGI 1NJI2 2QRCB 3CC71 1JJ2Y 5C4XI 1M1K2 4E2XA 2R93I 2VUMI 5A2Qf 1Z01A 4NBDA 4QTUA 4NBEA 1QVGZ 2IZ4A 3KIFA 4RS4A 4BXXI 2JA7I 3I551 1RQFA 2JS4A 1TWGI 2LIYA 4Y52I 1K731 4A3GI 4E30A 1TWFI 3S1RI 3CCU1 1YJWZ 1YIJZ 4HH4A 3S2HI 3I4MI 3CME1 2RBLA 5FLXb 4MXUA 4A3KI 3GTLI 5FLMI 4E31A 3I4NI 3KIHA 2DE5A 3MZKB 5AN9F 1YUKA 3D9XA 2R7ZI 1WIIA 2GTIA 2NVTI 5C44I 3G71Z 1Q862 2F4OA 5FLXf 2R92I 1ZB8A 2KI7B 3S17I 2DE7A 3CCMZ 2J6AA 1JJ2Z 1TWHI 4RVGA 1YUAA 3J80b 4A3CI 3RZDI 3OW2Y 3CD6Z 1VQ6Z 1KQSY 3CXCY 1Q822 3GKQA 3I561 1X0TA 3GTPI 3CCQZ 2E9HA 2GTHA 3CCLZ 3D6WA 3PO2I 2JA5I 3CC21 4MRIA 4E2YA 3CC41 1YHQ1 3CPWY 1VQ51 1W2BY 4RVHA 1QF8A 2VUGA 3GTQI 4A93I 2JA8I 2B63I 3CD61 3FKII 2AKLA 4RV9A 2P28A 2P3YA 3P5JB 4A3LI 3QWUA 1VQP1 1YIT1 3IX0A 1QYPA 3CCJ1 4A3JI 3I55Z 4NFRA 3GTKI 1M1K1 1PFTA 1RO0A 5A2Qb 1ZB9A 1YJ91 2KPIA 2V8JA 3OW2Z 3HKZA 3CCUZ 1KC82 1KQSZ 3CXCZ 1K9M2 3FQQA 3CMEZ 5IP9I 4MONA 2JNYA 1JWHC 3IFUA 4NBFA 4A3DI 3NH4A 4A3EI 3NDJA 2K3RA 3HOZI 2RHBA 2PK7A 4DK1A 1K83I 3FQMA 1KD12 1USPA 3HOYI 3CPWZ 1Q7Y2 4NB8A 1W2BZ 2HU9A 1VQK1 3I07A 1N8R1 1RNIA 2W03A 1RO2A 1DL6A 3H0GI 4AYBA 3G6E1 4BBSI 3HOVI 3M3YI 3H3VJ 5D1OA 5IT9b 5IP7I 2DE6A 3I56Z 4E32A 4RVFA 2YU9I 2PMZA 3CCV1 1VQ71 4MH4A 4BY1I 1VQM1 1Q812 5IT9f 3S2DI 2JA6I 1YJN1 1Q821 3CC2Z 2V8KA 2VF1A 3CC4Z 1Z03A 1VQ91 1YHQZ 2Q51A 1VQ5Z 3F3FC 1X3ZA 5T6BA 2GU2A 4DGLA 4NBAA 4E2WA 2OTL1 1VQPZ 1YITZ 3CCJZ 3CCE1 2G2KA 3ESWA 3VMGA 1RLYA 2V8IA 2IZ3A 1Y1WI 2QREB 2H85A 3HOUI 2JUBA 1YJ9Z 1VQ41 1WW9A 2E2HI 2ZAEB 2OOXB 3GCFA 4NB9A 1USPB 2QR1B 1VQN1 2RPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8A 2;  3CME Z;  3CCU 1;  1YJW Z;  1YIJ Z;  3CME 1;  3CMA Z;  1YJW 1;  1YIJ 1;  1KC8 1;  1K9M 1;  3CCR Z;  1K8A 1;  3CCS Z;  1QVF Y;  1NJI 1;  1KD1 2;  2QEX 1;  3CCR 1;  3CCS 1;  1VQK Z;  3CPW Z;  1Q7Y 2;  1W2B Z;  1VQK 1;  3G71 Z;  1Q86 2;  1N8R 1;  3G6E Z;  3G71 1;  3CCM Z;  1JJ2 Z;  1QVG Y;  3G6E 1;  1Q7Y 1;  3CCM 1;  1VQ8 Z;  3CMA 1;  1VQ8 1;  2QA4 Z;  1YI2 Z;  3OW2 Y;  3CD6 Z;  1VQ6 Z;  3I56 Z;  3CXC Y;  3CCV Z;  1KQS Y;  1VQ7 Z;  3CC7 Z;  1Q82 2;  2QA4 1;  2OTJ Z;  1YI2 1;  1VQ6 1;  3I56 1;  3CCV 1;  1M90 2;  1VQ7 1;  1VQM Z;  1KD1 1;  2OTJ 1;  1YJN Z;  1S72 Z;  3CCQ Z;  1VQM 1;  1Q81 2;  1VQ9 Z;  1YJN 1;  1S72 1;  3CC2 Z;  1Q82 1;  3CCQ 1;  3G4S Z;  3CC4 Z;  1M90 1;  3CCL Z;  1VQ9 1;  3CC2 1;  1Q86 1;  1YHQ Z;  3G4S 1;  1VQ5 Z;  3CC4 1;  3CCL 1;  1QVF Z;  1Q81 1;  1YHQ 1;  3CPW Y;  1VQ5 1;  1VQO Z;  1W2B Y;  2OTL Z;  3CD6 1;  1VQO 1;  1VQL Z;  2OTL 1;  3CCE Z;  1VQP Z;  1NJI 2;  3CC7 1;  1JJ2 Y;  1YIT Z;  1M1K 2;  1VQL 1;  3CCJ Z;  3CCE 1;  1VQP 1;  1YIT 1;  2QEX Z;  1K73 2;  3CCJ 1;  1QVG Z;  1VQ4 Z;  3I55 Z;  1YJ9 Z;  1M1K 1;  1N8R 2;  1VQ4 1;  3I55 1;  1YJ9 1;  1VQN Z;  1K73 1;  3OW2 Z;  3CCU Z;  1KC8 2;  1KQS Z;  3CXC Z;  1VQN 1;  1K9M 2; 
#chains in the Genus database with same CATH topology
 4NOZ A;  1K8A 2;  2WB1 A;  1WCM I;  4NH1 C;  4RVD A;  1TWA I;  5D1P A;  3VMI A;  3CMA Z;  1KC8 1;  1K9M 1;  2R6M A;  1NJI 1;  2OOY B;  3CCR 1;  3JAM b;  3CCS 1;  1TWC I;  1VQK Z;  5D1O B;  2Q4Z A;  1ZH1 A;  4Y7N I;  3PO3 S;  4CL1 A;  3GTM S;  3G6E Z;  1TFI A;  2AYD A;  3M4O I;  4A3I I;  3NH8 A;  3JAM f;  1Q7Y 1;  1Y1V S;  3NFZ A;  3CMA 1;  3IF8 A;  3TDH B;  3J7A 4;  3HOW I;  1R9T I;  4S1T A;  1VQ8 1;  4DQY B;  3CCV Z;  1VQ7 Z;  2M6N A;  2O53 A;  3VMH A;  2QA4 1;  4BBR I;  1I50 I;  2V3V A;  2VPZ A;  4A3M I;  1I3Q I;  1YI2 1;  1M90 2;  2BJO A;  2JIP A;  1VQM Z;  2OTJ 1;  1YJN Z;  2QRD B;  2O4H A;  3D2L A;  3HOX I;  1VQ9 Z;  5CM2 M;  1S72 1;  2RT9 A;  1Q86 1;  3VTN A;  3NH5 A;  3G4S 1;  3PO3 I;  2E7Z A;  4HGY A;  3GTJ I;  1L1O C;  1Q81 1;  3GTM I;  4HGZ A;  2OTL Z;  2EGT A;  4NBH A;  3S1M I;  1VQO 1;  5C4J I;  3CCE Z;  1Y1V I;  3LUS A;  1NP6 A;  1VLA A;  1VQL 1;  3F3P C;  1RO4 A;  2K5R A;  4XX2 A;  4TNU A;  3RZO I;  2QEX Z;  3BG1 B;  3MON A;  1K73 2;  1VQ4 Z;  2NVQ I;  1SFO I;  4X6A I;  5T67 A;  2PM9 A;  1N8R 2;  4E33 A;  1VQN Z;  2Y0S A;  2E2J I;  2LEX A;  3MZL B;  5LL6 f;  4NBG A;  3S16 I;  2I3C A;  1LQL A;  2HF1 A;  4EWC A;  1YJW 1;  1YIJ 1;  3CCR Z;  1K8A 1;  3CCS Z;  1QVF Y;  2QEX 1;  2M48 A;  1Z02 A;  4A3B I;  3J81 b;  3EER A;  4MD8 A;  3S1N I;  2F4M A;  2RIQ A;  2QKD A;  3T4N B;  3J80 f;  3G71 1;  4QTT A;  2OZK A;  1QVG Y;  3GTO I;  4A3F I;  1NUI A;  3TE5 B;  3J81 f;  3CCM 1;  4MD9 A;  1VQ8 Z;  3NDI A;  2W04 A;  1WJ2 A;  1N2F A;  3Q87 A;  1S7M A;  4BY7 I;  2QA4 Z;  1YI2 Z;  5T64 A;  3CC7 Z;  2OTJ Z;  3EED A;  1VQ6 1;  4NBC A;  1KD1 1;  2WAQ A;  1S72 Z;  1X3W A;  5C3E I;  2QLV B;  3VB9 A;  2E2I I;  1I6H I;  4E2Z A;  4NBB A;  3CQZ I;  3CCQ 1;  4MD7 A;  3S14 I;  3G4S Z;  1ML8 A;  1M90 1;  1P9N A;  3K7A I;  3S15 I;  1KRL A;  3U50 C;  3CCL 1;  2LFU A;  1QVF Z;  3S1Q I;  1VQO Z;  2NVX I;  2JMO A;  2JR6 A;  2NVY I;  2YAD A;  3BG0 B;  1SIW A;  1VQL Z;  3GTG I;  2JIO A;  1NJI 2;  2QRC B;  3CC7 1;  1JJ2 Y;  5C4X I;  1M1K 2;  4E2X A;  2R93 I;  2VUM I;  5A2Q f;  1Z01 A;  1FDO A;  4NBD A;  4QTU A;  4NBE A;  1QVG Z;  2IZ4 A;  3KIF A;  4RS4 A;  4BXX I;  2JA7 I;  3I55 1;  1RQF A;  2JS4 A;  1TWG I;  2LIY A;  4Y52 I;  1K73 1;  4A3G I;  1WZN A;  4E30 A;  1AA6 A;  1TWF I;  3S1R I;  3CCU 1;  1YJW Z;  1YIJ Z;  4HH4 A;  3S2H I;  2VPW A;  3I4M I;  3CME 1;  2RBL A;  5FLX b;  4MXU A;  4A3K I;  3IR7 A;  3GTL I;  5FLM I;  2NAP A;  4E31 A;  3I4N I;  3KIH A;  2DE5 A;  3MZK B;  5AN9 F;  1YUK A;  3D9X A;  2R7Z I;  1WII A;  2GTI A;  2NVT I;  5C44 I;  3G71 Z;  1Q86 2;  2F4O A;  5FLX f;  2R92 I;  1ZB8 A;  2KI7 B;  3S17 I;  2DE7 A;  3CCM Z;  2J6A A;  1JJ2 Z;  1TWH I;  4RVG A;  1YUA A;  3J80 b;  4A3C I;  3RZD I;  3OW2 Y;  3CD6 Z;  1VQ6 Z;  1KQS Y;  3CXC Y;  1Q82 2;  3GKQ A;  3I56 1;  1X0T A;  3GTP I;  3CCQ Z;  2E9H A;  2GTH A;  3CCL Z;  3D6W A;  3PO2 I;  2JA5 I;  3CC2 1;  4MRI A;  4E2Y A;  3CC4 1;  1YHQ 1;  3CPW Y;  1VQ5 1;  1W2B Y;  4RVH A;  1QF8 A;  2VUG A;  3GTQ I;  1FDI A;  4A93 I;  2JA8 I;  2B63 I;  3CD6 1;  3FKI I;  2AKL A;  4RV9 A;  2P28 A;  2P3Y A;  3P5J B;  4A3L I;  3QWU A;  1VQP 1;  1YIT 1;  3IX0 A;  1QYP A;  3CCJ 1;  4A3J I;  3I55 Z;  4NFR A;  3GTK I;  1M1K 1;  1PFT A;  1RO0 A;  5A2Q b;  1ZB9 A;  1YJ9 1;  2KPI A;  2V8J A;  3OW2 Z;  3HKZ A;  3CCU Z;  1KC8 2;  1KQS Z;  3CXC Z;  1K9M 2;  3FQQ A;  3CME Z;  5IP9 I;  4MON A;  2JNY A;  1JWH C;  3IFU A;  4NBF A;  4A3D I;  3NH4 A;  4A3E I;  3NDJ A;  2K3R A;  3HOZ I;  2RHB A;  2PK7 A;  4DK1 A;  1K83 I;  3FQM A;  1KD1 2;  1USP A;  3HOY I;  3CPW Z;  1Q7Y 2;  4NB8 A;  1W2B Z;  2HU9 A;  1VQK 1;  2JIR A;  3I07 A;  1N8R 1;  1RNI A;  1Y8C A;  2W03 A;  1RO2 A;  1DL6 A;  3H0G I;  4AYB A;  3G6E 1;  4BBS I;  3HOV I;  3M3Y I;  2JIM A;  3H3V J;  5D1O A;  5IT9 b;  5IP7 I;  2VPY A;  2DE6 A;  3I56 Z;  4E32 A;  4RVF A;  2YU9 I;  2PMZ A;  3CCV 1;  1VQ7 1;  4MH4 A;  4BY1 I;  2VPX A;  1VQM 1;  1Q81 2;  5IT9 f;  3S2D I;  2JA6 I;  1YJN 1;  1Q82 1;  3CC2 Z;  2V8K A;  2VF1 A;  3CC4 Z;  1Z03 A;  1VQ9 1;  2V45 A;  2Q51 A;  1YHQ Z;  1VQ5 Z;  3F3F C;  1QXF A;  1X3Z A;  5T6B A;  2GU2 A;  4DGL A;  4NBA A;  4E2W A;  2OTL 1;  1VQP Z;  1YIT Z;  3CCJ Z;  3CCE 1;  2G2K A;  2IV2 X;  2JIQ A;  3ESW A;  3VMG A;  1RLY A;  2V8I A;  2IZ3 A;  1Y1W I;  2QRE B;  2H85 A;  3HOU I;  2JUB A;  1YJ9 Z;  1VQ4 1;  1WW9 A;  2E2H I;  2ZAE B;  2OOX B;  3GCF A;  4NB9 A;  1USP B;  2QR1 B;  1Q16 A;  1VQN 1;  2RPR A; 
#chains in the Genus database with same CATH homology
 4NOZ A;  1K8A 2;  2WB1 A;  1WCM I;  4NH1 C;  4RVD A;  1TWA I;  5D1P A;  3VMI A;  3CMA Z;  1KC8 1;  1K9M 1;  2R6M A;  1NJI 1;  2OOY B;  3CCR 1;  3JAM b;  3CCS 1;  1TWC I;  1VQK Z;  5D1O B;  2Q4Z A;  1ZH1 A;  4Y7N I;  3PO3 S;  4CL1 A;  3GTM S;  3G6E Z;  1TFI A;  3M4O I;  4A3I I;  3NH8 A;  3JAM f;  1Q7Y 1;  1Y1V S;  3NFZ A;  3CMA 1;  3IF8 A;  3TDH B;  3J7A 4;  3HOW I;  1R9T I;  4S1T A;  1VQ8 1;  4DQY B;  3CCV Z;  1VQ7 Z;  2M6N A;  2O53 A;  3VMH A;  2QA4 1;  4BBR I;  1I50 I;  4A3M I;  1YI2 1;  1I3Q I;  1M90 2;  2BJO A;  1VQM Z;  2OTJ 1;  1YJN Z;  2QRD B;  2O4H A;  3HOX I;  1VQ9 Z;  5CM2 M;  1S72 1;  2RT9 A;  1Q86 1;  3VTN A;  3NH5 A;  3G4S 1;  3PO3 I;  4HGY A;  3GTJ I;  1L1O C;  1Q81 1;  3GTM I;  4HGZ A;  2OTL Z;  2EGT A;  4NBH A;  3S1M I;  1VQO 1;  5C4J I;  3CCE Z;  1Y1V I;  3LUS A;  1NP6 A;  1VLA A;  1VQL 1;  3F3P C;  1RO4 A;  2K5R A;  4XX2 A;  4TNU A;  3RZO I;  2QEX Z;  3BG1 B;  3MON A;  1K73 2;  1VQ4 Z;  2NVQ I;  1SFO I;  4X6A I;  5T67 A;  2PM9 A;  1N8R 2;  4E33 A;  1VQN Z;  2Y0S A;  2E2J I;  3MZL B;  5LL6 f;  4NBG A;  3S16 I;  2I3C A;  1LQL A;  2HF1 A;  4EWC A;  1YJW 1;  1YIJ 1;  3CCR Z;  1K8A 1;  3CCS Z;  1QVF Y;  2QEX 1;  2M48 A;  1Z02 A;  4A3B I;  3J81 b;  3EER A;  4MD8 A;  3S1N I;  2F4M A;  2RIQ A;  2QKD A;  3T4N B;  3J80 f;  3G71 1;  4QTT A;  2OZK A;  1QVG Y;  3GTO I;  4A3F I;  1NUI A;  3TE5 B;  3J81 f;  3CCM 1;  4MD9 A;  1VQ8 Z;  3NDI A;  2W04 A;  1N2F A;  3Q87 A;  1S7M A;  4BY7 I;  2QA4 Z;  1YI2 Z;  5T64 A;  3CC7 Z;  2OTJ Z;  3EED A;  1VQ6 1;  4NBC A;  1KD1 1;  2WAQ A;  1S72 Z;  1X3W A;  5C3E I;  2QLV B;  3VB9 A;  2E2I I;  1I6H I;  4E2Z A;  4NBB A;  3CQZ I;  3CCQ 1;  4MD7 A;  3S14 I;  3G4S Z;  1ML8 A;  1M90 1;  1P9N A;  3K7A I;  3S15 I;  1KRL A;  3U50 C;  3CCL 1;  2LFU A;  1QVF Z;  3S1Q I;  1VQO Z;  2NVX I;  2JMO A;  2JR6 A;  2NVY I;  2YAD A;  3BG0 B;  1VQL Z;  3GTG I;  1NJI 2;  2QRC B;  3CC7 1;  1JJ2 Y;  5C4X I;  1M1K 2;  4E2X A;  2R93 I;  2VUM I;  5A2Q f;  1Z01 A;  4NBD A;  4QTU A;  4NBE A;  1QVG Z;  2IZ4 A;  3KIF A;  4RS4 A;  4BXX I;  2JA7 I;  3I55 1;  1RQF A;  2JS4 A;  1TWG I;  2LIY A;  4Y52 I;  1K73 1;  4A3G I;  4E30 A;  1TWF I;  3S1R I;  3CCU 1;  1YJW Z;  1YIJ Z;  4HH4 A;  3S2H I;  3I4M I;  3CME 1;  2RBL A;  5FLX b;  4MXU A;  4A3K I;  3GTL I;  5FLM I;  4E31 A;  3I4N I;  3KIH A;  2DE5 A;  3MZK B;  5AN9 F;  1YUK A;  3D9X A;  2R7Z I;  1WII A;  2GTI A;  2NVT I;  5C44 I;  3G71 Z;  1Q86 2;  2F4O A;  5FLX f;  2R92 I;  1ZB8 A;  2KI7 B;  3S17 I;  2DE7 A;  3CCM Z;  2J6A A;  1JJ2 Z;  1TWH I;  4RVG A;  1YUA A;  3J80 b;  4A3C I;  3RZD I;  3OW2 Y;  3CD6 Z;  1VQ6 Z;  1KQS Y;  3CXC Y;  1Q82 2;  3GKQ A;  3I56 1;  1X0T A;  3GTP I;  3CCQ Z;  2E9H A;  2GTH A;  3CCL Z;  3D6W A;  3PO2 I;  2JA5 I;  3CC2 1;  4MRI A;  4E2Y A;  3CC4 1;  1YHQ 1;  3CPW Y;  1VQ5 1;  1W2B Y;  4RVH A;  1QF8 A;  2VUG A;  3GTQ I;  4A93 I;  2JA8 I;  2B63 I;  3CD6 1;  3FKI I;  2AKL A;  4RV9 A;  2P28 A;  2P3Y A;  3P5J B;  4A3L I;  3QWU A;  1VQP 1;  1YIT 1;  3IX0 A;  1QYP A;  3CCJ 1;  4A3J I;  3I55 Z;  4NFR A;  3GTK I;  1M1K 1;  1PFT A;  1RO0 A;  5A2Q b;  1ZB9 A;  1YJ9 1;  2KPI A;  2V8J A;  3OW2 Z;  3HKZ A;  3CCU Z;  1KC8 2;  1KQS Z;  3CXC Z;  1K9M 2;  3FQQ A;  3CME Z;  5IP9 I;  4MON A;  2JNY A;  1JWH C;  3IFU A;  4NBF A;  4A3D I;  3NH4 A;  4A3E I;  3NDJ A;  2K3R A;  3HOZ I;  2RHB A;  2PK7 A;  4DK1 A;  1K83 I;  3FQM A;  1KD1 2;  1USP A;  3HOY I;  3CPW Z;  1Q7Y 2;  4NB8 A;  1W2B Z;  2HU9 A;  1VQK 1;  3I07 A;  1N8R 1;  1RNI A;  2W03 A;  1RO2 A;  1DL6 A;  3H0G I;  4AYB A;  3G6E 1;  4BBS I;  3HOV I;  3M3Y I;  3H3V J;  5D1O A;  5IT9 b;  5IP7 I;  2DE6 A;  3I56 Z;  4E32 A;  4RVF A;  2YU9 I;  2PMZ A;  3CCV 1;  1VQ7 1;  4MH4 A;  4BY1 I;  1VQM 1;  1Q81 2;  5IT9 f;  3S2D I;  2JA6 I;  1YJN 1;  1Q82 1;  3CC2 Z;  2V8K A;  2VF1 A;  3CC4 Z;  1Z03 A;  1VQ9 1;  1YHQ Z;  2Q51 A;  1VQ5 Z;  3F3F C;  1X3Z A;  5T6B A;  2GU2 A;  4DGL A;  4NBA A;  4E2W A;  2OTL 1;  1VQP Z;  1YIT Z;  3CCJ Z;  3CCE 1;  2G2K A;  3ESW A;  3VMG A;  1RLY A;  2V8I A;  2IZ3 A;  1Y1W I;  2QRE B;  2H85 A;  3HOU I;  2JUB A;  1YJ9 Z;  1VQ4 1;  1WW9 A;  2E2H I;  2ZAE B;  2OOX B;  3GCF A;  4NB9 A;  1USP B;  2QR1 B;  1VQN 1;  2RPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...