5A2Qf

Structure of the hcv ires bound to the human ribosome
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
72
structure length
72
Chain Sequence
KKRKKKSCTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ribosome
molecule keywords 18S RRNA
publication title Cryo-Em Structure of Hepatitis C Virus Ires Bound to the Human Ribosome at 3.9 Angstrom Resolution
pubmed doi rcsb
total genus 5
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF01599 Ribosomal_S27 Ribosomal protein S27a
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.660 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5a2qf00
3JAMf 5IT9f 3J81f 5A2Qf 3J80f 5FLXf
chains in the Genus database with same CATH superfamily
1RQFA 2VPZA 1S72Z 1VQPZ 1N8R2 1VQNZ 4HH4A 2DE6A 1Q822 4A3CI 2R92I 1L1OC 2NAPA 2W04A 1RNIA 2VPXA 3CCLZ 4NBGA 3OW2Z 3D9XA 4A93I 2M48A 4MONA 2JR6A 2EGTA 3CCU1 5CM2M 3I4NI 1ZH1A 4A3II 1KD11 3CPWY 3S2HI 3IFUA 1YJNZ 1USPB 4S1TA 3NH8A 1KRLA 1USPA 3CC4Z 1VQ6Z 1KD12 3GTMS 3CCJ1 3CCM1 3GTOI 3CC71 1Q811 3CD6Z 1VQ41 4E33A 1YI21 2RIQA 2RBLA 3U50C 1Q812 2J6AA 4NBDA 3S1RI 3J81b 5A2Qb 4NOZA 2OTL1 3I561 1M901 3M3YI 2JIOA 3VB9A 3P5JB 1K732 4BBRI 5C44I 4XX2A 1S7MA 1M902 2PK7A 3I55Z 4NH1C 1QYPA 3CCSZ 5D1PA 2OTJZ 4Y52I 3VMIA 3CCEZ 3HOUI 3CXCY 1Z02A 4RVDA 1QVFZ 3F3FC 2E2HI 2G2KA 3HOZI 4DK1A 3RZOI 3G71Z 3KIFA 1KQSZ 1YIJ1 2AKLA 2Q4ZA 1VQ9Z 3GTKI 3MZKB 1YUAA 3CCRZ 1VQ5Z 2F4MA 3CCVZ 1K83I 1VQK1 1YJW1 3S15I 4CL1A 2R6MA 3HKZA 3CMA1 3VMGA 5IT9f 4BY1I 2JA7I 5T67A 3KIHA 4MD7A 3S17I 2GTIA 4MD9A 3IF8A 2DE7A 1YJ9Z 1R9TI 1WCMI 4NBEA 1QVGZ 3D2LA 4NB8A 4RVHA 5FLMI 5IT9b 3S14I 2R93I 3CME1 2LEXA 1RO2A 3H0GI 2F4OA 1VQ81 1Q821 2QKDA 3RZDI 3T4NB 3G6E1 1X0TA 4A3MI 1W2BZ 1SIWA 1W2BY 1ML8A 3H3VJ 4BBSI 2M6NA 3GCFA 3HOXI 4NBAA 1TFIA 4BY7I 1WJ2A 2JUBA 3S1MI 1S721 1ZB9A 4DGLA 1VQP1 1YUKA 2DE5A 1VQN1 3NH5A 1Q861 3GTPI 2VPYA 3CPWZ 3J81f 5A2Qf 1K9M1 3HOVI 4E2WA 1Q862 2JA8I 4NBBA 5T6BA 1Q16A 3MONA 3BG1B 2GU2A 3CCL1 1K9M2 1P9NA 1RO4A 1JJ2Y 2O53A 2YADA 1TWAI 3J80f 1WW9A 1YITZ 1I6HI 1YJN1 4BXXI 4AYBA 1K731 2KPIA 2QREB 3CC41 1VQ61 2K3RA 3CD61 1TWFI 1NJI1 5AN9F 2LIYA 3VMHA 3J80b 3HOWI 1NJI2 2WAQA 2QEXZ 2LFUA 3LUSA 1VQLZ 3CXCZ 5T64A 3GKQA 1QF8A 5C4JI 3S1QI 4E31A 3I551 1Y1VI 3QWUA 4TNUA 3I4MI 3TE5B 3IR7A 3CCS1 1VQMZ 2V8IA 2I3CA 2OTJ1 3CCE1 1VQOZ 2R7ZI 1Y1WI 5IP9I 5C3EI 1X3WA 3K7AI 2JA5I 2YU9I 3CC2Z 1K8A1 3GTQI 3I07A 2ZAEB 4A3DI 3JAMb 4HGYA 2HF1A 4MH4A 1YHQZ 1K8A2 1FDOA 2Q51A 3BG0B 3G711 1WZNA 3PO3S 1NUIA 1Y8CA 2PMZA 1VQ91 1NP6A 2QLVB 3PO2I 1Z03A 2VUGA 3IX0A 2QA4Z 1KC81 3CCR1 1VQ51 4NBFA 2RHBA 1N2FA 2JS4A 3G4SZ 3CCV1 4A3GI 1YHQ1 3NDIA 1LQLA 1KC82 2QRDB 4A3BI 5C4XI 1JWHC 3GTGI 4A3FI 2V8JA 2WB1A 1X3ZA 4NBCA 1VQ7Z 4NBHA 3FKII 4RVGA 3TDHB 1YJ91 2B63I 1PFTA 2QR1B 2E2JI 3PO3I 2E2II 3NH4A 2OOYB 4DQYB 4E2YA 4E2ZA 3S16I 1QXFA 3FQQA 2JMOA 4RV9A 1WIIA 3EEDA 2JIRA 2AYDA 2IZ4A 1Q7Y1 1DL6A 2BJOA 4NFRA 1VLAA 2H85A 4E32A 3CCUZ 4RS4A 2P28A 1Q7Y2 4EWCA 2RT9A 1Y1VS 3M4OI 1JJ2Z 3CCJZ 3CCMZ 2E9HA 2OOXB 3CC7Z 1VQ4Z 3OW2Y 2JIQA 2GTHA 2IZ3A 2KI7B 1YI2Z 2QRCB 2OZKA 2NVYI 2E7ZA 2OTLZ 3I56Z 3VTNA 4MD8A 2VUMI 1YIT1 1I50I 1ZB8A 1I3QI 3MZLB 4E30A 2V8KA 4MXUA 2V45A 3GTJI 5IP7I 3J7A4 4X6AI 3CQZI 4HGZA 1FDIA 3JAMf 2RPRA 2NVXI 3HOYI 2JIMA 3NFZA 2QEX1 1VQL1 3NDJA 2W03A 5FLXf 1TWHI 4A3EI 1M1K1 1YIJZ 3EERA 1Z01A 3S1NI 3ESWA 1VQM1 3D6WA 3GTMI 1M1K2 1QVFY 4QTTA 2JIPA 2Y0SA 1VQO1 1VQKZ 1YJWZ 2K5RA 2V3VA 5FLXb 2JA6I 1KQSY 1TWGI 3CC21 3CCQZ 3CMAZ 2IV2X 2HU9A 4MRIA 3GTLI 3S2DI 4Y7NI 2NVTI 5D1OB 3FQMA 4RVFA 1RO0A 5D1OA 2VPWA 4A3LI 1RLYA 3F3PC 1AA6A 4A3KI 2P3YA 4A3JI 3CCQ1 2VF1A 2QA41 3G4S1 2PM9A 3CMEZ 4E2XA 1SFOI 4NB9A 2JNYA 1VQ8Z 2O4HA 3G6EZ 5LL6f 4QTUA 2NVQI 1QVGY 1VQ71 3Q87A 1TWCI 1N8R1
chains in the Genus database with same CATH topology
1RQFA 1S72Z 1VQPZ 1N8R2 1VQNZ 4HH4A 2DE6A 1Q822 4A3CI 2R92I 1L1OC 2W04A 1RNIA 3CCLZ 4NBGA 3OW2Z 3D9XA 4A93I 2M48A 4MONA 2JR6A 2EGTA 3CCU1 5CM2M 3I4NI 1ZH1A 4A3II 1KD11 3CPWY 3S2HI 3IFUA 1YJNZ 1USPB 4S1TA 3NH8A 1KRLA 1USPA 3CC4Z 1VQ6Z 1KD12 3GTMS 3CCJ1 3CCM1 3GTOI 3CC71 1Q811 3CD6Z 1VQ41 4E33A 1YI21 2RIQA 2RBLA 3U50C 1Q812 2J6AA 4NBDA 3S1RI 3J81b 5A2Qb 4NOZA 2OTL1 3I561 1M901 3M3YI 3VB9A 3P5JB 1K732 4BBRI 5C44I 4XX2A 1S7MA 1M902 2PK7A 3I55Z 4NH1C 1QYPA 3CCSZ 5D1PA 2OTJZ 4Y52I 3VMIA 3CCEZ 3HOUI 3CXCY 1Z02A 4RVDA 1QVFZ 3F3FC 2E2HI 2G2KA 3HOZI 4DK1A 3RZOI 3G71Z 3KIFA 1KQSZ 1YIJ1 2AKLA 2Q4ZA 1VQ9Z 3GTKI 3MZKB 1YUAA 3CCRZ 1VQ5Z 2F4MA 3CCVZ 1K83I 1VQK1 1YJW1 3S15I 4CL1A 2R6MA 3HKZA 3CMA1 3VMGA 5IT9f 4BY1I 2JA7I 5T67A 3KIHA 4MD7A 3S17I 2GTIA 4MD9A 3IF8A 2DE7A 1YJ9Z 1R9TI 1WCMI 4NBEA 1QVGZ 4NB8A 4RVHA 5FLMI 5IT9b 3S14I 2R93I 3CME1 1RO2A 3H0GI 2F4OA 1VQ81 1Q821 2QKDA 3RZDI 3T4NB 3G6E1 1X0TA 4A3MI 1W2BZ 1W2BY 1ML8A 3H3VJ 4BBSI 2M6NA 3GCFA 3HOXI 4NBAA 1TFIA 4BY7I 2JUBA 3S1MI 1S721 1ZB9A 4DGLA 1VQP1 1YUKA 2DE5A 1VQN1 3NH5A 1Q861 3GTPI 3CPWZ 3J81f 5A2Qf 1K9M1 3HOVI 4E2WA 1Q862 2JA8I 4NBBA 5T6BA 3MONA 3BG1B 2GU2A 3CCL1 1K9M2 1P9NA 1RO4A 1JJ2Y 2O53A 2YADA 1TWAI 3J80f 1WW9A 1YITZ 1I6HI 1YJN1 4BXXI 4AYBA 1K731 2KPIA 2QREB 3CC41 1VQ61 2K3RA 3CD61 1TWFI 1NJI1 5AN9F 2LIYA 3VMHA 3J80b 3HOWI 1NJI2 2WAQA 2QEXZ 2LFUA 3LUSA 1VQLZ 3CXCZ 5T64A 3GKQA 1QF8A 5C4JI 3S1QI 4E31A 3I551 1Y1VI 3QWUA 4TNUA 3I4MI 3TE5B 3CCS1 1VQMZ 2V8IA 2I3CA 2OTJ1 3CCE1 1VQOZ 2R7ZI 1Y1WI 5IP9I 5C3EI 1X3WA 3K7AI 2JA5I 2YU9I 3CC2Z 1K8A1 3GTQI 3I07A 2ZAEB 4A3DI 3JAMb 4HGYA 2HF1A 4MH4A 1YHQZ 1K8A2 3BG0B 2Q51A 3G711 3PO3S 1NUIA 2PMZA 1VQ91 1NP6A 2QLVB 3PO2I 1Z03A 2VUGA 3IX0A 2QA4Z 1KC81 1VQ51 3CCR1 4NBFA 2RHBA 1N2FA 2JS4A 3G4SZ 3CCV1 4A3GI 1YHQ1 3NDIA 1LQLA 1KC82 2QRDB 4A3BI 5C4XI 1JWHC 3GTGI 4A3FI 2V8JA 2WB1A 1X3ZA 4NBCA 1VQ7Z 4NBHA 3FKII 4RVGA 3TDHB 1YJ91 2B63I 1PFTA 2QR1B 2E2JI 3PO3I 2E2II 3NH4A 2OOYB 4DQYB 4E2YA 4E2ZA 3S16I 3FQQA 2JMOA 4RV9A 1WIIA 3EEDA 2IZ4A 1Q7Y1 1DL6A 2BJOA 4NFRA 1VLAA 2H85A 4E32A 3CCUZ 4RS4A 2P28A 1Q7Y2 4EWCA 2RT9A 1Y1VS 3M4OI 1JJ2Z 3CCJZ 3CCMZ 2E9HA 2OOXB 3CC7Z 1VQ4Z 3OW2Y 2GTHA 2IZ3A 2KI7B 1YI2Z 2QRCB 2OZKA 2NVYI 2OTLZ 3I56Z 3VTNA 4MD8A 2VUMI 1YIT1 1I50I 1ZB8A 1I3QI 3MZLB 4E30A 2V8KA 4MXUA 3GTJI 5IP7I 3J7A4 4X6AI 3CQZI 4HGZA 3JAMf 2RPRA 2NVXI 3HOYI 3NFZA 2QEX1 1VQL1 3NDJA 2W03A 5FLXf 1TWHI 4A3EI 1M1K1 1YIJZ 3EERA 1Z01A 3S1NI 3ESWA 1VQM1 3D6WA 3GTMI 1M1K2 1QVFY 4QTTA 2Y0SA 1VQO1 1VQKZ 1YJWZ 2K5RA 5FLXb 2JA6I 1KQSY 1TWGI 3CC21 3CCQZ 3CMAZ 2HU9A 4MRIA 3GTLI 3S2DI 4Y7NI 2NVTI 5D1OB 3FQMA 4RVFA 1RO0A 5D1OA 4A3LI 1RLYA 3F3PC 4A3KI 2P3YA 4A3JI 3CCQ1 2VF1A 2QA41 3G4S1 2PM9A 3CMEZ 4E2XA 1SFOI 4NB9A 2JNYA 1VQ8Z 2O4HA 3G6EZ 5LL6f 4QTUA 2NVQI 1QVGY 1VQ71 3Q87A 1TWCI 1N8R1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAM f;  5IT9 f;  3J81 f;  5A2Q f;  3J80 f;  5FLX f; 
#chains in the Genus database with same CATH topology
 1RQF A;  2VPZ A;  1S72 Z;  1VQP Z;  1N8R 2;  1VQN Z;  4HH4 A;  2DE6 A;  1Q82 2;  4A3C I;  2R92 I;  1L1O C;  2NAP A;  2W04 A;  1RNI A;  2VPX A;  3CCL Z;  4NBG A;  3OW2 Z;  3D9X A;  4A93 I;  2M48 A;  4MON A;  2JR6 A;  2EGT A;  3CCU 1;  5CM2 M;  3I4N I;  1ZH1 A;  4A3I I;  1KD1 1;  3CPW Y;  3S2H I;  3IFU A;  1YJN Z;  1USP B;  4S1T A;  3NH8 A;  1KRL A;  1USP A;  3CC4 Z;  1VQ6 Z;  1KD1 2;  3GTM S;  3CCJ 1;  3CCM 1;  3GTO I;  3CC7 1;  1Q81 1;  3CD6 Z;  1VQ4 1;  4E33 A;  1YI2 1;  2RIQ A;  2RBL A;  3U50 C;  1Q81 2;  2J6A A;  4NBD A;  3S1R I;  3J81 b;  5A2Q b;  4NOZ A;  2OTL 1;  3I56 1;  1M90 1;  3M3Y I;  2JIO A;  3VB9 A;  3P5J B;  1K73 2;  4BBR I;  5C44 I;  4XX2 A;  1S7M A;  1M90 2;  2PK7 A;  3I55 Z;  4NH1 C;  1QYP A;  3CCS Z;  5D1P A;  2OTJ Z;  4Y52 I;  3VMI A;  3CCE Z;  3HOU I;  3CXC Y;  1Z02 A;  4RVD A;  1QVF Z;  3F3F C;  2E2H I;  2G2K A;  3HOZ I;  4DK1 A;  3RZO I;  3G71 Z;  3KIF A;  1KQS Z;  1YIJ 1;  2AKL A;  2Q4Z A;  1VQ9 Z;  3GTK I;  3MZK B;  1YUA A;  3CCR Z;  1VQ5 Z;  2F4M A;  3CCV Z;  1K83 I;  1VQK 1;  1YJW 1;  3S15 I;  4CL1 A;  2R6M A;  3HKZ A;  3CMA 1;  3VMG A;  5IT9 f;  4BY1 I;  2JA7 I;  5T67 A;  3KIH A;  4MD7 A;  3S17 I;  2GTI A;  4MD9 A;  3IF8 A;  2DE7 A;  1YJ9 Z;  1R9T I;  1WCM I;  4NBE A;  1QVG Z;  3D2L A;  4NB8 A;  4RVH A;  5FLM I;  5IT9 b;  3S14 I;  2R93 I;  3CME 1;  2LEX A;  1RO2 A;  3H0G I;  2F4O A;  1VQ8 1;  1Q82 1;  2QKD A;  3RZD I;  3T4N B;  3G6E 1;  1X0T A;  4A3M I;  1W2B Z;  1SIW A;  1W2B Y;  1ML8 A;  3H3V J;  4BBS I;  2M6N A;  3GCF A;  3HOX I;  4NBA A;  1TFI A;  4BY7 I;  1WJ2 A;  2JUB A;  3S1M I;  1S72 1;  1ZB9 A;  4DGL A;  1VQP 1;  1YUK A;  2DE5 A;  1VQN 1;  3NH5 A;  1Q86 1;  3GTP I;  2VPY A;  3CPW Z;  3J81 f;  5A2Q f;  1K9M 1;  3HOV I;  4E2W A;  1Q86 2;  2JA8 I;  4NBB A;  5T6B A;  1Q16 A;  3MON A;  3BG1 B;  2GU2 A;  3CCL 1;  1K9M 2;  1P9N A;  1RO4 A;  1JJ2 Y;  2O53 A;  2YAD A;  1TWA I;  3J80 f;  1WW9 A;  1YIT Z;  1I6H I;  1YJN 1;  4BXX I;  4AYB A;  1K73 1;  2KPI A;  2QRE B;  3CC4 1;  1VQ6 1;  2K3R A;  3CD6 1;  1TWF I;  1NJI 1;  5AN9 F;  2LIY A;  3VMH A;  3J80 b;  3HOW I;  1NJI 2;  2WAQ A;  2QEX Z;  2LFU A;  3LUS A;  1VQL Z;  3CXC Z;  5T64 A;  3GKQ A;  1QF8 A;  5C4J I;  3S1Q I;  4E31 A;  3I55 1;  1Y1V I;  3QWU A;  4TNU A;  3I4M I;  3TE5 B;  3IR7 A;  3CCS 1;  1VQM Z;  2V8I A;  2I3C A;  2OTJ 1;  3CCE 1;  1VQO Z;  2R7Z I;  1Y1W I;  5IP9 I;  5C3E I;  1X3W A;  3K7A I;  2JA5 I;  2YU9 I;  3CC2 Z;  1K8A 1;  3GTQ I;  3I07 A;  2ZAE B;  4A3D I;  3JAM b;  4HGY A;  2HF1 A;  4MH4 A;  1YHQ Z;  1K8A 2;  1FDO A;  2Q51 A;  3BG0 B;  3G71 1;  1WZN A;  3PO3 S;  1NUI A;  1Y8C A;  2PMZ A;  1VQ9 1;  1NP6 A;  2QLV B;  3PO2 I;  1Z03 A;  2VUG A;  3IX0 A;  2QA4 Z;  1KC8 1;  3CCR 1;  1VQ5 1;  4NBF A;  2RHB A;  1N2F A;  2JS4 A;  3G4S Z;  3CCV 1;  4A3G I;  1YHQ 1;  3NDI A;  1LQL A;  1KC8 2;  2QRD B;  4A3B I;  5C4X I;  1JWH C;  3GTG I;  4A3F I;  2V8J A;  2WB1 A;  1X3Z A;  4NBC A;  1VQ7 Z;  4NBH A;  3FKI I;  4RVG A;  3TDH B;  1YJ9 1;  2B63 I;  1PFT A;  2QR1 B;  2E2J I;  3PO3 I;  2E2I I;  3NH4 A;  2OOY B;  4DQY B;  4E2Y A;  4E2Z A;  3S16 I;  1QXF A;  3FQQ A;  2JMO A;  4RV9 A;  1WII A;  3EED A;  2JIR A;  2AYD A;  2IZ4 A;  1Q7Y 1;  1DL6 A;  2BJO A;  4NFR A;  1VLA A;  2H85 A;  4E32 A;  3CCU Z;  4RS4 A;  2P28 A;  1Q7Y 2;  4EWC A;  2RT9 A;  1Y1V S;  3M4O I;  1JJ2 Z;  3CCJ Z;  3CCM Z;  2E9H A;  2OOX B;  3CC7 Z;  1VQ4 Z;  3OW2 Y;  2JIQ A;  2GTH A;  2IZ3 A;  2KI7 B;  1YI2 Z;  2QRC B;  2OZK A;  2NVY I;  2E7Z A;  2OTL Z;  3I56 Z;  3VTN A;  4MD8 A;  2VUM I;  1YIT 1;  1I50 I;  1ZB8 A;  1I3Q I;  3MZL B;  4E30 A;  2V8K A;  4MXU A;  2V45 A;  3GTJ I;  5IP7 I;  3J7A 4;  4X6A I;  3CQZ I;  4HGZ A;  1FDI A;  3JAM f;  2RPR A;  2NVX I;  3HOY I;  2JIM A;  3NFZ A;  2QEX 1;  1VQL 1;  3NDJ A;  2W03 A;  5FLX f;  1TWH I;  4A3E I;  1M1K 1;  1YIJ Z;  3EER A;  1Z01 A;  3S1N I;  3ESW A;  1VQM 1;  3D6W A;  3GTM I;  1M1K 2;  1QVF Y;  4QTT A;  2JIP A;  2Y0S A;  1VQO 1;  1VQK Z;  1YJW Z;  2K5R A;  2V3V A;  5FLX b;  2JA6 I;  1KQS Y;  1TWG I;  3CC2 1;  3CCQ Z;  3CMA Z;  2IV2 X;  2HU9 A;  4MRI A;  3GTL I;  3S2D I;  4Y7N I;  2NVT I;  5D1O B;  3FQM A;  4RVF A;  1RO0 A;  5D1O A;  2VPW A;  4A3L I;  1RLY A;  3F3P C;  1AA6 A;  4A3K I;  2P3Y A;  4A3J I;  3CCQ 1;  2VF1 A;  2QA4 1;  3G4S 1;  2PM9 A;  3CME Z;  4E2X A;  1SFO I;  4NB9 A;  2JNY A;  1VQ8 Z;  2O4H A;  3G6E Z;  5LL6 f;  4QTU A;  2NVQ I;  1QVG Y;  1VQ7 1;  3Q87 A;  1TWC I;  1N8R 1; 
#chains in the Genus database with same CATH homology
 1RQF A;  1S72 Z;  1VQP Z;  1N8R 2;  1VQN Z;  4HH4 A;  2DE6 A;  1Q82 2;  4A3C I;  2R92 I;  1L1O C;  2W04 A;  1RNI A;  3CCL Z;  4NBG A;  3OW2 Z;  3D9X A;  4A93 I;  2M48 A;  4MON A;  2JR6 A;  2EGT A;  3CCU 1;  5CM2 M;  3I4N I;  1ZH1 A;  4A3I I;  1KD1 1;  3CPW Y;  3S2H I;  3IFU A;  1YJN Z;  1USP B;  4S1T A;  3NH8 A;  1KRL A;  1USP A;  3CC4 Z;  1VQ6 Z;  1KD1 2;  3GTM S;  3CCJ 1;  3CCM 1;  3GTO I;  3CC7 1;  1Q81 1;  3CD6 Z;  1VQ4 1;  4E33 A;  1YI2 1;  2RIQ A;  2RBL A;  3U50 C;  1Q81 2;  2J6A A;  4NBD A;  3S1R I;  3J81 b;  5A2Q b;  4NOZ A;  2OTL 1;  3I56 1;  1M90 1;  3M3Y I;  3VB9 A;  3P5J B;  1K73 2;  4BBR I;  5C44 I;  4XX2 A;  1S7M A;  1M90 2;  2PK7 A;  3I55 Z;  4NH1 C;  1QYP A;  3CCS Z;  5D1P A;  2OTJ Z;  4Y52 I;  3VMI A;  3CCE Z;  3HOU I;  3CXC Y;  1Z02 A;  4RVD A;  1QVF Z;  3F3F C;  2E2H I;  2G2K A;  3HOZ I;  4DK1 A;  3RZO I;  3G71 Z;  3KIF A;  1KQS Z;  1YIJ 1;  2AKL A;  2Q4Z A;  1VQ9 Z;  3GTK I;  3MZK B;  1YUA A;  3CCR Z;  1VQ5 Z;  2F4M A;  3CCV Z;  1K83 I;  1VQK 1;  1YJW 1;  3S15 I;  4CL1 A;  2R6M A;  3HKZ A;  3CMA 1;  3VMG A;  5IT9 f;  4BY1 I;  2JA7 I;  5T67 A;  3KIH A;  4MD7 A;  3S17 I;  2GTI A;  4MD9 A;  3IF8 A;  2DE7 A;  1YJ9 Z;  1R9T I;  1WCM I;  4NBE A;  1QVG Z;  4NB8 A;  4RVH A;  5FLM I;  5IT9 b;  3S14 I;  2R93 I;  3CME 1;  1RO2 A;  3H0G I;  2F4O A;  1VQ8 1;  1Q82 1;  2QKD A;  3RZD I;  3T4N B;  3G6E 1;  1X0T A;  4A3M I;  1W2B Z;  1W2B Y;  1ML8 A;  3H3V J;  4BBS I;  2M6N A;  3GCF A;  3HOX I;  4NBA A;  1TFI A;  4BY7 I;  2JUB A;  3S1M I;  1S72 1;  1ZB9 A;  4DGL A;  1VQP 1;  1YUK A;  2DE5 A;  1VQN 1;  3NH5 A;  1Q86 1;  3GTP I;  3CPW Z;  3J81 f;  5A2Q f;  1K9M 1;  3HOV I;  4E2W A;  1Q86 2;  2JA8 I;  4NBB A;  5T6B A;  3MON A;  3BG1 B;  2GU2 A;  3CCL 1;  1K9M 2;  1P9N A;  1RO4 A;  1JJ2 Y;  2O53 A;  2YAD A;  1TWA I;  3J80 f;  1WW9 A;  1YIT Z;  1I6H I;  1YJN 1;  4BXX I;  4AYB A;  1K73 1;  2KPI A;  2QRE B;  3CC4 1;  1VQ6 1;  2K3R A;  3CD6 1;  1TWF I;  1NJI 1;  5AN9 F;  2LIY A;  3VMH A;  3J80 b;  3HOW I;  1NJI 2;  2WAQ A;  2QEX Z;  2LFU A;  3LUS A;  1VQL Z;  3CXC Z;  5T64 A;  3GKQ A;  1QF8 A;  5C4J I;  3S1Q I;  4E31 A;  3I55 1;  1Y1V I;  3QWU A;  4TNU A;  3I4M I;  3TE5 B;  3CCS 1;  1VQM Z;  2V8I A;  2I3C A;  2OTJ 1;  3CCE 1;  1VQO Z;  2R7Z I;  1Y1W I;  5IP9 I;  5C3E I;  1X3W A;  3K7A I;  2JA5 I;  2YU9 I;  3CC2 Z;  1K8A 1;  3GTQ I;  3I07 A;  2ZAE B;  4A3D I;  3JAM b;  4HGY A;  2HF1 A;  4MH4 A;  1YHQ Z;  1K8A 2;  3BG0 B;  2Q51 A;  3G71 1;  3PO3 S;  1NUI A;  2PMZ A;  1VQ9 1;  1NP6 A;  2QLV B;  3PO2 I;  1Z03 A;  2VUG A;  3IX0 A;  2QA4 Z;  1KC8 1;  1VQ5 1;  3CCR 1;  4NBF A;  2RHB A;  1N2F A;  2JS4 A;  3G4S Z;  3CCV 1;  4A3G I;  1YHQ 1;  3NDI A;  1LQL A;  1KC8 2;  2QRD B;  4A3B I;  5C4X I;  1JWH C;  3GTG I;  4A3F I;  2V8J A;  2WB1 A;  1X3Z A;  4NBC A;  1VQ7 Z;  4NBH A;  3FKI I;  4RVG A;  3TDH B;  1YJ9 1;  2B63 I;  1PFT A;  2QR1 B;  2E2J I;  3PO3 I;  2E2I I;  3NH4 A;  2OOY B;  4DQY B;  4E2Y A;  4E2Z A;  3S16 I;  3FQQ A;  2JMO A;  4RV9 A;  1WII A;  3EED A;  2IZ4 A;  1Q7Y 1;  1DL6 A;  2BJO A;  4NFR A;  1VLA A;  2H85 A;  4E32 A;  3CCU Z;  4RS4 A;  2P28 A;  1Q7Y 2;  4EWC A;  2RT9 A;  1Y1V S;  3M4O I;  1JJ2 Z;  3CCJ Z;  3CCM Z;  2E9H A;  2OOX B;  3CC7 Z;  1VQ4 Z;  3OW2 Y;  2GTH A;  2IZ3 A;  2KI7 B;  1YI2 Z;  2QRC B;  2OZK A;  2NVY I;  2OTL Z;  3I56 Z;  3VTN A;  4MD8 A;  2VUM I;  1YIT 1;  1I50 I;  1ZB8 A;  1I3Q I;  3MZL B;  4E30 A;  2V8K A;  4MXU A;  3GTJ I;  5IP7 I;  3J7A 4;  4X6A I;  3CQZ I;  4HGZ A;  3JAM f;  2RPR A;  2NVX I;  3HOY I;  3NFZ A;  2QEX 1;  1VQL 1;  3NDJ A;  2W03 A;  5FLX f;  1TWH I;  4A3E I;  1M1K 1;  1YIJ Z;  3EER A;  1Z01 A;  3S1N I;  3ESW A;  1VQM 1;  3D6W A;  3GTM I;  1M1K 2;  1QVF Y;  4QTT A;  2Y0S A;  1VQO 1;  1VQK Z;  1YJW Z;  2K5R A;  5FLX b;  2JA6 I;  1KQS Y;  1TWG I;  3CC2 1;  3CCQ Z;  3CMA Z;  2HU9 A;  4MRI A;  3GTL I;  3S2D I;  4Y7N I;  2NVT I;  5D1O B;  3FQM A;  4RVF A;  1RO0 A;  5D1O A;  4A3L I;  1RLY A;  3F3P C;  4A3K I;  2P3Y A;  4A3J I;  3CCQ 1;  2VF1 A;  2QA4 1;  3G4S 1;  2PM9 A;  3CME Z;  4E2X A;  1SFO I;  4NB9 A;  2JNY A;  1VQ8 Z;  2O4H A;  3G6E Z;  5LL6 f;  4QTU A;  2NVQ I;  1QVG Y;  1VQ7 1;  3Q87 A;  1TWC I;  1N8R 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...