3CCS1

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482a
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccs100
1VQ91 1QVFZ 1S72Z 3CME1 1YJW1 3CMA1 1YHQ1 1VQ81 1VQM1 3G4SZ 3I551 3G6EZ 3CCVZ 2QEX1 3CCL1 1YIT1 3CCEZ 3CCQ1 3CCMZ 1Q811 3CCUZ 1VQ4Z 1VQOZ 1YIJZ 1KQSY 1VQL1 3OW2Z 3CXCY 1KD11 3CCS1 1Q821 1VQ51 1Q812 3G711 1N8R1 3CCJZ 1KD12 1VQP1 1YI21 3I561 1M1K2 1VQKZ 2OTL1 1N8R2 1YJ9Z 1KC82 3CC2Z 1VQ7Z 1VQ9Z 3CCR1 1VQN1 1YJWZ 2OTJ1 1KQSZ 1YJN1 3CXCZ 1K8A2 3I55Z 3CC41 3CCLZ 3CCQZ 1NJI1 1M1K1 1VQ61 2QA4Z 1KC81 1NJI2 3CC71 1K731 3G71Z 3G4S1 3G6E1 3CCV1 1K732 2OTLZ 3CCE1 3CPWY 3CCM1 1YIJ1 1Q862 3CMEZ 3CMAZ 3CCJ1 1K8A1 1YHQZ 1VQ8Z 1VQMZ 1VQK1 3CD61 1QVGY 2QEXZ 1YITZ 1YJNZ 1S721 1K9M2 3CC21 1VQLZ 1JJ2Y 1VQ71 3CCSZ 1M902 1VQ5Z 1VQ6Z 3CPWZ 1VQPZ 1YI2Z 1QVFY 3I56Z 3CC7Z 1Q861 3CCU1 1VQ41 1VQO1 1W2BZ 2QA41 1QVGZ 1W2BY 3CCRZ 1VQNZ 1Q7Y1 1YJ91 2OTJZ 3OW2Y 1Q822 1K9M1 1Q7Y2 1JJ2Z 3CD6Z 1M901 3CC4Z
chains in the Genus database with same CATH superfamily
3GCFA 2NAPA 1S72Z 1DL6A 1WW9A 1YJW1 3CMA1 5T6BA 1VQM1 5AN9F 3HOXI 1ZH1A 3Q87A 5CM2M 3I551 1USPA 2E7ZA 3CCQ1 3CCMZ 2RT9A 1L1OC 2QLVB 5FLMI 1VQL1 3CCS1 4BBRI 1Q812 2LFUA 1N8R1 1VQP1 1YI21 4RVDA 1YJ9Z 4DQYB 3RZDI 4A3MI 4MD9A 4A3GI 3CC2Z 3VTNA 4E2ZA 4HGZA 3FQMA 2R7ZI 3S2HI 3F3PC 3HOYI 4BXXI 2VPYA 2F4OA 2RPRA 4RS4A 2QA4Z 4A3DI 3G71Z 2JIRA 3G6E1 3CCV1 4NOZA 3CCE1 2YADA 1SIWA 3IX0A 5T67A 2Q4ZA 2V3VA 3FQQA 3CMAZ 3CCJ1 4E2XA 3GTGI 1QXFA 1VQMZ 2E2II 1VQK1 2OOYB 4EWCA 1QVGY 1N2FA 3NDJA 1YUAA 1S721 1VLAA 5C4JI 4NBHA 2GTIA 2GU2A 2QRDB 1VQLZ 1JJ2Y 3FKII 3CCSZ 4MXUA 3CPWZ 1R9TI 1YI2Z 1VQPZ 3S1RI 3HOZI 3TDHB 2VUMI 1Q861 3JAMf 1AA6A 3HOVI 4TNUA 5D1OA 3J80f 2E9HA 1WJ2A 1FDIA 2WB1A 3EERA 1YJ91 2JIPA 4A3KI 1Q7Y2 2NVTI 3S1NI 2V8IA 1M901 3NFZA 1YUKA 2J6AA 1QVFZ 2IV2X 4S1TA 4NBEA 3G6EZ 3IFUA 3CCVZ 3CCEZ 2G2KA 3PO3I 3CQZI 3NH8A 1Q811 3CCUZ 1VQ4Z 3GTKI 2VF1A 2V45A 2M6NA 5A2Qb 4NH1C 1Q821 1VQ51 2JR6A 3G711 4RVGA 3CCJZ 2NVQI 1M1K2 1VQKZ 3GTOI 3LUSA 2VPWA 1I3QI 1NP6A 3HKZA 2IZ3A 3NH4A 2JIQA 1X3ZA 5C44I 2F4MA 2R93I 1NUIA 1VQ9Z 3CCR1 4AYBA 3ESWA 2B63I 5FLXb 3CCLZ 2KI7B 4CL1A 1TWHI 4E32A 1KC81 1NJI2 2JA6I 3G4S1 3S1QI 1K732 1K83I 2P3YA 4RV9A 2V8JA 3J81b 2R6MA 5IP7I 1I50I 1K8A1 3I4NI 3VMIA 4MRIA 4NBGA 3F3FC 5IT9b 4NBAA 2JIOA 2O53A 5T64A 1YJNZ 2HU9A 2JNYA 3VB9A 2NVYI 1VQ71 5C3EI 1VQ5Z 1S7MA 1VQ6Z 3CC7Z 4DGLA 2BJOA 4NBCA 3CCU1 1VQ41 3S14I 2I3CA 1QVGZ 3CCRZ 2PM9A 1Q7Y1 3OW2Y 3GKQA 1K9M1 1JJ2Z 3CD6Z 2PMZA 4A3FI 2R92I 3J7A4 1VQ91 3KIFA 3CME1 2RHBA 1VQ81 1Y1WI 3KIHA 4QTUA 3G4SZ 4X6AI 1RO0A 3CCL1 2VPXA 2AKLA 1KQSY 3CXCY 1P9NA 2JIMA 1KD12 5A2Qf 4HGYA 4A3CI 1KRLA 1Z02A 4XX2A 3M4OI 1VQ7Z 4QTTA 1TWAI 4MD7A 3GTJI 4A93I 4E31A 3GTMI 1YJN1 2Y0SA 2E2JI 1RO4A 1WIIA 4E30A 1Y8CA 1PFTA 1NJI1 1VQ61 4A3LI 5FLXf 3CC71 1K731 4RVFA 2O4HA 2RBLA 2M48A 2OTLZ 2VPZA 3TE5B 1ZB8A 1X0TA 4NBDA 1YIJ1 2OZKA 3U50C 4NBFA 3D9XA 1Q862 3CMEZ 1QYPA 4HH4A 1VQ8Z 3J81f 3CD61 1Z01A 2W03A 1WZNA 3K7AI 3EEDA 5IT9f 4NB8A 1M902 4BBSI 2LEXA 1USPB 3I4MI 2P28A 3MZKB 2LIYA 2JA5I 4E2WA 1LQLA 3S2DI 2EGTA 4NFRA 2PK7A 4DK1A 1W2BZ 1Y1VI 2K5RA 1Z03A 1W2BY 2JUBA 1Q822 2H85A 1TWGI 2QR1B 2GTHA 2QRCB 2V8KA 2JS4A 2IZ4A 3T4NB 3NDIA 1ZB9A 1YHQ1 3IF8A 3S16I 1QF8A 3MZLB 2VUGA 2QEX1 1YIT1 1SFOI 1JWHC 5LL6f 1WCMI 1VQOZ 1TWFI 1YIJZ 4Y52I 1TWCI 3OW2Z 1KD11 2AYDA 2OOXB 2E2HI 3IR7A 3I561 2OTL1 1N8R2 4A3BI 2QREB 1KC82 3RZOI 4NB9A 3S1MI 1RO2A 2WAQA 3GTMS 3PO3S 3H3VJ 3BG1B 2RIQA 1VQN1 1Q16A 1YJWZ 2OTJ1 2K3RA 5C4XI 3VMHA 3NH5A 1KQSZ 3CXCZ 1K8A2 3I55Z 3CC41 1X3WA 2JA7I 4BY7I 1I6HI 3CCQZ 4MONA 1M1K1 2DE6A 2NVXI 2JA8I 2DE7A 3HOWI 5IP9I 1ML8A 4BY1I 2YU9I 3M3YI 4E33A 5D1OB 3CCM1 3CPWY 4E2YA 3P5JB 3S17I 3I07A 2W04A 2Q51A 1RNIA 3H0GI 3MONA 4A3EI 1YHQZ 3BG0B 4NBBA 3GTQI 2QEXZ 1YITZ 2JMOA 3PO2I 1K9M2 3CC21 1RLYA 2KPIA 2DE5A 3D2LA 4RVHA 3JAMb 3QWUA 4A3JI 3VMGA 1QVFY 1FDOA 1Y1VS 2ZAEB 3I56Z 3GTPI 3J80b 4MH4A 5D1PA 1VQO1 3GTLI 2QKDA 4Y7NI 3D6WA 2QA41 4MD8A 3HOUI 1VQNZ 1TFIA 1RQFA 2OTJZ 3S15I 4A3II 2HF1A 3CC4Z
chains in the Genus database with same CATH topology
3GCFA 1S72Z 1DL6A 1WW9A 1YJW1 3CMA1 5T6BA 1VQM1 5AN9F 1ZH1A 3Q87A 3HOXI 5CM2M 3I551 1USPA 3CCQ1 3CCMZ 2RT9A 1L1OC 2QLVB 5FLMI 1VQL1 3CCS1 4BBRI 1Q812 2LFUA 1N8R1 1VQP1 1YI21 4RVDA 1YJ9Z 4DQYB 3RZDI 4A3MI 4MD9A 4A3GI 3CC2Z 3VTNA 4E2ZA 4HGZA 3FQMA 2R7ZI 3S2HI 3F3PC 3HOYI 4BXXI 2F4OA 2RPRA 4RS4A 2QA4Z 4A3DI 3G71Z 3G6E1 3CCV1 4NOZA 3CCE1 2YADA 3IX0A 5T67A 2Q4ZA 3FQQA 3CMAZ 3CCJ1 4E2XA 3GTGI 1VQMZ 2E2II 1VQK1 2OOYB 4EWCA 1QVGY 1N2FA 3NDJA 1YUAA 1S721 1VLAA 5C4JI 4NBHA 2GTIA 2GU2A 2QRDB 1VQLZ 1JJ2Y 3FKII 3CCSZ 4MXUA 3CPWZ 1R9TI 1YI2Z 1VQPZ 3S1RI 3HOZI 3TDHB 2VUMI 1Q861 3JAMf 3HOVI 4TNUA 5D1OA 3J80f 2E9HA 2WB1A 3EERA 1YJ91 4A3KI 1Q7Y2 2NVTI 3S1NI 2V8IA 1M901 3NFZA 1YUKA 2J6AA 1QVFZ 4S1TA 4NBEA 3G6EZ 3IFUA 3CCVZ 3CCEZ 2G2KA 3PO3I 3CQZI 3NH8A 1Q811 3CCUZ 1VQ4Z 3GTKI 2VF1A 2M6NA 5A2Qb 4NH1C 1Q821 1VQ51 2JR6A 3G711 4RVGA 3CCJZ 2NVQI 1M1K2 1VQKZ 3GTOI 3LUSA 1I3QI 1NP6A 3HKZA 2IZ3A 3NH4A 1X3ZA 5C44I 2F4MA 2R93I 1NUIA 1VQ9Z 3CCR1 4AYBA 3ESWA 2B63I 5FLXb 3CCLZ 2KI7B 4CL1A 1TWHI 4E32A 1KC81 1NJI2 2JA6I 3G4S1 3S1QI 1K732 1K83I 2P3YA 4RV9A 2V8JA 3J81b 2R6MA 5IP7I 1I50I 1K8A1 3I4NI 3VMIA 4MRIA 4NBGA 3F3FC 5IT9b 4NBAA 2O53A 5T64A 1YJNZ 2HU9A 2JNYA 3VB9A 2NVYI 1VQ71 5C3EI 1VQ5Z 1S7MA 1VQ6Z 3CC7Z 4DGLA 2BJOA 4NBCA 3CCU1 1VQ41 3S14I 2I3CA 1QVGZ 3CCRZ 2PM9A 1Q7Y1 3OW2Y 3GKQA 1K9M1 1JJ2Z 3CD6Z 2PMZA 4A3FI 2R92I 3J7A4 1VQ91 3KIFA 3CME1 2RHBA 1VQ81 1Y1WI 3KIHA 4QTUA 3G4SZ 4X6AI 1RO0A 3CCL1 2AKLA 1KQSY 3CXCY 1P9NA 1KD12 5A2Qf 4HGYA 4A3CI 1KRLA 1Z02A 4XX2A 3M4OI 1VQ7Z 4QTTA 1TWAI 4MD7A 3GTJI 4A93I 4E31A 3GTMI 1YJN1 2Y0SA 2E2JI 1RO4A 1WIIA 4E30A 1PFTA 1NJI1 1VQ61 4A3LI 5FLXf 3CC71 1K731 4RVFA 2O4HA 2RBLA 2M48A 2OTLZ 3TE5B 1ZB8A 1X0TA 4NBDA 1YIJ1 2OZKA 3U50C 4NBFA 3D9XA 1Q862 3CMEZ 1QYPA 4HH4A 1VQ8Z 3J81f 3CD61 1Z01A 2W03A 3K7AI 5IT9f 3EEDA 4NB8A 1M902 4BBSI 1USPB 3I4MI 2P28A 3MZKB 2LIYA 2JA5I 4E2WA 1LQLA 3S2DI 2EGTA 4NFRA 2PK7A 4DK1A 1W2BZ 1Y1VI 2K5RA 1Z03A 1W2BY 2JUBA 1Q822 2H85A 1TWGI 2QR1B 2GTHA 2QRCB 2V8KA 2JS4A 2IZ4A 3T4NB 3NDIA 1ZB9A 1YHQ1 3IF8A 3S16I 1QF8A 3MZLB 2VUGA 2QEX1 1YIT1 1SFOI 1JWHC 5LL6f 1WCMI 1VQOZ 1TWFI 1YIJZ 4Y52I 1TWCI 3OW2Z 1KD11 2OOXB 2E2HI 3I561 2OTL1 1N8R2 4A3BI 2QREB 1KC82 3RZOI 4NB9A 3S1MI 1RO2A 2WAQA 3GTMS 3PO3S 3H3VJ 3BG1B 2RIQA 1VQN1 1YJWZ 2OTJ1 2K3RA 5C4XI 3VMHA 3NH5A 1KQSZ 3CXCZ 1K8A2 3I55Z 3CC41 1X3WA 2JA7I 4BY7I 1I6HI 3CCQZ 4MONA 1M1K1 2DE6A 2NVXI 2JA8I 2DE7A 3HOWI 5IP9I 1ML8A 4BY1I 2YU9I 3M3YI 4E33A 5D1OB 3CCM1 3CPWY 4E2YA 3P5JB 3S17I 3I07A 2W04A 2Q51A 1RNIA 3H0GI 3MONA 4A3EI 1YHQZ 3BG0B 4NBBA 3GTQI 2QEXZ 1YITZ 2JMOA 3PO2I 1K9M2 3CC21 1RLYA 2KPIA 2DE5A 4RVHA 3JAMb 3QWUA 4A3JI 3VMGA 1QVFY 1Y1VS 2ZAEB 3I56Z 3GTPI 3J80b 4MH4A 5D1PA 1VQO1 3GTLI 2QKDA 4Y7NI 3D6WA 2QA41 4MD8A 3HOUI 1VQNZ 1TFIA 1RQFA 2OTJZ 3S15I 4A3II 2HF1A 3CC4Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ9 1;  1QVF Z;  1S72 Z;  3CME 1;  1YJW 1;  3CMA 1;  1YHQ 1;  1VQ8 1;  1VQM 1;  3G4S Z;  3I55 1;  3G6E Z;  3CCV Z;  2QEX 1;  3CCL 1;  1YIT 1;  3CCE Z;  3CCQ 1;  3CCM Z;  1Q81 1;  3CCU Z;  1VQ4 Z;  1VQO Z;  1YIJ Z;  1KQS Y;  1VQL 1;  3OW2 Z;  3CXC Y;  1KD1 1;  3CCS 1;  1Q82 1;  1VQ5 1;  1Q81 2;  3G71 1;  1N8R 1;  3CCJ Z;  1KD1 2;  1VQP 1;  1YI2 1;  3I56 1;  1M1K 2;  1VQK Z;  2OTL 1;  1N8R 2;  1YJ9 Z;  1KC8 2;  3CC2 Z;  1VQ7 Z;  1VQ9 Z;  3CCR 1;  1VQN 1;  1YJW Z;  2OTJ 1;  1KQS Z;  1YJN 1;  3CXC Z;  1K8A 2;  3I55 Z;  3CC4 1;  3CCL Z;  3CCQ Z;  1NJI 1;  1M1K 1;  1VQ6 1;  2QA4 Z;  1KC8 1;  1NJI 2;  3CC7 1;  1K73 1;  3G71 Z;  3G4S 1;  3G6E 1;  3CCV 1;  1K73 2;  2OTL Z;  3CCE 1;  3CPW Y;  3CCM 1;  1YIJ 1;  1Q86 2;  3CME Z;  3CMA Z;  3CCJ 1;  1K8A 1;  1YHQ Z;  1VQ8 Z;  1VQM Z;  1VQK 1;  3CD6 1;  1QVG Y;  2QEX Z;  1YIT Z;  1YJN Z;  1S72 1;  1K9M 2;  3CC2 1;  1VQL Z;  1JJ2 Y;  1VQ7 1;  3CCS Z;  1M90 2;  1VQ5 Z;  1VQ6 Z;  3CPW Z;  1VQP Z;  1YI2 Z;  1QVF Y;  3I56 Z;  3CC7 Z;  1Q86 1;  3CCU 1;  1VQ4 1;  1VQO 1;  1W2B Z;  2QA4 1;  1QVG Z;  1W2B Y;  3CCR Z;  1VQN Z;  1Q7Y 1;  1YJ9 1;  2OTJ Z;  3OW2 Y;  1Q82 2;  1K9M 1;  1Q7Y 2;  1JJ2 Z;  3CD6 Z;  1M90 1;  3CC4 Z; 
#chains in the Genus database with same CATH topology
 3GCF A;  2NAP A;  1S72 Z;  1DL6 A;  1WW9 A;  1YJW 1;  3CMA 1;  5T6B A;  1VQM 1;  5AN9 F;  3HOX I;  1ZH1 A;  3Q87 A;  5CM2 M;  3I55 1;  1USP A;  2E7Z A;  3CCQ 1;  3CCM Z;  2RT9 A;  1L1O C;  2QLV B;  5FLM I;  1VQL 1;  3CCS 1;  4BBR I;  1Q81 2;  2LFU A;  1N8R 1;  1VQP 1;  1YI2 1;  4RVD A;  1YJ9 Z;  4DQY B;  3RZD I;  4A3M I;  4MD9 A;  4A3G I;  3CC2 Z;  3VTN A;  4E2Z A;  4HGZ A;  3FQM A;  2R7Z I;  3S2H I;  3F3P C;  3HOY I;  4BXX I;  2VPY A;  2F4O A;  2RPR A;  4RS4 A;  2QA4 Z;  4A3D I;  3G71 Z;  2JIR A;  3G6E 1;  3CCV 1;  4NOZ A;  3CCE 1;  2YAD A;  1SIW A;  3IX0 A;  5T67 A;  2Q4Z A;  2V3V A;  3FQQ A;  3CMA Z;  3CCJ 1;  4E2X A;  3GTG I;  1QXF A;  1VQM Z;  2E2I I;  1VQK 1;  2OOY B;  4EWC A;  1QVG Y;  1N2F A;  3NDJ A;  1YUA A;  1S72 1;  1VLA A;  5C4J I;  4NBH A;  2GTI A;  2GU2 A;  2QRD B;  1VQL Z;  1JJ2 Y;  3FKI I;  3CCS Z;  4MXU A;  3CPW Z;  1R9T I;  1YI2 Z;  1VQP Z;  3S1R I;  3HOZ I;  3TDH B;  2VUM I;  1Q86 1;  3JAM f;  1AA6 A;  3HOV I;  4TNU A;  5D1O A;  3J80 f;  2E9H A;  1WJ2 A;  1FDI A;  2WB1 A;  3EER A;  1YJ9 1;  2JIP A;  4A3K I;  1Q7Y 2;  2NVT I;  3S1N I;  2V8I A;  1M90 1;  3NFZ A;  1YUK A;  2J6A A;  1QVF Z;  2IV2 X;  4S1T A;  4NBE A;  3G6E Z;  3IFU A;  3CCV Z;  3CCE Z;  2G2K A;  3PO3 I;  3CQZ I;  3NH8 A;  1Q81 1;  3CCU Z;  1VQ4 Z;  3GTK I;  2VF1 A;  2V45 A;  2M6N A;  5A2Q b;  4NH1 C;  1Q82 1;  1VQ5 1;  2JR6 A;  3G71 1;  4RVG A;  3CCJ Z;  2NVQ I;  1M1K 2;  1VQK Z;  3GTO I;  3LUS A;  2VPW A;  1I3Q I;  1NP6 A;  3HKZ A;  2IZ3 A;  3NH4 A;  2JIQ A;  1X3Z A;  5C44 I;  2F4M A;  2R93 I;  1NUI A;  1VQ9 Z;  3CCR 1;  4AYB A;  3ESW A;  2B63 I;  5FLX b;  3CCL Z;  2KI7 B;  4CL1 A;  1TWH I;  4E32 A;  1KC8 1;  1NJI 2;  2JA6 I;  3G4S 1;  3S1Q I;  1K73 2;  1K83 I;  2P3Y A;  4RV9 A;  2V8J A;  3J81 b;  2R6M A;  5IP7 I;  1I50 I;  1K8A 1;  3I4N I;  3VMI A;  4MRI A;  4NBG A;  3F3F C;  5IT9 b;  4NBA A;  2JIO A;  2O53 A;  5T64 A;  1YJN Z;  2HU9 A;  2JNY A;  3VB9 A;  2NVY I;  1VQ7 1;  5C3E I;  1VQ5 Z;  1S7M A;  1VQ6 Z;  3CC7 Z;  4DGL A;  2BJO A;  4NBC A;  3CCU 1;  1VQ4 1;  3S14 I;  2I3C A;  1QVG Z;  3CCR Z;  2PM9 A;  1Q7Y 1;  3OW2 Y;  3GKQ A;  1K9M 1;  1JJ2 Z;  3CD6 Z;  2PMZ A;  4A3F I;  2R92 I;  3J7A 4;  1VQ9 1;  3KIF A;  3CME 1;  2RHB A;  1VQ8 1;  1Y1W I;  3KIH A;  4QTU A;  3G4S Z;  4X6A I;  1RO0 A;  3CCL 1;  2VPX A;  2AKL A;  1KQS Y;  3CXC Y;  1P9N A;  2JIM A;  1KD1 2;  5A2Q f;  4HGY A;  4A3C I;  1KRL A;  1Z02 A;  4XX2 A;  3M4O I;  1VQ7 Z;  4QTT A;  1TWA I;  4MD7 A;  3GTJ I;  4A93 I;  4E31 A;  3GTM I;  1YJN 1;  2Y0S A;  2E2J I;  1RO4 A;  1WII A;  4E30 A;  1Y8C A;  1PFT A;  1NJI 1;  1VQ6 1;  4A3L I;  5FLX f;  3CC7 1;  1K73 1;  4RVF A;  2O4H A;  2RBL A;  2M48 A;  2OTL Z;  2VPZ A;  3TE5 B;  1ZB8 A;  1X0T A;  4NBD A;  1YIJ 1;  2OZK A;  3U50 C;  4NBF A;  3D9X A;  1Q86 2;  3CME Z;  1QYP A;  4HH4 A;  1VQ8 Z;  3J81 f;  3CD6 1;  1Z01 A;  2W03 A;  1WZN A;  3K7A I;  3EED A;  5IT9 f;  4NB8 A;  1M90 2;  4BBS I;  2LEX A;  1USP B;  3I4M I;  2P28 A;  3MZK B;  2LIY A;  2JA5 I;  4E2W A;  1LQL A;  3S2D I;  2EGT A;  4NFR A;  2PK7 A;  4DK1 A;  1W2B Z;  1Y1V I;  2K5R A;  1Z03 A;  1W2B Y;  2JUB A;  1Q82 2;  2H85 A;  1TWG I;  2QR1 B;  2GTH A;  2QRC B;  2V8K A;  2JS4 A;  2IZ4 A;  3T4N B;  3NDI A;  1ZB9 A;  1YHQ 1;  3IF8 A;  3S16 I;  1QF8 A;  3MZL B;  2VUG A;  2QEX 1;  1YIT 1;  1SFO I;  1JWH C;  5LL6 f;  1WCM I;  1VQO Z;  1TWF I;  1YIJ Z;  4Y52 I;  1TWC I;  3OW2 Z;  1KD1 1;  2AYD A;  2OOX B;  2E2H I;  3IR7 A;  3I56 1;  2OTL 1;  1N8R 2;  4A3B I;  2QRE B;  1KC8 2;  3RZO I;  4NB9 A;  3S1M I;  1RO2 A;  2WAQ A;  3GTM S;  3PO3 S;  3H3V J;  3BG1 B;  2RIQ A;  1VQN 1;  1Q16 A;  1YJW Z;  2OTJ 1;  2K3R A;  5C4X I;  3VMH A;  3NH5 A;  1KQS Z;  3CXC Z;  1K8A 2;  3I55 Z;  3CC4 1;  1X3W A;  2JA7 I;  4BY7 I;  1I6H I;  3CCQ Z;  4MON A;  1M1K 1;  2DE6 A;  2NVX I;  2JA8 I;  2DE7 A;  3HOW I;  5IP9 I;  1ML8 A;  4BY1 I;  2YU9 I;  3M3Y I;  4E33 A;  5D1O B;  3CCM 1;  3CPW Y;  4E2Y A;  3P5J B;  3S17 I;  3I07 A;  2W04 A;  2Q51 A;  1RNI A;  3H0G I;  3MON A;  4A3E I;  1YHQ Z;  3BG0 B;  4NBB A;  3GTQ I;  2QEX Z;  1YIT Z;  2JMO A;  3PO2 I;  1K9M 2;  3CC2 1;  1RLY A;  2KPI A;  2DE5 A;  3D2L A;  4RVH A;  3JAM b;  3QWU A;  4A3J I;  3VMG A;  1QVF Y;  1FDO A;  1Y1V S;  2ZAE B;  3I56 Z;  3GTP I;  3J80 b;  4MH4 A;  5D1P A;  1VQO 1;  3GTL I;  2QKD A;  4Y7N I;  3D6W A;  2QA4 1;  4MD8 A;  3HOU I;  1VQN Z;  1TFI A;  1RQF A;  2OTJ Z;  3S15 I;  4A3I I;  2HF1 A;  3CC4 Z; 
#chains in the Genus database with same CATH homology
 3GCF A;  1S72 Z;  1DL6 A;  1WW9 A;  1YJW 1;  3CMA 1;  5T6B A;  1VQM 1;  5AN9 F;  1ZH1 A;  3Q87 A;  3HOX I;  5CM2 M;  3I55 1;  1USP A;  3CCQ 1;  3CCM Z;  2RT9 A;  1L1O C;  2QLV B;  5FLM I;  1VQL 1;  3CCS 1;  4BBR I;  1Q81 2;  2LFU A;  1N8R 1;  1VQP 1;  1YI2 1;  4RVD A;  1YJ9 Z;  4DQY B;  3RZD I;  4A3M I;  4MD9 A;  4A3G I;  3CC2 Z;  3VTN A;  4E2Z A;  4HGZ A;  3FQM A;  2R7Z I;  3S2H I;  3F3P C;  3HOY I;  4BXX I;  2F4O A;  2RPR A;  4RS4 A;  2QA4 Z;  4A3D I;  3G71 Z;  3G6E 1;  3CCV 1;  4NOZ A;  3CCE 1;  2YAD A;  3IX0 A;  5T67 A;  2Q4Z A;  3FQQ A;  3CMA Z;  3CCJ 1;  4E2X A;  3GTG I;  1VQM Z;  2E2I I;  1VQK 1;  2OOY B;  4EWC A;  1QVG Y;  1N2F A;  3NDJ A;  1YUA A;  1S72 1;  1VLA A;  5C4J I;  4NBH A;  2GTI A;  2GU2 A;  2QRD B;  1VQL Z;  1JJ2 Y;  3FKI I;  3CCS Z;  4MXU A;  3CPW Z;  1R9T I;  1YI2 Z;  1VQP Z;  3S1R I;  3HOZ I;  3TDH B;  2VUM I;  1Q86 1;  3JAM f;  3HOV I;  4TNU A;  5D1O A;  3J80 f;  2E9H A;  2WB1 A;  3EER A;  1YJ9 1;  4A3K I;  1Q7Y 2;  2NVT I;  3S1N I;  2V8I A;  1M90 1;  3NFZ A;  1YUK A;  2J6A A;  1QVF Z;  4S1T A;  4NBE A;  3G6E Z;  3IFU A;  3CCV Z;  3CCE Z;  2G2K A;  3PO3 I;  3CQZ I;  3NH8 A;  1Q81 1;  3CCU Z;  1VQ4 Z;  3GTK I;  2VF1 A;  2M6N A;  5A2Q b;  4NH1 C;  1Q82 1;  1VQ5 1;  2JR6 A;  3G71 1;  4RVG A;  3CCJ Z;  2NVQ I;  1M1K 2;  1VQK Z;  3GTO I;  3LUS A;  1I3Q I;  1NP6 A;  3HKZ A;  2IZ3 A;  3NH4 A;  1X3Z A;  5C44 I;  2F4M A;  2R93 I;  1NUI A;  1VQ9 Z;  3CCR 1;  4AYB A;  3ESW A;  2B63 I;  5FLX b;  3CCL Z;  2KI7 B;  4CL1 A;  1TWH I;  4E32 A;  1KC8 1;  1NJI 2;  2JA6 I;  3G4S 1;  3S1Q I;  1K73 2;  1K83 I;  2P3Y A;  4RV9 A;  2V8J A;  3J81 b;  2R6M A;  5IP7 I;  1I50 I;  1K8A 1;  3I4N I;  3VMI A;  4MRI A;  4NBG A;  3F3F C;  5IT9 b;  4NBA A;  2O53 A;  5T64 A;  1YJN Z;  2HU9 A;  2JNY A;  3VB9 A;  2NVY I;  1VQ7 1;  5C3E I;  1VQ5 Z;  1S7M A;  1VQ6 Z;  3CC7 Z;  4DGL A;  2BJO A;  4NBC A;  3CCU 1;  1VQ4 1;  3S14 I;  2I3C A;  1QVG Z;  3CCR Z;  2PM9 A;  1Q7Y 1;  3OW2 Y;  3GKQ A;  1K9M 1;  1JJ2 Z;  3CD6 Z;  2PMZ A;  4A3F I;  2R92 I;  3J7A 4;  1VQ9 1;  3KIF A;  3CME 1;  2RHB A;  1VQ8 1;  1Y1W I;  3KIH A;  4QTU A;  3G4S Z;  4X6A I;  1RO0 A;  3CCL 1;  2AKL A;  1KQS Y;  3CXC Y;  1P9N A;  1KD1 2;  5A2Q f;  4HGY A;  4A3C I;  1KRL A;  1Z02 A;  4XX2 A;  3M4O I;  1VQ7 Z;  4QTT A;  1TWA I;  4MD7 A;  3GTJ I;  4A93 I;  4E31 A;  3GTM I;  1YJN 1;  2Y0S A;  2E2J I;  1RO4 A;  1WII A;  4E30 A;  1PFT A;  1NJI 1;  1VQ6 1;  4A3L I;  5FLX f;  3CC7 1;  1K73 1;  4RVF A;  2O4H A;  2RBL A;  2M48 A;  2OTL Z;  3TE5 B;  1ZB8 A;  1X0T A;  4NBD A;  1YIJ 1;  2OZK A;  3U50 C;  4NBF A;  3D9X A;  1Q86 2;  3CME Z;  1QYP A;  4HH4 A;  1VQ8 Z;  3J81 f;  3CD6 1;  1Z01 A;  2W03 A;  3K7A I;  5IT9 f;  3EED A;  4NB8 A;  1M90 2;  4BBS I;  1USP B;  3I4M I;  2P28 A;  3MZK B;  2LIY A;  2JA5 I;  4E2W A;  1LQL A;  3S2D I;  2EGT A;  4NFR A;  2PK7 A;  4DK1 A;  1W2B Z;  1Y1V I;  2K5R A;  1Z03 A;  1W2B Y;  2JUB A;  1Q82 2;  2H85 A;  1TWG I;  2QR1 B;  2GTH A;  2QRC B;  2V8K A;  2JS4 A;  2IZ4 A;  3T4N B;  3NDI A;  1ZB9 A;  1YHQ 1;  3IF8 A;  3S16 I;  1QF8 A;  3MZL B;  2VUG A;  2QEX 1;  1YIT 1;  1SFO I;  1JWH C;  5LL6 f;  1WCM I;  1VQO Z;  1TWF I;  1YIJ Z;  4Y52 I;  1TWC I;  3OW2 Z;  1KD1 1;  2OOX B;  2E2H I;  3I56 1;  2OTL 1;  1N8R 2;  4A3B I;  2QRE B;  1KC8 2;  3RZO I;  4NB9 A;  3S1M I;  1RO2 A;  2WAQ A;  3GTM S;  3PO3 S;  3H3V J;  3BG1 B;  2RIQ A;  1VQN 1;  1YJW Z;  2OTJ 1;  2K3R A;  5C4X I;  3VMH A;  3NH5 A;  1KQS Z;  3CXC Z;  1K8A 2;  3I55 Z;  3CC4 1;  1X3W A;  2JA7 I;  4BY7 I;  1I6H I;  3CCQ Z;  4MON A;  1M1K 1;  2DE6 A;  2NVX I;  2JA8 I;  2DE7 A;  3HOW I;  5IP9 I;  1ML8 A;  4BY1 I;  2YU9 I;  3M3Y I;  4E33 A;  5D1O B;  3CCM 1;  3CPW Y;  4E2Y A;  3P5J B;  3S17 I;  3I07 A;  2W04 A;  2Q51 A;  1RNI A;  3H0G I;  3MON A;  4A3E I;  1YHQ Z;  3BG0 B;  4NBB A;  3GTQ I;  2QEX Z;  1YIT Z;  2JMO A;  3PO2 I;  1K9M 2;  3CC2 1;  1RLY A;  2KPI A;  2DE5 A;  4RVH A;  3JAM b;  3QWU A;  4A3J I;  3VMG A;  1QVF Y;  1Y1V S;  2ZAE B;  3I56 Z;  3GTP I;  3J80 b;  4MH4 A;  5D1P A;  1VQO 1;  3GTL I;  2QKD A;  4Y7N I;  3D6W A;  2QA4 1;  4MD8 A;  3HOU I;  1VQN Z;  1TFI A;  1RQF A;  2OTJ Z;  3S15 I;  4A3I I;  2HF1 A;  3CC4 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...