3CCS1

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482a
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccs100
3CCQ1 1YIT1 1VQPZ 1VQKZ 3CCMZ 3G4SZ 1YHQ1 1QVGZ 1K9M2 1KD12 1NJI1 2OTLZ 1KC81 1M902 3CCU1 3CC71 2QEXZ 1VQM1 3CD6Z 1VQLZ 1VQ5Z 1QVFY 3I56Z 1K8A1 1YIJZ 1M901 1W2BZ 3G6E1 1VQ61 3CMEZ 1Q862 1K9M1 1YI21 1Q812 1K732 1Q822 1QVFZ 2OTL1 1YI2Z 3CCSZ 1NJI2 3CC21 1KQSZ 1YHQZ 2OTJZ 1VQP1 1VQK1 3CCV1 1QVGY 1M1K2 3CCJ1 1YJWZ 1S72Z 3G711 1VQ81 3CCEZ 3CC4Z 3CCS1 3CXCZ 1VQ6Z 3CCRZ 1YIJ1 3I551 3I561 1VQ41 1YITZ 1VQNZ 1KC82 1Q7Y2 1VQ4Z 3CCUZ 3CC7Z 3CD61 3CMA1 3CC2Z 1VQO1 1YJ91 1VQ9Z 1VQ8Z 3CPWZ 3OW2Z 1JJ2Z 1N8R2 1K731 3I55Z 1VQMZ 1Q861 1VQ71 1YJNZ 1KD11 3CME1 1VQ7Z 2QA4Z 1K8A2 1S721 3CCM1 3CCJZ 1YJW1 3CXCY 1Q811 3CCLZ 1M1K1 1Q7Y1 2QEX1 3OW2Y 1N8R1 3CPWY 2OTJ1 1VQOZ 2QA41 1W2BY 1YJN1 3CC41 1Q821 3CCL1 1VQN1 3CCVZ 1VQ51 3CCR1 1VQL1 1VQ91 1YJ9Z 1JJ2Y 3G6EZ 3CCE1 3CMAZ 3G4S1 3G71Z 1KQSY 3CCQZ
chains in the Genus database with same CATH superfamily
1VQKZ 1WJ2A 5FLXb 2GTIA 2P3YA 1QVGZ 1K9M2 2NVXI 1KD12 3S2HI 3S14I 4E2XA 4A3JI 1VQ5Z 1M901 4Y7NI 2M48A 1TWAI 4RVHA 3HOXI 2OOXB 3FQMA 5C44I 2OTL1 5T6BA 1RO2A 3CCSZ 2RPRA 3S1NI 2E2HI 1YHQZ 5AN9F 2QR1B 1VQK1 3PO3I 2V3VA 1QVGY 1YJWZ 2QKDA 3CCEZ 2Q51A 3JAMf 3MONA 2WB1A 3S1MI 3K7AI 1Y1VS 4A3BI 2DE7A 3CCRZ 1YIJ1 2R92I 2BJOA 2O4HA 1VQ41 1YITZ 2E2II 4NBEA 1Z02A 4MD9A 1Q7Y2 3CD61 3J7A4 1TWCI 3KIFA 4NB9A 4NB8A 3S17I 4HH4A 3OW2Z 3J81f 2K3RA 3NH4A 3J81b 1K731 2I3CA 1VQMZ 2M6NA 5IT9b 1YUKA 1KD11 3S15I 4NBGA 3HKZA 1SIWA 1S7MA 3CCJZ 4DK1A 3CXCY 3HOWI 1Q811 3CPWY 1SFOI 2V8IA 3VMGA 1VQOZ 4BBSI 2V8JA 3NH8A 1W2BY 2DE6A 4E31A 4A3MI 4A93I 3QWUA 1Q821 1VQ51 5IT9f 2JS4A 1VQ91 2K5RA 1I3QI 2VPXA 4BBRI 3G6EZ 1USPA 2G2KA 1KQSY 1AA6A 4RVGA 1RLYA 2RT9A 2ZAEB 3BG0B 2RHBA 1WCMI 3I4MI 4A3GI 2JR6A 3P5JB 3CD6Z 3S1RI 4A3CI 3GTOI 1YI21 4E32A 4E2WA 2JA7I 4DQYB 2OOYB 1X3WA 4AYBA 1FDOA 3GTGI 3MZKB 2VF1A 1Q822 2NAPA 3M3YI 1KQSZ 3IX0A 2F4MA 5D1OB 4BY1I 2JIOA 3CCV1 3MZLB 2E2JI 3F3FC 3G711 2RIQA 1VQ81 2P28A 3PO2I 2JIPA 3CXCZ 3TE5B 2E9HA 2QRDB 2YADA 3I551 1TWFI 1WW9A 3S1QI 1KC82 1VQ4Z 1NP6A 2F4OA 1QF8A 1YJ91 3D6WA 1JJ2Z 4E2ZA 4MRIA 2YU9I 1Q861 1ZH1A 3D9XA 3IFUA 2W04A 3ESWA 1VQ7Z 1QXFA 1K8A2 2B63I 4NOZA 4E30A 4XX2A 4RS4A 1Q7Y1 2KI7B 3RZOI 2OTJ1 3JAMb 2QA41 3H3VJ 1WZNA 1K83I 1YJN1 4A3DI 1L1OC 4QTUA 3NFZA 3VMIA 4MONA 1Y8CA 2VUGA 3F3PC 5A2Qf 1X0TA 3GTMI 5FLXf 2JNYA 4BY7I 2IV2X 2GU2A 3RZDI 3CMAZ 3G71Z 3NDJA 1VQN1 4DGLA 3CCQ1 1VQPZ 2Q4ZA 2JA8I 2HU9A 1TWHI 3GTMS 5D1PA 1RO4A 3VB9A 2QEXZ 1Y1VI 3VTNA 5CM2M 3GTJI 1VQLZ 3GTLI 1QVFY 1ZB8A 1K8A1 1YUAA 1YIJZ 2QRCB 1VQ61 3CMEZ 1Q862 2KPIA 1TWGI 4NBCA 1K732 3GTQI 2R6MA 1QYPA 4A3EI 3GTKI 4A3II 1YI2Z 2W03A 1NJI2 2JUBA 2OTJZ 1VQP1 4Y52I 2NVQI 3LUSA 1ZB9A 2JIQA 1S72Z 5T64A 3CC4Z 2PM9A 5IP9I 3I07A 3CCS1 3HOVI 3KIHA 2NVYI 2AKLA 3T4NB 2Y0SA 4A3LI 4HGZA 3I561 5IP7I 1VQNZ 3TDHB 5FLMI 3VMHA 3CCUZ 3CC7Z 2V45A 3CMA1 3CC2Z 4NBAA 2WAQA 1RQFA 1VQ9Z 1I50I 4RVDA 3CQZI 3EERA 1N8R2 3S2DI 3I55Z 1VQ71 5T67A 1YJNZ 1X3ZA 3CME1 2QA4Z 2J6AA 2NVTI 4NFRA 2PMZA 1S721 5C4JI 4MD7A 1M1K1 1N8R1 3GKQA 5C4XI 2LEXA 2IZ4A 4NH1C 3CC41 3CCL1 1R9TI 2RBLA 1VQL1 2VPYA 4HGYA 2JA6I 2IZ3A 4E33A 1YJ9Z 3NH5A 4A3KI 1KRLA 2GTHA 3G4S1 4NBFA 1PFTA 2V8KA 3FQQA 1JWHC 2EGTA 3S16I 1YIT1 4S1TA 3CCMZ 5LL6f 3G4SZ 1YHQ1 2JIMA 4MD8A 1RNIA 2LIYA 1NJI1 2OTLZ 1KC81 3FKII 1M902 1Y1WI 2OZKA 3CCU1 3CC71 1VQM1 2LFUA 3I56Z 1W2BZ 3G6E1 1TFIA 1K9M1 1ML8A 3Q87A 3H0GI 2QREB 1Q812 2DE5A 4X6AI 2QLVB 2JA5I 2O53A 1QVFZ 2VPZA 2PK7A 1N2FA 3CC21 1FDIA 1WIIA 3J80f 2R93I 2JMOA 1M1K2 3CCJ1 2H85A 3GCFA 3HOYI 4NBHA 4MH4A 3IF8A 4BXXI 3IR7A 2VUMI 3BG1B 1VQ6Z 4QTTA 3U50C 3EEDA 2HF1A 2R7ZI 3PO3S 4NBBA 1Q16A 5D1OA 4TNUA 5C3EI 1VQO1 1DL6A 4E2YA 3CPWZ 1VQ8Z 3GTPI 3NDIA 1RO0A 4CL1A 4RV9A 1LQLA 3CCM1 1YJW1 3D2LA 5A2Qb 3CCLZ 1I6HI 2QEX1 3OW2Y 2JIRA 3J80b 4NBDA 4EWCA 1P9NA 1NUIA 1Z01A 3CCVZ 3CCR1 3HOZI 3HOUI 1USPB 1VLAA 4RVFA 3M4OI 4MXUA 3I4NI 1Z03A 4A3FI 2AYDA 1JJ2Y 3CCE1 2VPWA 2E7ZA 3CCQZ
chains in the Genus database with same CATH topology
1VQKZ 5FLXb 2GTIA 2P3YA 1QVGZ 1K9M2 2NVXI 1KD12 3S2HI 3S14I 4E2XA 4A3JI 1VQ5Z 1M901 4Y7NI 2M48A 1TWAI 4RVHA 3HOXI 2OOXB 3FQMA 5C44I 2OTL1 5T6BA 1RO2A 3CCSZ 2RPRA 3S1NI 2E2HI 1YHQZ 5AN9F 2QR1B 1VQK1 3PO3I 1QVGY 1YJWZ 2QKDA 3CCEZ 2Q51A 3JAMf 3MONA 2WB1A 3S1MI 3K7AI 1Y1VS 4A3BI 2DE7A 3CCRZ 1YIJ1 2R92I 2BJOA 2O4HA 1VQ41 1YITZ 2E2II 4NBEA 1Z02A 4MD9A 1Q7Y2 3CD61 3J7A4 1TWCI 3KIFA 4NB9A 4NB8A 3S17I 4HH4A 3OW2Z 3J81f 2K3RA 3NH4A 3J81b 1K731 2I3CA 1VQMZ 2M6NA 5IT9b 1YUKA 1KD11 3S15I 4NBGA 3HKZA 1S7MA 3CCJZ 4DK1A 3CXCY 3HOWI 1Q811 3CPWY 1SFOI 2V8IA 3VMGA 1VQOZ 4BBSI 2V8JA 3NH8A 1W2BY 2DE6A 4E31A 4A3MI 4A93I 3QWUA 1Q821 1VQ51 5IT9f 2JS4A 1VQ91 2K5RA 1I3QI 3G6EZ 4BBRI 1USPA 2G2KA 1KQSY 4RVGA 1RLYA 2RT9A 2ZAEB 3BG0B 2RHBA 1WCMI 3I4MI 4A3GI 2JR6A 3P5JB 3CD6Z 3S1RI 4A3CI 3GTOI 1YI21 4E32A 4E2WA 2JA7I 4DQYB 2OOYB 1X3WA 4AYBA 3GTGI 3MZKB 2VF1A 1Q822 3M3YI 1KQSZ 3IX0A 2F4MA 5D1OB 4BY1I 3CCV1 2E2JI 3MZLB 3F3FC 3G711 2RIQA 1VQ81 2P28A 3PO2I 3CXCZ 3TE5B 2E9HA 2QRDB 2YADA 3I551 1TWFI 1WW9A 3S1QI 1KC82 1VQ4Z 1NP6A 2F4OA 1QF8A 1YJ91 3D6WA 1JJ2Z 4E2ZA 4MRIA 2YU9I 1Q861 1ZH1A 3D9XA 3IFUA 2W04A 3ESWA 1VQ7Z 1K8A2 2B63I 4NOZA 4E30A 4XX2A 4RS4A 1Q7Y1 2KI7B 3RZOI 2OTJ1 3JAMb 2QA41 3H3VJ 1K83I 1YJN1 4A3DI 1L1OC 4QTUA 3NFZA 3VMIA 4MONA 2VUGA 3F3PC 5A2Qf 1X0TA 3GTMI 5FLXf 2JNYA 4BY7I 2GU2A 3RZDI 3CMAZ 3G71Z 3NDJA 1VQN1 4DGLA 3CCQ1 1VQPZ 2Q4ZA 2JA8I 2HU9A 1TWHI 3GTMS 5D1PA 1RO4A 3VB9A 2QEXZ 1Y1VI 3VTNA 5CM2M 3GTJI 1VQLZ 3GTLI 1QVFY 1ZB8A 1K8A1 1YUAA 1YIJZ 2QRCB 1VQ61 3CMEZ 1Q862 2KPIA 1TWGI 4NBCA 1K732 3GTQI 2R6MA 1QYPA 4A3EI 3GTKI 4A3II 1YI2Z 2W03A 1NJI2 2JUBA 2OTJZ 1VQP1 4Y52I 2NVQI 3LUSA 1ZB9A 1S72Z 5T64A 3CC4Z 2PM9A 5IP9I 3I07A 3CCS1 3HOVI 3KIHA 2NVYI 2AKLA 3T4NB 2Y0SA 4A3LI 4HGZA 3I561 5IP7I 1VQNZ 3TDHB 5FLMI 3VMHA 3CCUZ 3CC7Z 3CMA1 3CC2Z 4NBAA 2WAQA 1RQFA 1VQ9Z 1I50I 4RVDA 3CQZI 3EERA 1N8R2 3S2DI 3I55Z 1VQ71 5T67A 1YJNZ 1X3ZA 3CME1 2QA4Z 2J6AA 2NVTI 4NFRA 2PMZA 1S721 5C4JI 4MD7A 1M1K1 1N8R1 3GKQA 5C4XI 2IZ4A 4NH1C 3CC41 3CCL1 1R9TI 2RBLA 1VQL1 4HGYA 2JA6I 2IZ3A 4E33A 1YJ9Z 3NH5A 4A3KI 1KRLA 2GTHA 3G4S1 4NBFA 1PFTA 2V8KA 3FQQA 1JWHC 2EGTA 3S16I 1YIT1 4S1TA 3CCMZ 5LL6f 3G4SZ 1YHQ1 4MD8A 1RNIA 2LIYA 1NJI1 2OTLZ 1KC81 3FKII 1M902 1Y1WI 2OZKA 3CCU1 3CC71 1VQM1 2LFUA 3I56Z 1W2BZ 3G6E1 1TFIA 1K9M1 1ML8A 3Q87A 3H0GI 2QREB 1Q812 2DE5A 4X6AI 2QLVB 2JA5I 2O53A 1QVFZ 2PK7A 1N2FA 3CC21 1WIIA 3J80f 2R93I 2JMOA 1M1K2 3CCJ1 2H85A 3GCFA 3HOYI 4NBHA 4MH4A 3IF8A 4BXXI 2VUMI 3BG1B 1VQ6Z 4QTTA 3U50C 3EEDA 2HF1A 2R7ZI 3PO3S 4NBBA 5D1OA 4TNUA 5C3EI 1VQO1 1DL6A 4E2YA 3CPWZ 1VQ8Z 3GTPI 3NDIA 1RO0A 4CL1A 4RV9A 1LQLA 3CCM1 1YJW1 5A2Qb 3CCLZ 1I6HI 2QEX1 3OW2Y 3J80b 4NBDA 4EWCA 1P9NA 1NUIA 1Z01A 3CCVZ 3CCR1 3HOZI 3HOUI 1USPB 1VLAA 4RVFA 3M4OI 4MXUA 3I4NI 1Z03A 4A3FI 1JJ2Y 3CCE1 3CCQZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCQ 1;  1YIT 1;  1VQP Z;  1VQK Z;  3CCM Z;  3G4S Z;  1YHQ 1;  1QVG Z;  1K9M 2;  1KD1 2;  1NJI 1;  2OTL Z;  1KC8 1;  1M90 2;  3CCU 1;  3CC7 1;  2QEX Z;  1VQM 1;  3CD6 Z;  1VQL Z;  1VQ5 Z;  1QVF Y;  3I56 Z;  1K8A 1;  1YIJ Z;  1M90 1;  1W2B Z;  3G6E 1;  1VQ6 1;  3CME Z;  1Q86 2;  1K9M 1;  1YI2 1;  1Q81 2;  1K73 2;  1Q82 2;  1QVF Z;  2OTL 1;  1YI2 Z;  3CCS Z;  1NJI 2;  3CC2 1;  1KQS Z;  1YHQ Z;  2OTJ Z;  1VQP 1;  1VQK 1;  3CCV 1;  1QVG Y;  1M1K 2;  3CCJ 1;  1YJW Z;  1S72 Z;  3G71 1;  1VQ8 1;  3CCE Z;  3CC4 Z;  3CCS 1;  3CXC Z;  1VQ6 Z;  3CCR Z;  1YIJ 1;  3I55 1;  3I56 1;  1VQ4 1;  1YIT Z;  1VQN Z;  1KC8 2;  1Q7Y 2;  1VQ4 Z;  3CCU Z;  3CC7 Z;  3CD6 1;  3CMA 1;  3CC2 Z;  1VQO 1;  1YJ9 1;  1VQ9 Z;  1VQ8 Z;  3CPW Z;  3OW2 Z;  1JJ2 Z;  1N8R 2;  1K73 1;  3I55 Z;  1VQM Z;  1Q86 1;  1VQ7 1;  1YJN Z;  1KD1 1;  3CME 1;  1VQ7 Z;  2QA4 Z;  1K8A 2;  1S72 1;  3CCM 1;  3CCJ Z;  1YJW 1;  3CXC Y;  1Q81 1;  3CCL Z;  1M1K 1;  1Q7Y 1;  2QEX 1;  3OW2 Y;  1N8R 1;  3CPW Y;  2OTJ 1;  1VQO Z;  2QA4 1;  1W2B Y;  1YJN 1;  3CC4 1;  1Q82 1;  3CCL 1;  1VQN 1;  3CCV Z;  1VQ5 1;  3CCR 1;  1VQL 1;  1VQ9 1;  1YJ9 Z;  1JJ2 Y;  3G6E Z;  3CCE 1;  3CMA Z;  3G4S 1;  3G71 Z;  1KQS Y;  3CCQ Z; 
#chains in the Genus database with same CATH topology
 1VQK Z;  1WJ2 A;  5FLX b;  2GTI A;  2P3Y A;  1QVG Z;  1K9M 2;  2NVX I;  1KD1 2;  3S2H I;  3S14 I;  4E2X A;  4A3J I;  1VQ5 Z;  1M90 1;  4Y7N I;  2M48 A;  1TWA I;  4RVH A;  3HOX I;  2OOX B;  3FQM A;  5C44 I;  2OTL 1;  5T6B A;  1RO2 A;  3CCS Z;  2RPR A;  3S1N I;  2E2H I;  1YHQ Z;  5AN9 F;  2QR1 B;  1VQK 1;  3PO3 I;  2V3V A;  1QVG Y;  1YJW Z;  2QKD A;  3CCE Z;  2Q51 A;  3JAM f;  3MON A;  2WB1 A;  3S1M I;  3K7A I;  1Y1V S;  4A3B I;  2DE7 A;  3CCR Z;  1YIJ 1;  2R92 I;  2BJO A;  2O4H A;  1VQ4 1;  1YIT Z;  2E2I I;  4NBE A;  1Z02 A;  4MD9 A;  1Q7Y 2;  3CD6 1;  3J7A 4;  1TWC I;  3KIF A;  4NB9 A;  4NB8 A;  3S17 I;  4HH4 A;  3OW2 Z;  3J81 f;  2K3R A;  3NH4 A;  3J81 b;  1K73 1;  2I3C A;  1VQM Z;  2M6N A;  5IT9 b;  1YUK A;  1KD1 1;  3S15 I;  4NBG A;  3HKZ A;  1SIW A;  1S7M A;  3CCJ Z;  4DK1 A;  3CXC Y;  3HOW I;  1Q81 1;  3CPW Y;  1SFO I;  2V8I A;  3VMG A;  1VQO Z;  4BBS I;  2V8J A;  3NH8 A;  1W2B Y;  2DE6 A;  4E31 A;  4A3M I;  4A93 I;  3QWU A;  1Q82 1;  1VQ5 1;  5IT9 f;  2JS4 A;  1VQ9 1;  2K5R A;  1I3Q I;  2VPX A;  4BBR I;  3G6E Z;  1USP A;  2G2K A;  1KQS Y;  1AA6 A;  4RVG A;  1RLY A;  2RT9 A;  2ZAE B;  3BG0 B;  2RHB A;  1WCM I;  3I4M I;  4A3G I;  2JR6 A;  3P5J B;  3CD6 Z;  3S1R I;  4A3C I;  3GTO I;  1YI2 1;  4E32 A;  4E2W A;  2JA7 I;  4DQY B;  2OOY B;  1X3W A;  4AYB A;  1FDO A;  3GTG I;  3MZK B;  2VF1 A;  1Q82 2;  2NAP A;  3M3Y I;  1KQS Z;  3IX0 A;  2F4M A;  5D1O B;  4BY1 I;  2JIO A;  3CCV 1;  3MZL B;  2E2J I;  3F3F C;  3G71 1;  2RIQ A;  1VQ8 1;  2P28 A;  3PO2 I;  2JIP A;  3CXC Z;  3TE5 B;  2E9H A;  2QRD B;  2YAD A;  3I55 1;  1TWF I;  1WW9 A;  3S1Q I;  1KC8 2;  1VQ4 Z;  1NP6 A;  2F4O A;  1QF8 A;  1YJ9 1;  3D6W A;  1JJ2 Z;  4E2Z A;  4MRI A;  2YU9 I;  1Q86 1;  1ZH1 A;  3D9X A;  3IFU A;  2W04 A;  3ESW A;  1VQ7 Z;  1QXF A;  1K8A 2;  2B63 I;  4NOZ A;  4E30 A;  4XX2 A;  4RS4 A;  1Q7Y 1;  2KI7 B;  3RZO I;  2OTJ 1;  3JAM b;  2QA4 1;  3H3V J;  1WZN A;  1K83 I;  1YJN 1;  4A3D I;  1L1O C;  4QTU A;  3NFZ A;  3VMI A;  4MON A;  1Y8C A;  2VUG A;  3F3P C;  5A2Q f;  1X0T A;  3GTM I;  5FLX f;  2JNY A;  4BY7 I;  2IV2 X;  2GU2 A;  3RZD I;  3CMA Z;  3G71 Z;  3NDJ A;  1VQN 1;  4DGL A;  3CCQ 1;  1VQP Z;  2Q4Z A;  2JA8 I;  2HU9 A;  1TWH I;  3GTM S;  5D1P A;  1RO4 A;  3VB9 A;  2QEX Z;  1Y1V I;  3VTN A;  5CM2 M;  3GTJ I;  1VQL Z;  3GTL I;  1QVF Y;  1ZB8 A;  1K8A 1;  1YUA A;  1YIJ Z;  2QRC B;  1VQ6 1;  3CME Z;  1Q86 2;  2KPI A;  1TWG I;  4NBC A;  1K73 2;  3GTQ I;  2R6M A;  1QYP A;  4A3E I;  3GTK I;  4A3I I;  1YI2 Z;  2W03 A;  1NJI 2;  2JUB A;  2OTJ Z;  1VQP 1;  4Y52 I;  2NVQ I;  3LUS A;  1ZB9 A;  2JIQ A;  1S72 Z;  5T64 A;  3CC4 Z;  2PM9 A;  5IP9 I;  3I07 A;  3CCS 1;  3HOV I;  3KIH A;  2NVY I;  2AKL A;  3T4N B;  2Y0S A;  4A3L I;  4HGZ A;  3I56 1;  5IP7 I;  1VQN Z;  3TDH B;  5FLM I;  3VMH A;  3CCU Z;  3CC7 Z;  2V45 A;  3CMA 1;  3CC2 Z;  4NBA A;  2WAQ A;  1RQF A;  1VQ9 Z;  1I50 I;  4RVD A;  3CQZ I;  3EER A;  1N8R 2;  3S2D I;  3I55 Z;  1VQ7 1;  5T67 A;  1YJN Z;  1X3Z A;  3CME 1;  2QA4 Z;  2J6A A;  2NVT I;  4NFR A;  2PMZ A;  1S72 1;  5C4J I;  4MD7 A;  1M1K 1;  1N8R 1;  3GKQ A;  5C4X I;  2LEX A;  2IZ4 A;  4NH1 C;  3CC4 1;  3CCL 1;  1R9T I;  2RBL A;  1VQL 1;  2VPY A;  4HGY A;  2JA6 I;  2IZ3 A;  4E33 A;  1YJ9 Z;  3NH5 A;  4A3K I;  1KRL A;  2GTH A;  3G4S 1;  4NBF A;  1PFT A;  2V8K A;  3FQQ A;  1JWH C;  2EGT A;  3S16 I;  1YIT 1;  4S1T A;  3CCM Z;  5LL6 f;  3G4S Z;  1YHQ 1;  2JIM A;  4MD8 A;  1RNI A;  2LIY A;  1NJI 1;  2OTL Z;  1KC8 1;  3FKI I;  1M90 2;  1Y1W I;  2OZK A;  3CCU 1;  3CC7 1;  1VQM 1;  2LFU A;  3I56 Z;  1W2B Z;  3G6E 1;  1TFI A;  1K9M 1;  1ML8 A;  3Q87 A;  3H0G I;  2QRE B;  1Q81 2;  2DE5 A;  4X6A I;  2QLV B;  2JA5 I;  2O53 A;  1QVF Z;  2VPZ A;  2PK7 A;  1N2F A;  3CC2 1;  1FDI A;  1WII A;  3J80 f;  2R93 I;  2JMO A;  1M1K 2;  3CCJ 1;  2H85 A;  3GCF A;  3HOY I;  4NBH A;  4MH4 A;  3IF8 A;  4BXX I;  3IR7 A;  2VUM I;  3BG1 B;  1VQ6 Z;  4QTT A;  3U50 C;  3EED A;  2HF1 A;  2R7Z I;  3PO3 S;  4NBB A;  1Q16 A;  5D1O A;  4TNU A;  5C3E I;  1VQO 1;  1DL6 A;  4E2Y A;  3CPW Z;  1VQ8 Z;  3GTP I;  3NDI A;  1RO0 A;  4CL1 A;  4RV9 A;  1LQL A;  3CCM 1;  1YJW 1;  3D2L A;  5A2Q b;  3CCL Z;  1I6H I;  2QEX 1;  3OW2 Y;  2JIR A;  3J80 b;  4NBD A;  4EWC A;  1P9N A;  1NUI A;  1Z01 A;  3CCV Z;  3CCR 1;  3HOZ I;  3HOU I;  1USP B;  1VLA A;  4RVF A;  3M4O I;  4MXU A;  3I4N I;  1Z03 A;  4A3F I;  2AYD A;  1JJ2 Y;  3CCE 1;  2VPW A;  2E7Z A;  3CCQ Z; 
#chains in the Genus database with same CATH homology
 1VQK Z;  5FLX b;  2GTI A;  2P3Y A;  1QVG Z;  1K9M 2;  2NVX I;  1KD1 2;  3S2H I;  3S14 I;  4E2X A;  4A3J I;  1VQ5 Z;  1M90 1;  4Y7N I;  2M48 A;  1TWA I;  4RVH A;  3HOX I;  2OOX B;  3FQM A;  5C44 I;  2OTL 1;  5T6B A;  1RO2 A;  3CCS Z;  2RPR A;  3S1N I;  2E2H I;  1YHQ Z;  5AN9 F;  2QR1 B;  1VQK 1;  3PO3 I;  1QVG Y;  1YJW Z;  2QKD A;  3CCE Z;  2Q51 A;  3JAM f;  3MON A;  2WB1 A;  3S1M I;  3K7A I;  1Y1V S;  4A3B I;  2DE7 A;  3CCR Z;  1YIJ 1;  2R92 I;  2BJO A;  2O4H A;  1VQ4 1;  1YIT Z;  2E2I I;  4NBE A;  1Z02 A;  4MD9 A;  1Q7Y 2;  3CD6 1;  3J7A 4;  1TWC I;  3KIF A;  4NB9 A;  4NB8 A;  3S17 I;  4HH4 A;  3OW2 Z;  3J81 f;  2K3R A;  3NH4 A;  3J81 b;  1K73 1;  2I3C A;  1VQM Z;  2M6N A;  5IT9 b;  1YUK A;  1KD1 1;  3S15 I;  4NBG A;  3HKZ A;  1S7M A;  3CCJ Z;  4DK1 A;  3CXC Y;  3HOW I;  1Q81 1;  3CPW Y;  1SFO I;  2V8I A;  3VMG A;  1VQO Z;  4BBS I;  2V8J A;  3NH8 A;  1W2B Y;  2DE6 A;  4E31 A;  4A3M I;  4A93 I;  3QWU A;  1Q82 1;  1VQ5 1;  5IT9 f;  2JS4 A;  1VQ9 1;  2K5R A;  1I3Q I;  3G6E Z;  4BBR I;  1USP A;  2G2K A;  1KQS Y;  4RVG A;  1RLY A;  2RT9 A;  2ZAE B;  3BG0 B;  2RHB A;  1WCM I;  3I4M I;  4A3G I;  2JR6 A;  3P5J B;  3CD6 Z;  3S1R I;  4A3C I;  3GTO I;  1YI2 1;  4E32 A;  4E2W A;  2JA7 I;  4DQY B;  2OOY B;  1X3W A;  4AYB A;  3GTG I;  3MZK B;  2VF1 A;  1Q82 2;  3M3Y I;  1KQS Z;  3IX0 A;  2F4M A;  5D1O B;  4BY1 I;  3CCV 1;  2E2J I;  3MZL B;  3F3F C;  3G71 1;  2RIQ A;  1VQ8 1;  2P28 A;  3PO2 I;  3CXC Z;  3TE5 B;  2E9H A;  2QRD B;  2YAD A;  3I55 1;  1TWF I;  1WW9 A;  3S1Q I;  1KC8 2;  1VQ4 Z;  1NP6 A;  2F4O A;  1QF8 A;  1YJ9 1;  3D6W A;  1JJ2 Z;  4E2Z A;  4MRI A;  2YU9 I;  1Q86 1;  1ZH1 A;  3D9X A;  3IFU A;  2W04 A;  3ESW A;  1VQ7 Z;  1K8A 2;  2B63 I;  4NOZ A;  4E30 A;  4XX2 A;  4RS4 A;  1Q7Y 1;  2KI7 B;  3RZO I;  2OTJ 1;  3JAM b;  2QA4 1;  3H3V J;  1K83 I;  1YJN 1;  4A3D I;  1L1O C;  4QTU A;  3NFZ A;  3VMI A;  4MON A;  2VUG A;  3F3P C;  5A2Q f;  1X0T A;  3GTM I;  5FLX f;  2JNY A;  4BY7 I;  2GU2 A;  3RZD I;  3CMA Z;  3G71 Z;  3NDJ A;  1VQN 1;  4DGL A;  3CCQ 1;  1VQP Z;  2Q4Z A;  2JA8 I;  2HU9 A;  1TWH I;  3GTM S;  5D1P A;  1RO4 A;  3VB9 A;  2QEX Z;  1Y1V I;  3VTN A;  5CM2 M;  3GTJ I;  1VQL Z;  3GTL I;  1QVF Y;  1ZB8 A;  1K8A 1;  1YUA A;  1YIJ Z;  2QRC B;  1VQ6 1;  3CME Z;  1Q86 2;  2KPI A;  1TWG I;  4NBC A;  1K73 2;  3GTQ I;  2R6M A;  1QYP A;  4A3E I;  3GTK I;  4A3I I;  1YI2 Z;  2W03 A;  1NJI 2;  2JUB A;  2OTJ Z;  1VQP 1;  4Y52 I;  2NVQ I;  3LUS A;  1ZB9 A;  1S72 Z;  5T64 A;  3CC4 Z;  2PM9 A;  5IP9 I;  3I07 A;  3CCS 1;  3HOV I;  3KIH A;  2NVY I;  2AKL A;  3T4N B;  2Y0S A;  4A3L I;  4HGZ A;  3I56 1;  5IP7 I;  1VQN Z;  3TDH B;  5FLM I;  3VMH A;  3CCU Z;  3CC7 Z;  3CMA 1;  3CC2 Z;  4NBA A;  2WAQ A;  1RQF A;  1VQ9 Z;  1I50 I;  4RVD A;  3CQZ I;  3EER A;  1N8R 2;  3S2D I;  3I55 Z;  1VQ7 1;  5T67 A;  1YJN Z;  1X3Z A;  3CME 1;  2QA4 Z;  2J6A A;  2NVT I;  4NFR A;  2PMZ A;  1S72 1;  5C4J I;  4MD7 A;  1M1K 1;  1N8R 1;  3GKQ A;  5C4X I;  2IZ4 A;  4NH1 C;  3CC4 1;  3CCL 1;  1R9T I;  2RBL A;  1VQL 1;  4HGY A;  2JA6 I;  2IZ3 A;  4E33 A;  1YJ9 Z;  3NH5 A;  4A3K I;  1KRL A;  2GTH A;  3G4S 1;  4NBF A;  1PFT A;  2V8K A;  3FQQ A;  1JWH C;  2EGT A;  3S16 I;  1YIT 1;  4S1T A;  3CCM Z;  5LL6 f;  3G4S Z;  1YHQ 1;  4MD8 A;  1RNI A;  2LIY A;  1NJI 1;  2OTL Z;  1KC8 1;  3FKI I;  1M90 2;  1Y1W I;  2OZK A;  3CCU 1;  3CC7 1;  1VQM 1;  2LFU A;  3I56 Z;  1W2B Z;  3G6E 1;  1TFI A;  1K9M 1;  1ML8 A;  3Q87 A;  3H0G I;  2QRE B;  1Q81 2;  2DE5 A;  4X6A I;  2QLV B;  2JA5 I;  2O53 A;  1QVF Z;  2PK7 A;  1N2F A;  3CC2 1;  1WII A;  3J80 f;  2R93 I;  2JMO A;  1M1K 2;  3CCJ 1;  2H85 A;  3GCF A;  3HOY I;  4NBH A;  4MH4 A;  3IF8 A;  4BXX I;  2VUM I;  3BG1 B;  1VQ6 Z;  4QTT A;  3U50 C;  3EED A;  2HF1 A;  2R7Z I;  3PO3 S;  4NBB A;  5D1O A;  4TNU A;  5C3E I;  1VQO 1;  1DL6 A;  4E2Y A;  3CPW Z;  1VQ8 Z;  3GTP I;  3NDI A;  1RO0 A;  4CL1 A;  4RV9 A;  1LQL A;  3CCM 1;  1YJW 1;  5A2Q b;  3CCL Z;  1I6H I;  2QEX 1;  3OW2 Y;  3J80 b;  4NBD A;  4EWC A;  1P9N A;  1NUI A;  1Z01 A;  3CCV Z;  3CCR 1;  3HOZ I;  3HOU I;  1USP B;  1VLA A;  4RVF A;  3M4O I;  4MXU A;  3I4N I;  1Z03 A;  4A3F I;  1JJ2 Y;  3CCE 1;  3CCQ Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...