3CCS1

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482a
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccs100
1VQKZ 3I55Z 1YJ91 3CCE1 3CCLZ 1Q7Y1 3CCR1 1K8A1 3CD61 1VQLZ 3CMEZ 1W2BZ 1VQK1 1K732 3I551 1VQ4Z 1YIT1 3CCQ1 1Q812 3CMAZ 1YIJ1 2OTJZ 3CCJ1 3CME1 1W2BY 1YJNZ 1VQ8Z 1VQPZ 1KC81 1K9M1 1VQMZ 3CC2Z 1Q861 1YJWZ 3OW2Z 3CMA1 3CC41 1S72Z 1YHQ1 1VQ81 1VQP1 1KD11 3OW2Y 3I56Z 3CC21 1YJW1 1N8R2 1VQ7Z 1NJI1 1YI2Z 1S721 1M901 3CCL1 1Q862 3CPWZ 3CCUZ 1VQL1 1VQ9Z 1JJ2Z 1Q7Y2 1VQ5Z 1M1K1 1VQOZ 1KD12 1KQSZ 1K8A2 1VQ71 3G4SZ 3G71Z 1VQ41 3CCU1 3G6EZ 2OTJ1 1JJ2Y 1VQNZ 1VQ91 1NJI2 2OTLZ 1YJN1 3CC7Z 1KQSY 1VQO1 1VQ6Z 1VQM1 3G711 3G4S1 2QA4Z 3CXCZ 1QVFZ 1QVGZ 3G6E1 1KC82 1K9M2 1VQN1 2OTL1 3CCEZ 3CCRZ 1K731 1VQ61 3CCMZ 1QVFY 2QA41 3I561 1Q821 1QVGY 3CCSZ 1Q811 1YI21 3CPWY 1YITZ 3CCQZ 1YIJZ 3CCM1 3CCJZ 1M902 1VQ51 3CCS1 3CCVZ 2QEXZ 1Q822 1M1K2 1YJ9Z 3CC4Z 3CC71 1YHQZ 3CCV1 1N8R1 2QEX1 3CD6Z 3CXCY
chains in the Genus database with same CATH superfamily
5A2Qf 3I4MI 2PMZA 4NBGA 4E2WA 1ZH1A 2JA6I 3CMEZ 4NBBA 4A3FI 2B63I 2V8JA 4NH1C 3NH8A 3I551 3J80f 2M48A 2GTIA 1YIJ1 1USPA 1ZB9A 3BG0B 2W03A 3JAMf 1VQ8Z 1K9M1 5D1OA 3S16I 2R7ZI 2RIQA 3GCFA 4A3DI 1KD11 3CC21 1YI2Z 3S15I 3S1RI 3I4NI 3CPWZ 1ML8A 4A93I 1I6HI 1P9NA 2M6NA 1Q7Y2 1VQ5Z 1KD12 3H0GI 3EEDA 1FDIA 3NH4A 4A3GI 4RV9A 1TWCI 2IZ3A 3TE5B 3G6EZ 3S1NI 2DE6A 3NDIA 2WB1A 2G2KA 2VF1A 2K5RA 1VQ6Z 3Q87A 3VTNA 3KIFA 3G4S1 3G711 1QVGZ 3GTJI 3CCRZ 1X3WA 3S1QI 3GKQA 4A3KI 2E9HA 2QA41 1QVGY 3HOUI 2GU2A 1YI21 3GTPI 2V8IA 3CCM1 1WCMI 1M902 2W04A 1VQ51 2JR6A 1R9TI 4NBCA 2F4MA 2E2JI 4E2YA 2R6MA 3RZOI 3PO3S 2Y0SA 4QTTA 2JA5I 3D9XA 3CQZI 3FKII 3I55Z 2QLVB 3CCR1 1TFIA 3S2HI 4NBDA 4HH4A 1WIIA 4CL1A 1K732 4Y52I 1KRLA 2JA7I 5T67A 1VQ4Z 1JWHC 1Q812 2OTJZ 2VPXA 2E2HI 4NB8A 1YJNZ 2IZ4A 1TWFI 1KC81 2DE5A 1VQMZ 5FLXf 4HGZA 3CC2Z 4XX2A 2JMOA 1Q861 1SIWA 3J7A4 4MD7A 4E30A 4A3LI 1Z01A 1L1OC 3GTGI 3HOXI 1ZB8A 4A3EI 1S721 1X3ZA 1K83I 2QRCB 1Q862 3FQMA 3H3VJ 5C4JI 4A3II 2HU9A 1KQSZ 3G4SZ 3G71Z 3QWUA 2KI7B 2QREB 1VQ41 2V8KA 4RVGA 4BY7I 2LEXA 2V45A 1Z03A 2BJOA 2OTJ1 2RBLA 4DQYB 1YJN1 3CC7Z 2AKLA 1KQSY 3S17I 3PO2I 1VQO1 3KIHA 1VQM1 5C44I 2QA4Z 3CXCZ 4E2ZA 3S2DI 2R93I 3F3PC 1K9M2 4A3BI 2Q4ZA 4NBFA 4E2XA 3CCEZ 2JUBA 1LQLA 3D6WA 5C3EI 2JIOA 2NVYI 3CCMZ 5CM2M 5AN9F 1YUAA 3CPWY 3HOZI 4RVDA 3CCQZ 2QR1B 1I3QI 2RHBA 4MRIA 3CCS1 1WZNA 4DGLA 1VLAA 1YUKA 3S14I 2JS4A 3CC4Z 3CC71 1S7MA 1YHQZ 1N8R1 3S1MI 4Y7NI 1RO0A 3CCE1 4DK1A 4BY1I 1K8A1 3M4OI 3VMHA 4A3MI 1W2BZ 1VQK1 4NFRA 3HOVI 4BXXI 3MZLB 2LIYA 3CCQ1 3GTMI 2RPRA 2VPZA 2ZAEB 2JIQA 1W2BY 3NDJA 2OZKA 1NUIA 5IP9I 1Y1VI 3OW2Z 5IT9b 3CMA1 2YADA 3CC41 1S72Z 2V3VA 1YHQ1 4NBHA 1VQP1 3OW2Y 2OOYB 2JA8I 1YJW1 3GTKI 1I50I 2RT9A 3ESWA 2JIPA 3FQQA 4MD9A 4AYBA 2NAPA 1TWHI 3J80b 1JJ2Z 2WAQA 3F3FC 1M1K1 1VQOZ 4E33A 1VQ71 3VMGA 3IR7A 1RO4A 3JAMb 4MH4A 3CCU1 5FLMI 3J81b 1JJ2Y 2E2II 1VQ91 4E31A 1FDOA 1PFTA 2O53A 2VPYA 1QVFZ 1TWGI 1KC82 1Y1WI 2NVXI 1VQN1 3IX0A 1AA6A 2OTL1 4TNUA 1RNIA 4EWCA 3MZKB 1QVFY 3I07A 1Q821 3CCSZ 2NVTI 2NVQI 3GTLI 4MONA 1YITZ 3CCJZ 3HOYI 3MONA 2VPWA 1Q822 4S1TA 1SFOI 2YU9I 4NBAA 2VUMI 4E32A 3CCV1 3NFZA 2QEX1 3J81f 3CXCY 3LUSA 1RO2A 4HGYA 2AYDA 2JIMA 1VQKZ 2I3CA 2J6AA 3BG1B 5T6BA 1YJ91 4RS4A 3CCLZ 1Q7Y1 2F4OA 2P28A 1QYPA 2KPIA 3T4NB 3CD61 1VQLZ 4RVFA 5C4XI 4BBSI 1WW9A 5LL6f 2EGTA 1YIT1 3CMAZ 3CCJ1 3CME1 3TDHB 1Y8CA 1VQPZ 2VUGA 3VB9A 1YJWZ 3GTOI 1RLYA 2JIRA 2Q51A 1VQ81 2O4HA 2PM9A 1Z02A 4NBEA 3I56Z 3NH5A 3VMIA 4QTUA 3PO3I 1N8R2 1VQ7Z 2R92I 4X6AI 1NJI1 1M901 3CCL1 3CCUZ 2GTHA 2QRDB 4A3CI 3RZDI 1VQL1 1WJ2A 1VQ9Z 2H85A 2HF1A 1Q16A 1QXFA 1K8A2 4MXUA 4BBRI 3D2LA 1VQNZ 5FLXb 1NJI2 2OTLZ 2PK7A 3K7AI 5A2Qb 3G6E1 3HOWI 1NP6A 2E7ZA 2JNYA 5T64A 1K731 1VQ61 3U50C 3GTQI 1X0TA 3I561 3GTMS 2OOXB 1Q811 4A3JI 1DL6A 4MD8A 2DE7A 3P5JB 1QF8A 2IV2X 1YIJZ 3M3YI 1Y1VS 3CCVZ 1RQFA 3IFUA 2QEXZ 1USPB 4NOZA 4NB9A 2K3RA 5D1PA 5IP7I 1M1K2 2LFUA 1TWAI 2QKDA 3HKZA 1YJ9Z 4RVHA 3IF8A 3EERA 1N2FA 2P3YA 5D1OB 5IT9f 3CD6Z
chains in the Genus database with same CATH topology
5A2Qf 3I4MI 2PMZA 4NBGA 4E2WA 1ZH1A 2JA6I 3CMEZ 4NBBA 4A3FI 2B63I 2V8JA 4NH1C 3NH8A 3I551 3J80f 2M48A 2GTIA 1YIJ1 1USPA 1ZB9A 3BG0B 2W03A 3JAMf 1VQ8Z 1K9M1 5D1OA 3S16I 2R7ZI 2RIQA 3GCFA 4A3DI 1KD11 3CC21 1YI2Z 3S15I 3S1RI 3I4NI 3CPWZ 1ML8A 4A93I 1I6HI 1P9NA 2M6NA 1Q7Y2 1VQ5Z 1KD12 3H0GI 3EEDA 3NH4A 4A3GI 4RV9A 1TWCI 2IZ3A 3TE5B 3G6EZ 3S1NI 2DE6A 3NDIA 2WB1A 2G2KA 2VF1A 2K5RA 1VQ6Z 3Q87A 3VTNA 3KIFA 3G4S1 3G711 1QVGZ 3GTJI 3CCRZ 1X3WA 3S1QI 3GKQA 4A3KI 2E9HA 2QA41 1QVGY 3HOUI 2GU2A 1YI21 3GTPI 2V8IA 3CCM1 1WCMI 1M902 2W04A 1VQ51 2JR6A 1R9TI 4NBCA 2F4MA 2E2JI 4E2YA 2R6MA 3RZOI 3PO3S 2Y0SA 4QTTA 2JA5I 3D9XA 3CQZI 3FKII 3I55Z 2QLVB 3CCR1 1TFIA 3S2HI 4NBDA 4HH4A 1WIIA 4CL1A 1K732 4Y52I 1KRLA 2JA7I 5T67A 1VQ4Z 1JWHC 1Q812 2OTJZ 2E2HI 4NB8A 1YJNZ 2IZ4A 1TWFI 1KC81 2DE5A 1VQMZ 5FLXf 4HGZA 3CC2Z 4XX2A 2JMOA 1Q861 3J7A4 4MD7A 4E30A 4A3LI 1Z01A 1L1OC 3GTGI 3HOXI 1ZB8A 4A3EI 1S721 1X3ZA 1K83I 2QRCB 1Q862 3FQMA 3H3VJ 5C4JI 4A3II 2HU9A 1KQSZ 3G4SZ 3G71Z 3QWUA 2KI7B 2QREB 1VQ41 2V8KA 4RVGA 4BY7I 1Z03A 2BJOA 2OTJ1 2RBLA 4DQYB 1YJN1 3CC7Z 2AKLA 1KQSY 3S17I 3PO2I 1VQO1 3KIHA 1VQM1 5C44I 2QA4Z 3CXCZ 4E2ZA 3S2DI 2R93I 3F3PC 1K9M2 4A3BI 2Q4ZA 4NBFA 4E2XA 3CCEZ 2JUBA 1LQLA 3D6WA 5C3EI 2NVYI 3CCMZ 5CM2M 5AN9F 1YUAA 3CPWY 3HOZI 4RVDA 3CCQZ 2QR1B 1I3QI 2RHBA 4MRIA 3CCS1 4DGLA 1VLAA 1YUKA 3S14I 2JS4A 3CC4Z 3CC71 1S7MA 1YHQZ 1N8R1 3S1MI 4Y7NI 1RO0A 3CCE1 4DK1A 4BY1I 1K8A1 3M4OI 3VMHA 4A3MI 1W2BZ 1VQK1 4NFRA 3HOVI 4BXXI 3MZLB 2LIYA 3CCQ1 3GTMI 2RPRA 2ZAEB 1W2BY 3NDJA 2OZKA 1NUIA 5IP9I 1Y1VI 3OW2Z 5IT9b 3CMA1 2YADA 3CC41 1S72Z 1YHQ1 4NBHA 1VQP1 3OW2Y 2OOYB 2JA8I 1YJW1 3GTKI 1I50I 2RT9A 3ESWA 3FQQA 4MD9A 4AYBA 1TWHI 3J80b 1JJ2Z 2WAQA 3F3FC 1M1K1 1VQOZ 4E33A 1VQ71 3VMGA 1RO4A 3JAMb 4MH4A 3CCU1 5FLMI 3J81b 1JJ2Y 2E2II 1VQ91 4E31A 1PFTA 2O53A 1QVFZ 1TWGI 1KC82 1Y1WI 2NVXI 1VQN1 3IX0A 2OTL1 4TNUA 1RNIA 4EWCA 3MZKB 1QVFY 3I07A 1Q821 3CCSZ 2NVTI 2NVQI 3GTLI 4MONA 1YITZ 3CCJZ 3HOYI 3MONA 1Q822 4S1TA 1SFOI 2YU9I 4NBAA 2VUMI 4E32A 3CCV1 3NFZA 2QEX1 3J81f 3CXCY 3LUSA 1RO2A 4HGYA 1VQKZ 2I3CA 2J6AA 3BG1B 5T6BA 1YJ91 4RS4A 3CCLZ 1Q7Y1 2F4OA 2P28A 1QYPA 2KPIA 3T4NB 3CD61 1VQLZ 4RVFA 5C4XI 4BBSI 1WW9A 5LL6f 2EGTA 1YIT1 3CMAZ 3CCJ1 3CME1 3TDHB 1VQPZ 2VUGA 3VB9A 1YJWZ 3GTOI 1RLYA 2Q51A 1VQ81 2O4HA 2PM9A 1Z02A 4NBEA 3I56Z 3NH5A 3VMIA 4QTUA 3PO3I 1N8R2 1VQ7Z 2R92I 4X6AI 1NJI1 1M901 3CCL1 3CCUZ 2GTHA 2QRDB 4A3CI 3RZDI 1VQL1 1VQ9Z 2H85A 2HF1A 1K8A2 4MXUA 4BBRI 1VQNZ 5FLXb 1NJI2 2OTLZ 2PK7A 3K7AI 5A2Qb 3G6E1 3HOWI 1NP6A 2JNYA 5T64A 1K731 1VQ61 3U50C 3GTQI 1X0TA 3I561 3GTMS 2OOXB 1Q811 4A3JI 1DL6A 4MD8A 2DE7A 3P5JB 1QF8A 1YIJZ 3M3YI 1Y1VS 3CCVZ 1RQFA 3IFUA 2QEXZ 1USPB 4NOZA 4NB9A 2K3RA 5D1PA 5IP7I 1M1K2 2LFUA 1TWAI 2QKDA 3HKZA 1YJ9Z 4RVHA 3IF8A 3EERA 1N2FA 2P3YA 5D1OB 5IT9f 3CD6Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQK Z;  3I55 Z;  1YJ9 1;  3CCE 1;  3CCL Z;  1Q7Y 1;  3CCR 1;  1K8A 1;  3CD6 1;  1VQL Z;  3CME Z;  1W2B Z;  1VQK 1;  1K73 2;  3I55 1;  1VQ4 Z;  1YIT 1;  3CCQ 1;  1Q81 2;  3CMA Z;  1YIJ 1;  2OTJ Z;  3CCJ 1;  3CME 1;  1W2B Y;  1YJN Z;  1VQ8 Z;  1VQP Z;  1KC8 1;  1K9M 1;  1VQM Z;  3CC2 Z;  1Q86 1;  1YJW Z;  3OW2 Z;  3CMA 1;  3CC4 1;  1S72 Z;  1YHQ 1;  1VQ8 1;  1VQP 1;  1KD1 1;  3OW2 Y;  3I56 Z;  3CC2 1;  1YJW 1;  1N8R 2;  1VQ7 Z;  1NJI 1;  1YI2 Z;  1S72 1;  1M90 1;  3CCL 1;  1Q86 2;  3CPW Z;  3CCU Z;  1VQL 1;  1VQ9 Z;  1JJ2 Z;  1Q7Y 2;  1VQ5 Z;  1M1K 1;  1VQO Z;  1KD1 2;  1KQS Z;  1K8A 2;  1VQ7 1;  3G4S Z;  3G71 Z;  1VQ4 1;  3CCU 1;  3G6E Z;  2OTJ 1;  1JJ2 Y;  1VQN Z;  1VQ9 1;  1NJI 2;  2OTL Z;  1YJN 1;  3CC7 Z;  1KQS Y;  1VQO 1;  1VQ6 Z;  1VQM 1;  3G71 1;  3G4S 1;  2QA4 Z;  3CXC Z;  1QVF Z;  1QVG Z;  3G6E 1;  1KC8 2;  1K9M 2;  1VQN 1;  2OTL 1;  3CCE Z;  3CCR Z;  1K73 1;  1VQ6 1;  3CCM Z;  1QVF Y;  2QA4 1;  3I56 1;  1Q82 1;  1QVG Y;  3CCS Z;  1Q81 1;  1YI2 1;  3CPW Y;  1YIT Z;  3CCQ Z;  1YIJ Z;  3CCM 1;  3CCJ Z;  1M90 2;  1VQ5 1;  3CCS 1;  3CCV Z;  2QEX Z;  1Q82 2;  1M1K 2;  1YJ9 Z;  3CC4 Z;  3CC7 1;  1YHQ Z;  3CCV 1;  1N8R 1;  2QEX 1;  3CD6 Z;  3CXC Y; 
#chains in the Genus database with same CATH topology
 5A2Q f;  3I4M I;  2PMZ A;  4NBG A;  4E2W A;  1ZH1 A;  2JA6 I;  3CME Z;  4NBB A;  4A3F I;  2B63 I;  2V8J A;  4NH1 C;  3NH8 A;  3I55 1;  3J80 f;  2M48 A;  2GTI A;  1YIJ 1;  1USP A;  1ZB9 A;  3BG0 B;  2W03 A;  3JAM f;  1VQ8 Z;  1K9M 1;  5D1O A;  3S16 I;  2R7Z I;  2RIQ A;  3GCF A;  4A3D I;  1KD1 1;  3CC2 1;  1YI2 Z;  3S15 I;  3S1R I;  3I4N I;  3CPW Z;  1ML8 A;  4A93 I;  1I6H I;  1P9N A;  2M6N A;  1Q7Y 2;  1VQ5 Z;  1KD1 2;  3H0G I;  3EED A;  1FDI A;  3NH4 A;  4A3G I;  4RV9 A;  1TWC I;  2IZ3 A;  3TE5 B;  3G6E Z;  3S1N I;  2DE6 A;  3NDI A;  2WB1 A;  2G2K A;  2VF1 A;  2K5R A;  1VQ6 Z;  3Q87 A;  3VTN A;  3KIF A;  3G4S 1;  3G71 1;  1QVG Z;  3GTJ I;  3CCR Z;  1X3W A;  3S1Q I;  3GKQ A;  4A3K I;  2E9H A;  2QA4 1;  1QVG Y;  3HOU I;  2GU2 A;  1YI2 1;  3GTP I;  2V8I A;  3CCM 1;  1WCM I;  1M90 2;  2W04 A;  1VQ5 1;  2JR6 A;  1R9T I;  4NBC A;  2F4M A;  2E2J I;  4E2Y A;  2R6M A;  3RZO I;  3PO3 S;  2Y0S A;  4QTT A;  2JA5 I;  3D9X A;  3CQZ I;  3FKI I;  3I55 Z;  2QLV B;  3CCR 1;  1TFI A;  3S2H I;  4NBD A;  4HH4 A;  1WII A;  4CL1 A;  1K73 2;  4Y52 I;  1KRL A;  2JA7 I;  5T67 A;  1VQ4 Z;  1JWH C;  1Q81 2;  2OTJ Z;  2VPX A;  2E2H I;  4NB8 A;  1YJN Z;  2IZ4 A;  1TWF I;  1KC8 1;  2DE5 A;  1VQM Z;  5FLX f;  4HGZ A;  3CC2 Z;  4XX2 A;  2JMO A;  1Q86 1;  1SIW A;  3J7A 4;  4MD7 A;  4E30 A;  4A3L I;  1Z01 A;  1L1O C;  3GTG I;  3HOX I;  1ZB8 A;  4A3E I;  1S72 1;  1X3Z A;  1K83 I;  2QRC B;  1Q86 2;  3FQM A;  3H3V J;  5C4J I;  4A3I I;  2HU9 A;  1KQS Z;  3G4S Z;  3G71 Z;  3QWU A;  2KI7 B;  2QRE B;  1VQ4 1;  2V8K A;  4RVG A;  4BY7 I;  2LEX A;  2V45 A;  1Z03 A;  2BJO A;  2OTJ 1;  2RBL A;  4DQY B;  1YJN 1;  3CC7 Z;  2AKL A;  1KQS Y;  3S17 I;  3PO2 I;  1VQO 1;  3KIH A;  1VQM 1;  5C44 I;  2QA4 Z;  3CXC Z;  4E2Z A;  3S2D I;  2R93 I;  3F3P C;  1K9M 2;  4A3B I;  2Q4Z A;  4NBF A;  4E2X A;  3CCE Z;  2JUB A;  1LQL A;  3D6W A;  5C3E I;  2JIO A;  2NVY I;  3CCM Z;  5CM2 M;  5AN9 F;  1YUA A;  3CPW Y;  3HOZ I;  4RVD A;  3CCQ Z;  2QR1 B;  1I3Q I;  2RHB A;  4MRI A;  3CCS 1;  1WZN A;  4DGL A;  1VLA A;  1YUK A;  3S14 I;  2JS4 A;  3CC4 Z;  3CC7 1;  1S7M A;  1YHQ Z;  1N8R 1;  3S1M I;  4Y7N I;  1RO0 A;  3CCE 1;  4DK1 A;  4BY1 I;  1K8A 1;  3M4O I;  3VMH A;  4A3M I;  1W2B Z;  1VQK 1;  4NFR A;  3HOV I;  4BXX I;  3MZL B;  2LIY A;  3CCQ 1;  3GTM I;  2RPR A;  2VPZ A;  2ZAE B;  2JIQ A;  1W2B Y;  3NDJ A;  2OZK A;  1NUI A;  5IP9 I;  1Y1V I;  3OW2 Z;  5IT9 b;  3CMA 1;  2YAD A;  3CC4 1;  1S72 Z;  2V3V A;  1YHQ 1;  4NBH A;  1VQP 1;  3OW2 Y;  2OOY B;  2JA8 I;  1YJW 1;  3GTK I;  1I50 I;  2RT9 A;  3ESW A;  2JIP A;  3FQQ A;  4MD9 A;  4AYB A;  2NAP A;  1TWH I;  3J80 b;  1JJ2 Z;  2WAQ A;  3F3F C;  1M1K 1;  1VQO Z;  4E33 A;  1VQ7 1;  3VMG A;  3IR7 A;  1RO4 A;  3JAM b;  4MH4 A;  3CCU 1;  5FLM I;  3J81 b;  1JJ2 Y;  2E2I I;  1VQ9 1;  4E31 A;  1FDO A;  1PFT A;  2O53 A;  2VPY A;  1QVF Z;  1TWG I;  1KC8 2;  1Y1W I;  2NVX I;  1VQN 1;  3IX0 A;  1AA6 A;  2OTL 1;  4TNU A;  1RNI A;  4EWC A;  3MZK B;  1QVF Y;  3I07 A;  1Q82 1;  3CCS Z;  2NVT I;  2NVQ I;  3GTL I;  4MON A;  1YIT Z;  3CCJ Z;  3HOY I;  3MON A;  2VPW A;  1Q82 2;  4S1T A;  1SFO I;  2YU9 I;  4NBA A;  2VUM I;  4E32 A;  3CCV 1;  3NFZ A;  2QEX 1;  3J81 f;  3CXC Y;  3LUS A;  1RO2 A;  4HGY A;  2AYD A;  2JIM A;  1VQK Z;  2I3C A;  2J6A A;  3BG1 B;  5T6B A;  1YJ9 1;  4RS4 A;  3CCL Z;  1Q7Y 1;  2F4O A;  2P28 A;  1QYP A;  2KPI A;  3T4N B;  3CD6 1;  1VQL Z;  4RVF A;  5C4X I;  4BBS I;  1WW9 A;  5LL6 f;  2EGT A;  1YIT 1;  3CMA Z;  3CCJ 1;  3CME 1;  3TDH B;  1Y8C A;  1VQP Z;  2VUG A;  3VB9 A;  1YJW Z;  3GTO I;  1RLY A;  2JIR A;  2Q51 A;  1VQ8 1;  2O4H A;  2PM9 A;  1Z02 A;  4NBE A;  3I56 Z;  3NH5 A;  3VMI A;  4QTU A;  3PO3 I;  1N8R 2;  1VQ7 Z;  2R92 I;  4X6A I;  1NJI 1;  1M90 1;  3CCL 1;  3CCU Z;  2GTH A;  2QRD B;  4A3C I;  3RZD I;  1VQL 1;  1WJ2 A;  1VQ9 Z;  2H85 A;  2HF1 A;  1Q16 A;  1QXF A;  1K8A 2;  4MXU A;  4BBR I;  3D2L A;  1VQN Z;  5FLX b;  1NJI 2;  2OTL Z;  2PK7 A;  3K7A I;  5A2Q b;  3G6E 1;  3HOW I;  1NP6 A;  2E7Z A;  2JNY A;  5T64 A;  1K73 1;  1VQ6 1;  3U50 C;  3GTQ I;  1X0T A;  3I56 1;  3GTM S;  2OOX B;  1Q81 1;  4A3J I;  1DL6 A;  4MD8 A;  2DE7 A;  3P5J B;  1QF8 A;  2IV2 X;  1YIJ Z;  3M3Y I;  1Y1V S;  3CCV Z;  1RQF A;  3IFU A;  2QEX Z;  1USP B;  4NOZ A;  4NB9 A;  2K3R A;  5D1P A;  5IP7 I;  1M1K 2;  2LFU A;  1TWA I;  2QKD A;  3HKZ A;  1YJ9 Z;  4RVH A;  3IF8 A;  3EER A;  1N2F A;  2P3Y A;  5D1O B;  5IT9 f;  3CD6 Z; 
#chains in the Genus database with same CATH homology
 5A2Q f;  3I4M I;  2PMZ A;  4NBG A;  4E2W A;  1ZH1 A;  2JA6 I;  3CME Z;  4NBB A;  4A3F I;  2B63 I;  2V8J A;  4NH1 C;  3NH8 A;  3I55 1;  3J80 f;  2M48 A;  2GTI A;  1YIJ 1;  1USP A;  1ZB9 A;  3BG0 B;  2W03 A;  3JAM f;  1VQ8 Z;  1K9M 1;  5D1O A;  3S16 I;  2R7Z I;  2RIQ A;  3GCF A;  4A3D I;  1KD1 1;  3CC2 1;  1YI2 Z;  3S15 I;  3S1R I;  3I4N I;  3CPW Z;  1ML8 A;  4A93 I;  1I6H I;  1P9N A;  2M6N A;  1Q7Y 2;  1VQ5 Z;  1KD1 2;  3H0G I;  3EED A;  3NH4 A;  4A3G I;  4RV9 A;  1TWC I;  2IZ3 A;  3TE5 B;  3G6E Z;  3S1N I;  2DE6 A;  3NDI A;  2WB1 A;  2G2K A;  2VF1 A;  2K5R A;  1VQ6 Z;  3Q87 A;  3VTN A;  3KIF A;  3G4S 1;  3G71 1;  1QVG Z;  3GTJ I;  3CCR Z;  1X3W A;  3S1Q I;  3GKQ A;  4A3K I;  2E9H A;  2QA4 1;  1QVG Y;  3HOU I;  2GU2 A;  1YI2 1;  3GTP I;  2V8I A;  3CCM 1;  1WCM I;  1M90 2;  2W04 A;  1VQ5 1;  2JR6 A;  1R9T I;  4NBC A;  2F4M A;  2E2J I;  4E2Y A;  2R6M A;  3RZO I;  3PO3 S;  2Y0S A;  4QTT A;  2JA5 I;  3D9X A;  3CQZ I;  3FKI I;  3I55 Z;  2QLV B;  3CCR 1;  1TFI A;  3S2H I;  4NBD A;  4HH4 A;  1WII A;  4CL1 A;  1K73 2;  4Y52 I;  1KRL A;  2JA7 I;  5T67 A;  1VQ4 Z;  1JWH C;  1Q81 2;  2OTJ Z;  2E2H I;  4NB8 A;  1YJN Z;  2IZ4 A;  1TWF I;  1KC8 1;  2DE5 A;  1VQM Z;  5FLX f;  4HGZ A;  3CC2 Z;  4XX2 A;  2JMO A;  1Q86 1;  3J7A 4;  4MD7 A;  4E30 A;  4A3L I;  1Z01 A;  1L1O C;  3GTG I;  3HOX I;  1ZB8 A;  4A3E I;  1S72 1;  1X3Z A;  1K83 I;  2QRC B;  1Q86 2;  3FQM A;  3H3V J;  5C4J I;  4A3I I;  2HU9 A;  1KQS Z;  3G4S Z;  3G71 Z;  3QWU A;  2KI7 B;  2QRE B;  1VQ4 1;  2V8K A;  4RVG A;  4BY7 I;  1Z03 A;  2BJO A;  2OTJ 1;  2RBL A;  4DQY B;  1YJN 1;  3CC7 Z;  2AKL A;  1KQS Y;  3S17 I;  3PO2 I;  1VQO 1;  3KIH A;  1VQM 1;  5C44 I;  2QA4 Z;  3CXC Z;  4E2Z A;  3S2D I;  2R93 I;  3F3P C;  1K9M 2;  4A3B I;  2Q4Z A;  4NBF A;  4E2X A;  3CCE Z;  2JUB A;  1LQL A;  3D6W A;  5C3E I;  2NVY I;  3CCM Z;  5CM2 M;  5AN9 F;  1YUA A;  3CPW Y;  3HOZ I;  4RVD A;  3CCQ Z;  2QR1 B;  1I3Q I;  2RHB A;  4MRI A;  3CCS 1;  4DGL A;  1VLA A;  1YUK A;  3S14 I;  2JS4 A;  3CC4 Z;  3CC7 1;  1S7M A;  1YHQ Z;  1N8R 1;  3S1M I;  4Y7N I;  1RO0 A;  3CCE 1;  4DK1 A;  4BY1 I;  1K8A 1;  3M4O I;  3VMH A;  4A3M I;  1W2B Z;  1VQK 1;  4NFR A;  3HOV I;  4BXX I;  3MZL B;  2LIY A;  3CCQ 1;  3GTM I;  2RPR A;  2ZAE B;  1W2B Y;  3NDJ A;  2OZK A;  1NUI A;  5IP9 I;  1Y1V I;  3OW2 Z;  5IT9 b;  3CMA 1;  2YAD A;  3CC4 1;  1S72 Z;  1YHQ 1;  4NBH A;  1VQP 1;  3OW2 Y;  2OOY B;  2JA8 I;  1YJW 1;  3GTK I;  1I50 I;  2RT9 A;  3ESW A;  3FQQ A;  4MD9 A;  4AYB A;  1TWH I;  3J80 b;  1JJ2 Z;  2WAQ A;  3F3F C;  1M1K 1;  1VQO Z;  4E33 A;  1VQ7 1;  3VMG A;  1RO4 A;  3JAM b;  4MH4 A;  3CCU 1;  5FLM I;  3J81 b;  1JJ2 Y;  2E2I I;  1VQ9 1;  4E31 A;  1PFT A;  2O53 A;  1QVF Z;  1TWG I;  1KC8 2;  1Y1W I;  2NVX I;  1VQN 1;  3IX0 A;  2OTL 1;  4TNU A;  1RNI A;  4EWC A;  3MZK B;  1QVF Y;  3I07 A;  1Q82 1;  3CCS Z;  2NVT I;  2NVQ I;  3GTL I;  4MON A;  1YIT Z;  3CCJ Z;  3HOY I;  3MON A;  1Q82 2;  4S1T A;  1SFO I;  2YU9 I;  4NBA A;  2VUM I;  4E32 A;  3CCV 1;  3NFZ A;  2QEX 1;  3J81 f;  3CXC Y;  3LUS A;  1RO2 A;  4HGY A;  1VQK Z;  2I3C A;  2J6A A;  3BG1 B;  5T6B A;  1YJ9 1;  4RS4 A;  3CCL Z;  1Q7Y 1;  2F4O A;  2P28 A;  1QYP A;  2KPI A;  3T4N B;  3CD6 1;  1VQL Z;  4RVF A;  5C4X I;  4BBS I;  1WW9 A;  5LL6 f;  2EGT A;  1YIT 1;  3CMA Z;  3CCJ 1;  3CME 1;  3TDH B;  1VQP Z;  2VUG A;  3VB9 A;  1YJW Z;  3GTO I;  1RLY A;  2Q51 A;  1VQ8 1;  2O4H A;  2PM9 A;  1Z02 A;  4NBE A;  3I56 Z;  3NH5 A;  3VMI A;  4QTU A;  3PO3 I;  1N8R 2;  1VQ7 Z;  2R92 I;  4X6A I;  1NJI 1;  1M90 1;  3CCL 1;  3CCU Z;  2GTH A;  2QRD B;  4A3C I;  3RZD I;  1VQL 1;  1VQ9 Z;  2H85 A;  2HF1 A;  1K8A 2;  4MXU A;  4BBR I;  1VQN Z;  5FLX b;  1NJI 2;  2OTL Z;  2PK7 A;  3K7A I;  5A2Q b;  3G6E 1;  3HOW I;  1NP6 A;  2JNY A;  5T64 A;  1K73 1;  1VQ6 1;  3U50 C;  3GTQ I;  1X0T A;  3I56 1;  3GTM S;  2OOX B;  1Q81 1;  4A3J I;  1DL6 A;  4MD8 A;  2DE7 A;  3P5J B;  1QF8 A;  1YIJ Z;  3M3Y I;  1Y1V S;  3CCV Z;  1RQF A;  3IFU A;  2QEX Z;  1USP B;  4NOZ A;  4NB9 A;  2K3R A;  5D1P A;  5IP7 I;  1M1K 2;  2LFU A;  1TWA I;  2QKD A;  3HKZ A;  1YJ9 Z;  4RVH A;  3IF8 A;  3EER A;  1N2F A;  2P3Y A;  5D1O B;  5IT9 f;  3CD6 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...