3CCS1

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482a
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccs100
1M1K2 3CCL1 1K8A1 2QA4Z 3CCEZ 3G6EZ 1VQLZ 1YIT1 3CCJZ 1VQ8Z 3CC7Z 3CCQZ 1VQ91 1VQ5Z 1Q811 3CD61 2OTJ1 1Q821 1VQO1 3CCSZ 3G4S1 3CC2Z 1NJI2 2OTJZ 1YIJZ 3CCR1 3OW2Z 1VQ81 1YJN1 3CPWY 3OW2Y 1VQK1 3CCE1 1KD11 1Q862 1VQ6Z 3I561 3I56Z 1NJI1 1KC82 1M902 3CCMZ 1QVGZ 1Q7Y1 1W2BY 1YI21 1YIJ1 1QVFZ 1YJNZ 1YJ9Z 3CCU1 1QVGY 3I55Z 1YHQZ 3I551 2QEX1 3CC41 3G711 2OTLZ 3CCQ1 1VQL1 1KQSZ 2QA41 3CCVZ 1VQ41 3CCM1 1N8R2 1K8A2 3G6E1 1VQ4Z 3G71Z 1VQKZ 1VQP1 3CC4Z 3CC21 1JJ2Y 3CCUZ 1YI2Z 1K9M1 3CC71 1VQ51 3CD6Z 1KC81 1N8R1 1VQPZ 3CCJ1 1Q7Y2 1VQ61 1VQNZ 1Q861 1VQM1 1VQMZ 1VQN1 3CCV1 3CCLZ 1K731 3CCRZ 3CXCZ 1VQ71 1VQOZ 3G4SZ 1VQ9Z 1KQSY 1Q812 3CMA1 3CMEZ 1VQ7Z 1YITZ 1K732 1YJW1 1JJ2Z 1M1K1 1YJWZ 1M901 1W2BZ 1QVFY 1KD12 2OTL1 3CMAZ 1S721 2QEXZ 3CXCY 3CME1 1K9M2 1YHQ1 3CCS1 1YJ91 1Q822 1S72Z 3CPWZ
chains in the Genus database with same CATH superfamily
3NFZA 3VTNA 3KIHA 2JIMA 3CCL1 3S1RI 1QXFA 3J80f 1I50I 4NBGA 4BY7I 1VQ8Z 4E30A 3JAMb 3GTGI 4E2WA 4A3JI 2QLVB 2NAPA 3CC2Z 1NJI2 3GTMS 2OTJZ 1YIJZ 3OW2Z 2QR1B 2P3YA 3GTJI 2E2HI 1Q862 1TFIA 2DE7A 1VQ6Z 3I56Z 1Y1VI 2PK7A 3P5JB 2JS4A 4HGYA 2V8IA 1YJNZ 2LFUA 1YJ9Z 2OZKA 3CCU1 1YHQZ 3I551 4RVGA 1VQL1 5FLXf 1Z01A 3CCM1 1N8R2 1K8A2 3G6E1 2M6NA 5D1PA 1TWHI 1VQ4Z 2VF1A 1WCMI 1VQKZ 3VMHA 5IP7I 2NVYI 4HH4A 2Y0SA 3CC4Z 1SIWA 3HOWI 3FQQA 4Y7NI 3CCUZ 1YI2Z 3JAMf 3F3PC 1KRLA 2DE5A 3T4NB 1KC81 1K83I 3HOVI 1VQM1 1DL6A 2DE6A 1SFOI 3CCRZ 1TWCI 3CXCZ 2E7ZA 2E9HA 2AYDA 4DK1A 2QREB 3EEDA 1YUKA 3CMA1 5C4XI 4RS4A 1VQ7Z 4Y52I 1YITZ 5D1OB 4E2XA 3IF8A 4AYBA 5CM2M 4NBFA 4NH1C 4RV9A 4A3CI 3CME1 1K9M2 5C3EI 1TWFI 1Y1WI 4MD9A 4A3II 3BG0B 4MRIA 2K3RA 3S1NI 3CCEZ 1ML8A 4NFRA 2E2II 2NVXI 2Q4ZA 2VUMI 3CCQZ 3NH5A 4RVFA 1Q811 4A3DI 1Q821 5C44I 3J81f 3CCR1 4A3LI 1WIIA 3CPWY 1VQK1 3CCE1 1KD11 2YADA 4A3GI 1M902 4E2ZA 1Q7Y1 4TNUA 3Q87A 1YI21 5C4JI 2RT9A 1QVFZ 2JUBA 3S1QI 2F4OA 2M48A 1Y8CA 2H85A 2LEXA 5IT9b 4BBRI 4DGLA 3CCVZ 4A3EI 3VMIA 3G71Z 4NB9A 5FLXb 2V8KA 4BXXI 2JIQA 3ESWA 5T6BA 3TE5B 1Y1VS 3CC21 2NVQI 1NP6A 2VPXA 3NH8A 3RZOI 3HOUI 1K9M1 3GTLI 2R93I 3CCJ1 2P28A 1Q7Y2 4XX2A 3H0GI 2Q51A 1VQMZ 1RO4A 2VPZA 3MZKB 2RIQA 1ZB9A 1VQOZ 1VQ9Z 3GCFA 1KQSY 1RO2A 2V8JA 3S14I 1Q812 3FQMA 1USPB 3U50C 1YJW1 2O53A 1I6HI 3J80b 4A3MI 1YJWZ 3GTMI 1M901 4MH4A 4NBAA 2QRDB 2GTHA 2RPRA 4X6AI 2RBLA 1KD12 2OTL1 3CXCY 4S1TA 3PO3I 4MXUA 4NBEA 1WJ2A 1R9TI 2B63I 2NVTI 3NH4A 1Q822 4BY1I 1M1K2 2QRCB 2V45A 1K8A1 3S2DI 3K7AI 1VQLZ 3VB9A 1YIT1 2QKDA 3CCJZ 3S1MI 4E2YA 5AN9F 4E31A 1VQ91 4A3KI 4NBCA 2OTJ1 1NUIA 1VQO1 3IX0A 3CCSZ 1VQ81 1I3QI 1FDOA 2HF1A 1ZB8A 1RLYA 3GTKI 3KIFA 2EGTA 3TDHB 1KC82 1QVGZ 2JIPA 1QF8A 4EWCA 1Z03A 1W2BY 1TWGI 1YIJ1 3I4MI 4A3BI 3HKZA 4A3FI 1QVGY 3QWUA 5A2Qf 4HGZA 4NBHA 2QEX1 3FKII 2JA6I 3CC41 2V3VA 3G711 2OTLZ 1ZH1A 3CCQ1 2J6AA 2VPWA 1KQSZ 4E33A 3NDIA 1VQ41 3RZDI 4CL1A 2JR6A 3J7A4 1WW9A 2JMOA 1LQLA 5T64A 3M4OI 1JJ2Y 2JNYA 2I3CA 3CC71 1WZNA 2LIYA 2ZAEB 2BJOA 1VQ51 3CD6Z 3S15I 2HU9A 2YU9I 2W04A 1Q861 4QTTA 3D2LA 1VQN1 1Q16A 3H3VJ 1VQ71 4BBSI 3M3YI 5IP9I 3S17I 3CMEZ 2JA7I 1RO0A 1RQFA 1K732 1Z02A 1JJ2Z 1USPA 3S16I 3CMAZ 1N2FA 3GKQA 3CCS1 2AKLA 3PO3S 1S72Z 4E32A 3EERA 3GTOI 2JIOA 3MZLB 4NBBA 3S2HI 2E2JI 4NOZA 2QA4Z 1JWHC 3G6EZ 1X0TA 5FLMI 2IZ3A 4MONA 3CC7Z 1YUAA 3LUSA 1VQ5Z 3CD61 5D1OA 1RNIA 3IR7A 3D6WA 1P9NA 3G4S1 3VMGA 1YJN1 2KI7B 3F3FC 2WB1A 3OW2Y 3IFUA 4RVDA 4NBDA 3I561 3CQZI 3HOYI 1NJI1 2KPIA 3CCMZ 4QTUA 2JIRA 2OOYB 5T67A 3GTPI 1PFTA 2WAQA 2IZ4A 2GTIA 2VUGA 2O4HA 3I55Z 2R7ZI 1X3ZA 2QA41 4MD7A 1VLAA 2PMZA 1AA6A 1VQP1 2OOXB 3J81b 3D9XA 5A2Qb 5IT9f 3GTQI 1N8R1 1VQPZ 5LL6f 1FDIA 1VQ61 1VQNZ 4MD8A 4A93I 2R92I 3HOXI 3CCV1 3CCLZ 1K731 2R6MA 2JA8I 2F4MA 1X3WA 2GU2A 4NB8A 3G4SZ 2VPYA 3NDJA 2K5RA 2RHBA 2G2KA 2W03A 3MONA 4RVHA 1M1K1 3PO2I 1TWAI 4DQYB 1W2BZ 2PM9A 3HOZI 3I4NI 1QVFY 1S7MA 1QYPA 1S721 2QEXZ 3I07A 1YHQ1 1YJ91 2IV2X 1L1OC 2JA5I 3BG1B 3CPWZ
chains in the Genus database with same CATH topology
3NFZA 3VTNA 3KIHA 3CCL1 3S1RI 3J80f 1I50I 4NBGA 4BY7I 1VQ8Z 4E30A 3JAMb 3GTGI 4E2WA 4A3JI 2QLVB 3CC2Z 1NJI2 3GTMS 2OTJZ 1YIJZ 3OW2Z 2QR1B 2P3YA 3GTJI 2E2HI 1Q862 1TFIA 2DE7A 1VQ6Z 3I56Z 1Y1VI 2PK7A 3P5JB 2JS4A 4HGYA 2V8IA 1YJNZ 2LFUA 1YJ9Z 2OZKA 3CCU1 1YHQZ 3I551 4RVGA 1VQL1 5FLXf 1Z01A 3CCM1 1N8R2 1K8A2 3G6E1 2M6NA 5D1PA 1TWHI 1VQ4Z 2VF1A 1WCMI 1VQKZ 3VMHA 5IP7I 2NVYI 4HH4A 2Y0SA 3CC4Z 3HOWI 3FQQA 4Y7NI 3CCUZ 1YI2Z 3JAMf 3F3PC 1KRLA 2DE5A 3T4NB 1KC81 1K83I 3HOVI 1VQM1 1DL6A 2DE6A 1SFOI 3CCRZ 1TWCI 3CXCZ 2E9HA 4DK1A 2QREB 3EEDA 1YUKA 3CMA1 5C4XI 4RS4A 1VQ7Z 4Y52I 1YITZ 5D1OB 4E2XA 3IF8A 4AYBA 5CM2M 4NBFA 4NH1C 4RV9A 4A3CI 3CME1 1K9M2 5C3EI 1TWFI 1Y1WI 4MD9A 4A3II 3BG0B 4MRIA 2K3RA 3S1NI 3CCEZ 1ML8A 4NFRA 2E2II 2NVXI 2Q4ZA 2VUMI 3CCQZ 3NH5A 4RVFA 1Q811 4A3DI 1Q821 5C44I 3J81f 3CCR1 4A3LI 1WIIA 3CPWY 1VQK1 3CCE1 1KD11 2YADA 4A3GI 1M902 4E2ZA 1Q7Y1 4TNUA 3Q87A 1YI21 5C4JI 2RT9A 1QVFZ 2JUBA 3S1QI 2F4OA 2M48A 2H85A 5IT9b 4BBRI 4DGLA 3CCVZ 4A3EI 3VMIA 3G71Z 4NB9A 5FLXb 2V8KA 4BXXI 3ESWA 5T6BA 3TE5B 1Y1VS 3CC21 2NVQI 1NP6A 3NH8A 3RZOI 3HOUI 1K9M1 3GTLI 2R93I 3CCJ1 2P28A 1Q7Y2 4XX2A 3H0GI 2Q51A 1VQMZ 1RO4A 3MZKB 2RIQA 1ZB9A 1VQOZ 1VQ9Z 3GCFA 1KQSY 1RO2A 2V8JA 3S14I 1Q812 3FQMA 1USPB 3U50C 1YJW1 2O53A 1I6HI 3J80b 4A3MI 1YJWZ 3GTMI 1M901 4MH4A 4NBAA 2QRDB 2GTHA 2RPRA 4X6AI 2RBLA 1KD12 2OTL1 3CXCY 4S1TA 3PO3I 4MXUA 4NBEA 1R9TI 2B63I 2NVTI 3NH4A 1Q822 4BY1I 1M1K2 2QRCB 1K8A1 3S2DI 3K7AI 1VQLZ 3VB9A 1YIT1 2QKDA 3CCJZ 3S1MI 4E2YA 5AN9F 4E31A 1VQ91 4A3KI 4NBCA 2OTJ1 1NUIA 1VQO1 3IX0A 3CCSZ 1VQ81 1I3QI 2HF1A 1ZB8A 1RLYA 3GTKI 3KIFA 2EGTA 3TDHB 1KC82 1QVGZ 1QF8A 4EWCA 1Z03A 1W2BY 1TWGI 1YIJ1 3I4MI 4A3BI 3HKZA 4A3FI 1QVGY 3QWUA 5A2Qf 4HGZA 4NBHA 2QEX1 3FKII 2JA6I 3CC41 3G711 2OTLZ 1ZH1A 3CCQ1 2J6AA 1KQSZ 4E33A 3NDIA 1VQ41 3RZDI 4CL1A 2JR6A 3J7A4 1WW9A 2JMOA 1LQLA 5T64A 3M4OI 1JJ2Y 2JNYA 2I3CA 3CC71 2LIYA 2ZAEB 2BJOA 1VQ51 3CD6Z 3S15I 2HU9A 2YU9I 2W04A 1Q861 4QTTA 1VQN1 3H3VJ 1VQ71 4BBSI 3M3YI 5IP9I 3S17I 3CMEZ 2JA7I 1RO0A 1RQFA 1K732 1Z02A 1JJ2Z 1USPA 3S16I 3CMAZ 1N2FA 3GKQA 3CCS1 2AKLA 3PO3S 1S72Z 4E32A 3EERA 3GTOI 3MZLB 4NBBA 3S2HI 2E2JI 4NOZA 2QA4Z 1JWHC 3G6EZ 1X0TA 5FLMI 2IZ3A 4MONA 3CC7Z 1YUAA 3LUSA 1VQ5Z 3CD61 5D1OA 1RNIA 3D6WA 1P9NA 3G4S1 3VMGA 1YJN1 2KI7B 3F3FC 2WB1A 3OW2Y 3IFUA 4RVDA 4NBDA 3I561 3CQZI 3HOYI 1NJI1 2KPIA 3CCMZ 4QTUA 2OOYB 5T67A 3GTPI 1PFTA 2WAQA 2IZ4A 2GTIA 2VUGA 2O4HA 3I55Z 2R7ZI 1X3ZA 2QA41 4MD7A 1VLAA 2PMZA 1VQP1 2OOXB 3J81b 3D9XA 5A2Qb 5IT9f 3GTQI 1N8R1 1VQPZ 5LL6f 1VQ61 1VQNZ 4MD8A 4A93I 2R92I 3HOXI 3CCV1 3CCLZ 1K731 2R6MA 2JA8I 2F4MA 1X3WA 2GU2A 4NB8A 3G4SZ 3NDJA 2K5RA 2RHBA 2G2KA 2W03A 3MONA 4RVHA 1M1K1 3PO2I 1TWAI 4DQYB 1W2BZ 2PM9A 3HOZI 3I4NI 1QVFY 1S7MA 1QYPA 1S721 2QEXZ 3I07A 1YHQ1 1YJ91 1L1OC 2JA5I 3BG1B 3CPWZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1K 2;  3CCL 1;  1K8A 1;  2QA4 Z;  3CCE Z;  3G6E Z;  1VQL Z;  1YIT 1;  3CCJ Z;  1VQ8 Z;  3CC7 Z;  3CCQ Z;  1VQ9 1;  1VQ5 Z;  1Q81 1;  3CD6 1;  2OTJ 1;  1Q82 1;  1VQO 1;  3CCS Z;  3G4S 1;  3CC2 Z;  1NJI 2;  2OTJ Z;  1YIJ Z;  3CCR 1;  3OW2 Z;  1VQ8 1;  1YJN 1;  3CPW Y;  3OW2 Y;  1VQK 1;  3CCE 1;  1KD1 1;  1Q86 2;  1VQ6 Z;  3I56 1;  3I56 Z;  1NJI 1;  1KC8 2;  1M90 2;  3CCM Z;  1QVG Z;  1Q7Y 1;  1W2B Y;  1YI2 1;  1YIJ 1;  1QVF Z;  1YJN Z;  1YJ9 Z;  3CCU 1;  1QVG Y;  3I55 Z;  1YHQ Z;  3I55 1;  2QEX 1;  3CC4 1;  3G71 1;  2OTL Z;  3CCQ 1;  1VQL 1;  1KQS Z;  2QA4 1;  3CCV Z;  1VQ4 1;  3CCM 1;  1N8R 2;  1K8A 2;  3G6E 1;  1VQ4 Z;  3G71 Z;  1VQK Z;  1VQP 1;  3CC4 Z;  3CC2 1;  1JJ2 Y;  3CCU Z;  1YI2 Z;  1K9M 1;  3CC7 1;  1VQ5 1;  3CD6 Z;  1KC8 1;  1N8R 1;  1VQP Z;  3CCJ 1;  1Q7Y 2;  1VQ6 1;  1VQN Z;  1Q86 1;  1VQM 1;  1VQM Z;  1VQN 1;  3CCV 1;  3CCL Z;  1K73 1;  3CCR Z;  3CXC Z;  1VQ7 1;  1VQO Z;  3G4S Z;  1VQ9 Z;  1KQS Y;  1Q81 2;  3CMA 1;  3CME Z;  1VQ7 Z;  1YIT Z;  1K73 2;  1YJW 1;  1JJ2 Z;  1M1K 1;  1YJW Z;  1M90 1;  1W2B Z;  1QVF Y;  1KD1 2;  2OTL 1;  3CMA Z;  1S72 1;  2QEX Z;  3CXC Y;  3CME 1;  1K9M 2;  1YHQ 1;  3CCS 1;  1YJ9 1;  1Q82 2;  1S72 Z;  3CPW Z; 
#chains in the Genus database with same CATH topology
 3NFZ A;  3VTN A;  3KIH A;  2JIM A;  3CCL 1;  3S1R I;  1QXF A;  3J80 f;  1I50 I;  4NBG A;  4BY7 I;  1VQ8 Z;  4E30 A;  3JAM b;  3GTG I;  4E2W A;  4A3J I;  2QLV B;  2NAP A;  3CC2 Z;  1NJI 2;  3GTM S;  2OTJ Z;  1YIJ Z;  3OW2 Z;  2QR1 B;  2P3Y A;  3GTJ I;  2E2H I;  1Q86 2;  1TFI A;  2DE7 A;  1VQ6 Z;  3I56 Z;  1Y1V I;  2PK7 A;  3P5J B;  2JS4 A;  4HGY A;  2V8I A;  1YJN Z;  2LFU A;  1YJ9 Z;  2OZK A;  3CCU 1;  1YHQ Z;  3I55 1;  4RVG A;  1VQL 1;  5FLX f;  1Z01 A;  3CCM 1;  1N8R 2;  1K8A 2;  3G6E 1;  2M6N A;  5D1P A;  1TWH I;  1VQ4 Z;  2VF1 A;  1WCM I;  1VQK Z;  3VMH A;  5IP7 I;  2NVY I;  4HH4 A;  2Y0S A;  3CC4 Z;  1SIW A;  3HOW I;  3FQQ A;  4Y7N I;  3CCU Z;  1YI2 Z;  3JAM f;  3F3P C;  1KRL A;  2DE5 A;  3T4N B;  1KC8 1;  1K83 I;  3HOV I;  1VQM 1;  1DL6 A;  2DE6 A;  1SFO I;  3CCR Z;  1TWC I;  3CXC Z;  2E7Z A;  2E9H A;  2AYD A;  4DK1 A;  2QRE B;  3EED A;  1YUK A;  3CMA 1;  5C4X I;  4RS4 A;  1VQ7 Z;  4Y52 I;  1YIT Z;  5D1O B;  4E2X A;  3IF8 A;  4AYB A;  5CM2 M;  4NBF A;  4NH1 C;  4RV9 A;  4A3C I;  3CME 1;  1K9M 2;  5C3E I;  1TWF I;  1Y1W I;  4MD9 A;  4A3I I;  3BG0 B;  4MRI A;  2K3R A;  3S1N I;  3CCE Z;  1ML8 A;  4NFR A;  2E2I I;  2NVX I;  2Q4Z A;  2VUM I;  3CCQ Z;  3NH5 A;  4RVF A;  1Q81 1;  4A3D I;  1Q82 1;  5C44 I;  3J81 f;  3CCR 1;  4A3L I;  1WII A;  3CPW Y;  1VQK 1;  3CCE 1;  1KD1 1;  2YAD A;  4A3G I;  1M90 2;  4E2Z A;  1Q7Y 1;  4TNU A;  3Q87 A;  1YI2 1;  5C4J I;  2RT9 A;  1QVF Z;  2JUB A;  3S1Q I;  2F4O A;  2M48 A;  1Y8C A;  2H85 A;  2LEX A;  5IT9 b;  4BBR I;  4DGL A;  3CCV Z;  4A3E I;  3VMI A;  3G71 Z;  4NB9 A;  5FLX b;  2V8K A;  4BXX I;  2JIQ A;  3ESW A;  5T6B A;  3TE5 B;  1Y1V S;  3CC2 1;  2NVQ I;  1NP6 A;  2VPX A;  3NH8 A;  3RZO I;  3HOU I;  1K9M 1;  3GTL I;  2R93 I;  3CCJ 1;  2P28 A;  1Q7Y 2;  4XX2 A;  3H0G I;  2Q51 A;  1VQM Z;  1RO4 A;  2VPZ A;  3MZK B;  2RIQ A;  1ZB9 A;  1VQO Z;  1VQ9 Z;  3GCF A;  1KQS Y;  1RO2 A;  2V8J A;  3S14 I;  1Q81 2;  3FQM A;  1USP B;  3U50 C;  1YJW 1;  2O53 A;  1I6H I;  3J80 b;  4A3M I;  1YJW Z;  3GTM I;  1M90 1;  4MH4 A;  4NBA A;  2QRD B;  2GTH A;  2RPR A;  4X6A I;  2RBL A;  1KD1 2;  2OTL 1;  3CXC Y;  4S1T A;  3PO3 I;  4MXU A;  4NBE A;  1WJ2 A;  1R9T I;  2B63 I;  2NVT I;  3NH4 A;  1Q82 2;  4BY1 I;  1M1K 2;  2QRC B;  2V45 A;  1K8A 1;  3S2D I;  3K7A I;  1VQL Z;  3VB9 A;  1YIT 1;  2QKD A;  3CCJ Z;  3S1M I;  4E2Y A;  5AN9 F;  4E31 A;  1VQ9 1;  4A3K I;  4NBC A;  2OTJ 1;  1NUI A;  1VQO 1;  3IX0 A;  3CCS Z;  1VQ8 1;  1I3Q I;  1FDO A;  2HF1 A;  1ZB8 A;  1RLY A;  3GTK I;  3KIF A;  2EGT A;  3TDH B;  1KC8 2;  1QVG Z;  2JIP A;  1QF8 A;  4EWC A;  1Z03 A;  1W2B Y;  1TWG I;  1YIJ 1;  3I4M I;  4A3B I;  3HKZ A;  4A3F I;  1QVG Y;  3QWU A;  5A2Q f;  4HGZ A;  4NBH A;  2QEX 1;  3FKI I;  2JA6 I;  3CC4 1;  2V3V A;  3G71 1;  2OTL Z;  1ZH1 A;  3CCQ 1;  2J6A A;  2VPW A;  1KQS Z;  4E33 A;  3NDI A;  1VQ4 1;  3RZD I;  4CL1 A;  2JR6 A;  3J7A 4;  1WW9 A;  2JMO A;  1LQL A;  5T64 A;  3M4O I;  1JJ2 Y;  2JNY A;  2I3C A;  3CC7 1;  1WZN A;  2LIY A;  2ZAE B;  2BJO A;  1VQ5 1;  3CD6 Z;  3S15 I;  2HU9 A;  2YU9 I;  2W04 A;  1Q86 1;  4QTT A;  3D2L A;  1VQN 1;  1Q16 A;  3H3V J;  1VQ7 1;  4BBS I;  3M3Y I;  5IP9 I;  3S17 I;  3CME Z;  2JA7 I;  1RO0 A;  1RQF A;  1K73 2;  1Z02 A;  1JJ2 Z;  1USP A;  3S16 I;  3CMA Z;  1N2F A;  3GKQ A;  3CCS 1;  2AKL A;  3PO3 S;  1S72 Z;  4E32 A;  3EER A;  3GTO I;  2JIO A;  3MZL B;  4NBB A;  3S2H I;  2E2J I;  4NOZ A;  2QA4 Z;  1JWH C;  3G6E Z;  1X0T A;  5FLM I;  2IZ3 A;  4MON A;  3CC7 Z;  1YUA A;  3LUS A;  1VQ5 Z;  3CD6 1;  5D1O A;  1RNI A;  3IR7 A;  3D6W A;  1P9N A;  3G4S 1;  3VMG A;  1YJN 1;  2KI7 B;  3F3F C;  2WB1 A;  3OW2 Y;  3IFU A;  4RVD A;  4NBD A;  3I56 1;  3CQZ I;  3HOY I;  1NJI 1;  2KPI A;  3CCM Z;  4QTU A;  2JIR A;  2OOY B;  5T67 A;  3GTP I;  1PFT A;  2WAQ A;  2IZ4 A;  2GTI A;  2VUG A;  2O4H A;  3I55 Z;  2R7Z I;  1X3Z A;  2QA4 1;  4MD7 A;  1VLA A;  2PMZ A;  1AA6 A;  1VQP 1;  2OOX B;  3J81 b;  3D9X A;  5A2Q b;  5IT9 f;  3GTQ I;  1N8R 1;  1VQP Z;  5LL6 f;  1FDI A;  1VQ6 1;  1VQN Z;  4MD8 A;  4A93 I;  2R92 I;  3HOX I;  3CCV 1;  3CCL Z;  1K73 1;  2R6M A;  2JA8 I;  2F4M A;  1X3W A;  2GU2 A;  4NB8 A;  3G4S Z;  2VPY A;  3NDJ A;  2K5R A;  2RHB A;  2G2K A;  2W03 A;  3MON A;  4RVH A;  1M1K 1;  3PO2 I;  1TWA I;  4DQY B;  1W2B Z;  2PM9 A;  3HOZ I;  3I4N I;  1QVF Y;  1S7M A;  1QYP A;  1S72 1;  2QEX Z;  3I07 A;  1YHQ 1;  1YJ9 1;  2IV2 X;  1L1O C;  2JA5 I;  3BG1 B;  3CPW Z; 
#chains in the Genus database with same CATH homology
 3NFZ A;  3VTN A;  3KIH A;  3CCL 1;  3S1R I;  3J80 f;  1I50 I;  4NBG A;  4BY7 I;  1VQ8 Z;  4E30 A;  3JAM b;  3GTG I;  4E2W A;  4A3J I;  2QLV B;  3CC2 Z;  1NJI 2;  3GTM S;  2OTJ Z;  1YIJ Z;  3OW2 Z;  2QR1 B;  2P3Y A;  3GTJ I;  2E2H I;  1Q86 2;  1TFI A;  2DE7 A;  1VQ6 Z;  3I56 Z;  1Y1V I;  2PK7 A;  3P5J B;  2JS4 A;  4HGY A;  2V8I A;  1YJN Z;  2LFU A;  1YJ9 Z;  2OZK A;  3CCU 1;  1YHQ Z;  3I55 1;  4RVG A;  1VQL 1;  5FLX f;  1Z01 A;  3CCM 1;  1N8R 2;  1K8A 2;  3G6E 1;  2M6N A;  5D1P A;  1TWH I;  1VQ4 Z;  2VF1 A;  1WCM I;  1VQK Z;  3VMH A;  5IP7 I;  2NVY I;  4HH4 A;  2Y0S A;  3CC4 Z;  3HOW I;  3FQQ A;  4Y7N I;  3CCU Z;  1YI2 Z;  3JAM f;  3F3P C;  1KRL A;  2DE5 A;  3T4N B;  1KC8 1;  1K83 I;  3HOV I;  1VQM 1;  1DL6 A;  2DE6 A;  1SFO I;  3CCR Z;  1TWC I;  3CXC Z;  2E9H A;  4DK1 A;  2QRE B;  3EED A;  1YUK A;  3CMA 1;  5C4X I;  4RS4 A;  1VQ7 Z;  4Y52 I;  1YIT Z;  5D1O B;  4E2X A;  3IF8 A;  4AYB A;  5CM2 M;  4NBF A;  4NH1 C;  4RV9 A;  4A3C I;  3CME 1;  1K9M 2;  5C3E I;  1TWF I;  1Y1W I;  4MD9 A;  4A3I I;  3BG0 B;  4MRI A;  2K3R A;  3S1N I;  3CCE Z;  1ML8 A;  4NFR A;  2E2I I;  2NVX I;  2Q4Z A;  2VUM I;  3CCQ Z;  3NH5 A;  4RVF A;  1Q81 1;  4A3D I;  1Q82 1;  5C44 I;  3J81 f;  3CCR 1;  4A3L I;  1WII A;  3CPW Y;  1VQK 1;  3CCE 1;  1KD1 1;  2YAD A;  4A3G I;  1M90 2;  4E2Z A;  1Q7Y 1;  4TNU A;  3Q87 A;  1YI2 1;  5C4J I;  2RT9 A;  1QVF Z;  2JUB A;  3S1Q I;  2F4O A;  2M48 A;  2H85 A;  5IT9 b;  4BBR I;  4DGL A;  3CCV Z;  4A3E I;  3VMI A;  3G71 Z;  4NB9 A;  5FLX b;  2V8K A;  4BXX I;  3ESW A;  5T6B A;  3TE5 B;  1Y1V S;  3CC2 1;  2NVQ I;  1NP6 A;  3NH8 A;  3RZO I;  3HOU I;  1K9M 1;  3GTL I;  2R93 I;  3CCJ 1;  2P28 A;  1Q7Y 2;  4XX2 A;  3H0G I;  2Q51 A;  1VQM Z;  1RO4 A;  3MZK B;  2RIQ A;  1ZB9 A;  1VQO Z;  1VQ9 Z;  3GCF A;  1KQS Y;  1RO2 A;  2V8J A;  3S14 I;  1Q81 2;  3FQM A;  1USP B;  3U50 C;  1YJW 1;  2O53 A;  1I6H I;  3J80 b;  4A3M I;  1YJW Z;  3GTM I;  1M90 1;  4MH4 A;  4NBA A;  2QRD B;  2GTH A;  2RPR A;  4X6A I;  2RBL A;  1KD1 2;  2OTL 1;  3CXC Y;  4S1T A;  3PO3 I;  4MXU A;  4NBE A;  1R9T I;  2B63 I;  2NVT I;  3NH4 A;  1Q82 2;  4BY1 I;  1M1K 2;  2QRC B;  1K8A 1;  3S2D I;  3K7A I;  1VQL Z;  3VB9 A;  1YIT 1;  2QKD A;  3CCJ Z;  3S1M I;  4E2Y A;  5AN9 F;  4E31 A;  1VQ9 1;  4A3K I;  4NBC A;  2OTJ 1;  1NUI A;  1VQO 1;  3IX0 A;  3CCS Z;  1VQ8 1;  1I3Q I;  2HF1 A;  1ZB8 A;  1RLY A;  3GTK I;  3KIF A;  2EGT A;  3TDH B;  1KC8 2;  1QVG Z;  1QF8 A;  4EWC A;  1Z03 A;  1W2B Y;  1TWG I;  1YIJ 1;  3I4M I;  4A3B I;  3HKZ A;  4A3F I;  1QVG Y;  3QWU A;  5A2Q f;  4HGZ A;  4NBH A;  2QEX 1;  3FKI I;  2JA6 I;  3CC4 1;  3G71 1;  2OTL Z;  1ZH1 A;  3CCQ 1;  2J6A A;  1KQS Z;  4E33 A;  3NDI A;  1VQ4 1;  3RZD I;  4CL1 A;  2JR6 A;  3J7A 4;  1WW9 A;  2JMO A;  1LQL A;  5T64 A;  3M4O I;  1JJ2 Y;  2JNY A;  2I3C A;  3CC7 1;  2LIY A;  2ZAE B;  2BJO A;  1VQ5 1;  3CD6 Z;  3S15 I;  2HU9 A;  2YU9 I;  2W04 A;  1Q86 1;  4QTT A;  1VQN 1;  3H3V J;  1VQ7 1;  4BBS I;  3M3Y I;  5IP9 I;  3S17 I;  3CME Z;  2JA7 I;  1RO0 A;  1RQF A;  1K73 2;  1Z02 A;  1JJ2 Z;  1USP A;  3S16 I;  3CMA Z;  1N2F A;  3GKQ A;  3CCS 1;  2AKL A;  3PO3 S;  1S72 Z;  4E32 A;  3EER A;  3GTO I;  3MZL B;  4NBB A;  3S2H I;  2E2J I;  4NOZ A;  2QA4 Z;  1JWH C;  3G6E Z;  1X0T A;  5FLM I;  2IZ3 A;  4MON A;  3CC7 Z;  1YUA A;  3LUS A;  1VQ5 Z;  3CD6 1;  5D1O A;  1RNI A;  3D6W A;  1P9N A;  3G4S 1;  3VMG A;  1YJN 1;  2KI7 B;  3F3F C;  2WB1 A;  3OW2 Y;  3IFU A;  4RVD A;  4NBD A;  3I56 1;  3CQZ I;  3HOY I;  1NJI 1;  2KPI A;  3CCM Z;  4QTU A;  2OOY B;  5T67 A;  3GTP I;  1PFT A;  2WAQ A;  2IZ4 A;  2GTI A;  2VUG A;  2O4H A;  3I55 Z;  2R7Z I;  1X3Z A;  2QA4 1;  4MD7 A;  1VLA A;  2PMZ A;  1VQP 1;  2OOX B;  3J81 b;  3D9X A;  5A2Q b;  5IT9 f;  3GTQ I;  1N8R 1;  1VQP Z;  5LL6 f;  1VQ6 1;  1VQN Z;  4MD8 A;  4A93 I;  2R92 I;  3HOX I;  3CCV 1;  3CCL Z;  1K73 1;  2R6M A;  2JA8 I;  2F4M A;  1X3W A;  2GU2 A;  4NB8 A;  3G4S Z;  3NDJ A;  2K5R A;  2RHB A;  2G2K A;  2W03 A;  3MON A;  4RVH A;  1M1K 1;  3PO2 I;  1TWA I;  4DQY B;  1W2B Z;  2PM9 A;  3HOZ I;  3I4N I;  1QVF Y;  1S7M A;  1QYP A;  1S72 1;  2QEX Z;  3I07 A;  1YHQ 1;  1YJ9 1;  1L1O C;  2JA5 I;  3BG1 B;  3CPW Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...