5A2Qf

Structure of the hcv ires bound to the human ribosome
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
72
structure length
72
Chain Sequence
KKRKKKSCTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 18S RRNA
publication title Cryo-Em Structure of Hepatitis C Virus Ires Bound to the Human Ribosome at 3.9 Angstrom Resolution
pubmed doi rcsb
molecule tags Ribosome
total genus 5
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF01599 Ribosomal_S27 Ribosomal protein S27a
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.660 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5a2qf00
5FLXf 5IT9f 5A2Qf 3J80f 3JAMf 3J81f
chains in the Genus database with same CATH superfamily
3NH5A 2JMOA 2QR1B 4A3II 2G2KA 1I6HI 1K9M2 3LUSA 3IX0A 1QVFY 2LEXA 2E2II 4RV9A 3S2HI 2R92I 1YIT1 1KD11 2NVQI 5IP9I 1WJ2A 2IZ4A 5AN9F 4A3LI 3MZKB 3PO2I 1YIJZ 4E33A 4MD9A 3I56Z 1M1K1 2V8KA 3S17I 1S721 2QKDA 3S14I 3GTJI 1VQ4Z 4EWCA 4E2WA 3TDHB 3I551 2WAQA 3GCFA 1K9M1 4QTUA 1QF8A 3S15I 3CMA1 1FDOA 3I07A 2BJOA 3HOYI 4AYBA 1I50I 3IR7A 1VQN1 2QRCB 2NAPA 5A2Qf 3D2LA 2V8IA 3F3FC 2HF1A 1VQ81 2Y0SA 2RIQA 1Y1VI 3S1MI 3CC2Z 2VUGA 2R7ZI 1NJI2 4RVFA 1Q7Y2 3CCJ1 3PO3S 1TWAI 2E2JI 3CCV1 3CCUZ 3D9XA 2QA4Z 2M6NA 1Y1VS 3K7AI 5C44I 3G4S1 1RLYA 1X3WA 4RVHA 3IFUA 2RBLA 4BBRI 1VQ6Z 2JA8I 1KC82 2Q4ZA 1W2BZ 4A3GI 1VQM1 1Y8CA 2OTJ1 3M3YI 1VQK1 1K732 3GTOI 2E9HA 2JIMA 1Y1WI 3CCE1 2VPXA 5D1OA 4A3EI 1JWHC 1YUAA 1NJI1 4MD8A 3FQQA 4NBDA 1AA6A 1TWCI 1Q7Y1 2AKLA 2R6MA 3CMEZ 1ZB8A 3CCQ1 3RZOI 1QVFZ 1TWFI 3GTLI 1TWHI 3GTMI 1W2BY 3S2DI 1VQPZ 2NVXI 2IZ3A 3VB9A 2PMZA 3KIFA 4E2YA 3I4MI 3U50C 1KC81 3G711 3CD61 4MXUA 2GU2A 3GTMS 1VQOZ 1Q862 4NBHA 2VUMI 1ZH1A 5A2Qb 1K731 3RZDI 3CCQZ 3VTNA 4NFRA 3CCMZ 2R93I 1DL6A 4TNUA 2M48A 3S1NI 3CCLZ 4E31A 1WW9A 3CCR1 2DE7A 2JS4A 2P28A 3NFZA 3CCS1 1RO2A 2HU9A 2AYDA 2VPYA 3G71Z 1VQ91 2O4HA 1ZB9A 2IV2X 3VMHA 2QEX1 2RPRA 1YJN1 2YADA 3HOVI 1USPA 5LL6f 3TE5B 1N8R2 3CPWY 2JA5I 3GTQI 5C3EI 1YHQ1 3NH4A 1Q861 3G6E1 2OOYB 1WZNA 1YITZ 1VLAA 2JA7I 2F4MA 2JIRA 4A3BI 3EERA 3GKQA 2JUBA 2RHBA 3I4NI 1YJ91 2GTIA 3HOWI 2OTL1 1S72Z 2JA6I 3HOUI 2GTHA 1VQ71 3I55Z 2QLVB 2Q51A 1P9NA 4NB9A 5D1OB 1TFIA 1LQLA 3HKZA 2ZAEB 3CMAZ 4NOZA 2H85A 4MRIA 3D6WA 2W03A 5T6BA 2PK7A 1N8R1 1WCMI 2JIOA 4E32A 1VQNZ 1Q822 4RVDA 2DE5A 1M902 5CM2M 4A3CI 1Q16A 4A3DI 2VPWA 1VQ8Z 2QRDB 3H0GI 1YJW1 4S1TA 1Q812 3HOZI 3GTKI 3CC71 3MONA 1RO0A 1Z02A 2VPZA 4NBBA 4A3KI 4NBAA 3CCJZ 4HH4A 1ML8A 4MD7A 3BG1B 3CCVZ 4XX2A 1SFOI 4HGYA 2KI7B 1YI21 3G4SZ 3CXCZ 3EEDA 1KQSY 4X6AI 3H3VJ 1RNIA 1Q821 1VQL1 2J6AA 2PM9A 2KPIA 1YJWZ 1VQMZ 2OTJZ 1M901 5C4JI 4E2ZA 1VQ51 1VQKZ 3HOXI 3GTPI 2K3RA 3ESWA 1QXFA 2JNYA 3CCEZ 5IT9f 1Q811 1USPB 3CC41 3P5JB 1NUIA 1R9TI 4HGZA 4A93I 3CXCY 3CQZI 5FLXb 4MH4A 3S16I 4DK1A 1K83I 2DE6A 3S1QI 5T67A 3CPWZ 2QREB 3NDIA 1L1OC 1YIJ1 4Y7NI 1VQ5Z 2VF1A 1QVGZ 3I561 1X0TA 3CD6Z 3VMIA 3GTGI 3CC4Z 1VQ41 3NDJA 2E7ZA 1PFTA 4A3FI 4NBFA 4DGLA 2K5RA 1RQFA 3CCRZ 2OZKA 2WB1A 3F3PC 4NH1C 3CCSZ 4A3JI 2RT9A 1Z03A 4Y52I 4QTTA 2E2HI 1QVGY 1VQ9Z 2B63I 4A3MI 4RVGA 2OOXB 1RO4A 2NVTI 5FLXf 1K8A2 1YUKA 3CC21 3JAMf 2NVYI 2QEXZ 1NP6A 5C4XI 3BG0B 1YJNZ 3J80b 3OW2Z 2O53A 3FKII 1YHQZ 1WIIA 3G6EZ 4BY7I 2I3CA 2W04A 3J81b 5IP7I 3KIHA 4NB8A 4BY1I 4NBGA 3CCU1 2QA41 4NBEA 4RS4A 4CL1A 3Q87A 3PO3I 1I3QI 2JR6A 2YU9I 3NH8A 4BBSI 5IT9b 1YJ9Z 5FLMI 2V8JA 5T64A 2JIQA 2OTLZ 1VQ61 2F4OA 1KQSZ 1FDIA 1KRLA 1VQ7Z 3OW2Y 1JJ2Z 3T4NB 1Z01A 1K8A1 4E2XA 2LFUA 3M4OI 2LIYA 3IF8A 1N2FA 3MZLB 5D1PA 3CME1 4MONA 4BXXI 4NBCA 1QYPA 4DQYB 3J80f 2V3VA 1VQP1 1JJ2Y 2V45A 1X3ZA 3J81f 4E30A 3S1RI 3CC7Z 2EGTA 1S7MA 3QWUA 2JIPA 1VQO1 1KD12 1YI2Z 3J7A4 3CCM1 3FQMA 3VMGA 2P3YA 1TWGI 3CCL1 1SIWA 3JAMb 1VQLZ 1M1K2
chains in the Genus database with same CATH topology
3NH5A 2JMOA 2QR1B 4A3II 2G2KA 1I6HI 1K9M2 3LUSA 3IX0A 1QVFY 2E2II 4RV9A 3S2HI 2R92I 1YIT1 1KD11 2NVQI 5IP9I 2IZ4A 5AN9F 4A3LI 3MZKB 3PO2I 1YIJZ 4E33A 4MD9A 3I56Z 1M1K1 2V8KA 3S17I 1S721 2QKDA 3S14I 3GTJI 1VQ4Z 4EWCA 4E2WA 3TDHB 3I551 2WAQA 3GCFA 1K9M1 4QTUA 1QF8A 3S15I 3CMA1 3I07A 2BJOA 3HOYI 4AYBA 1I50I 1VQN1 2QRCB 5A2Qf 2V8IA 3F3FC 2HF1A 1VQ81 2Y0SA 2RIQA 1Y1VI 3S1MI 3CC2Z 2VUGA 2R7ZI 1NJI2 4RVFA 1Q7Y2 3CCJ1 3PO3S 1TWAI 2E2JI 3CCV1 3CCUZ 3D9XA 2QA4Z 2M6NA 1Y1VS 3K7AI 5C44I 3G4S1 1RLYA 1X3WA 4RVHA 3IFUA 2RBLA 4BBRI 1VQ6Z 2JA8I 1KC82 2Q4ZA 1W2BZ 4A3GI 1VQM1 2OTJ1 3M3YI 1VQK1 1K732 3GTOI 2E9HA 1Y1WI 3CCE1 4A3EI 5D1OA 1JWHC 1YUAA 1NJI1 4MD8A 3FQQA 4NBDA 1Q7Y1 1TWCI 2AKLA 2R6MA 3CMEZ 1ZB8A 3CCQ1 3RZOI 1QVFZ 1TWFI 3GTLI 1TWHI 3GTMI 1W2BY 3S2DI 1VQPZ 2NVXI 2IZ3A 3VB9A 2PMZA 3KIFA 4E2YA 3I4MI 3U50C 1KC81 3G711 3CD61 4MXUA 2GU2A 3GTMS 1VQOZ 1Q862 4NBHA 2VUMI 1ZH1A 5A2Qb 1K731 3RZDI 3CCQZ 3VTNA 4NFRA 3CCMZ 2R93I 1DL6A 4TNUA 2M48A 3S1NI 3CCLZ 4E31A 1WW9A 3CCR1 2JS4A 2DE7A 2P28A 3NFZA 3CCS1 1RO2A 2HU9A 1VQ91 3G71Z 2O4HA 1ZB9A 3VMHA 2QEX1 2RPRA 1YJN1 2YADA 3HOVI 1USPA 5LL6f 3TE5B 1N8R2 3CPWY 2JA5I 3GTQI 5C3EI 1YHQ1 3NH4A 1Q861 3G6E1 2OOYB 1YITZ 1VLAA 2JA7I 2F4MA 4A3BI 3EERA 3GKQA 2JUBA 2RHBA 3I4NI 1YJ91 2GTIA 3HOWI 2OTL1 1S72Z 2JA6I 3HOUI 2GTHA 1VQ71 3I55Z 2QLVB 2Q51A 1P9NA 4NB9A 5D1OB 1TFIA 1LQLA 3HKZA 2ZAEB 3CMAZ 4NOZA 2H85A 4MRIA 3D6WA 2W03A 5T6BA 2PK7A 1N8R1 1WCMI 4E32A 1VQNZ 1Q822 4RVDA 2DE5A 1M902 5CM2M 4A3CI 4A3DI 1VQ8Z 2QRDB 3H0GI 1YJW1 4S1TA 1Q812 3HOZI 3GTKI 3CC71 3MONA 1RO0A 1Z02A 4NBBA 4A3KI 4NBAA 3CCJZ 4HH4A 1ML8A 4MD7A 3BG1B 3CCVZ 4XX2A 1SFOI 4HGYA 2KI7B 1YI21 3G4SZ 3CXCZ 3EEDA 1KQSY 4X6AI 3H3VJ 1RNIA 1Q821 1VQL1 2J6AA 2PM9A 2KPIA 1YJWZ 1VQMZ 2OTJZ 1M901 5C4JI 4E2ZA 1VQ51 1VQKZ 3HOXI 3GTPI 2K3RA 3ESWA 2JNYA 3CCEZ 5IT9f 1Q811 1USPB 3CC41 3P5JB 1NUIA 1R9TI 4HGZA 4A93I 3CXCY 3CQZI 5FLXb 4MH4A 3S16I 4DK1A 1K83I 2DE6A 3S1QI 5T67A 3CPWZ 2QREB 3NDIA 1L1OC 1YIJ1 4Y7NI 1VQ5Z 2VF1A 1QVGZ 3I561 1X0TA 3CD6Z 3VMIA 3GTGI 3CC4Z 1VQ41 3NDJA 1PFTA 4A3FI 4NBFA 4DGLA 2K5RA 1RQFA 3CCRZ 2OZKA 2WB1A 3F3PC 4NH1C 3CCSZ 4A3JI 2RT9A 1Z03A 4Y52I 4QTTA 2E2HI 1QVGY 1VQ9Z 2B63I 4A3MI 4RVGA 2OOXB 1RO4A 2NVTI 5FLXf 1K8A2 1YUKA 3CC21 3JAMf 2NVYI 2QEXZ 1NP6A 5C4XI 3BG0B 1YJNZ 3J80b 3OW2Z 2O53A 3FKII 1YHQZ 1WIIA 3G6EZ 4BY7I 2I3CA 2W04A 3J81b 5IP7I 3KIHA 4NB8A 4BY1I 4NBGA 3CCU1 2QA41 4NBEA 4RS4A 4CL1A 3Q87A 3PO3I 1I3QI 2JR6A 2YU9I 3NH8A 4BBSI 5IT9b 1YJ9Z 5FLMI 2V8JA 5T64A 1VQ61 2OTLZ 2F4OA 1KQSZ 1KRLA 1VQ7Z 3OW2Y 1JJ2Z 3T4NB 1Z01A 1K8A1 4E2XA 2LFUA 3M4OI 2LIYA 3IF8A 1N2FA 3MZLB 5D1PA 3CME1 4MONA 4BXXI 4NBCA 1QYPA 4DQYB 3J80f 1VQP1 1JJ2Y 1X3ZA 3J81f 4E30A 3S1RI 3CC7Z 2EGTA 1S7MA 3QWUA 1VQO1 1KD12 1YI2Z 3J7A4 3CCM1 3FQMA 3VMGA 2P3YA 1TWGI 3CCL1 3JAMb 1VQLZ 1M1K2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX f;  5IT9 f;  5A2Q f;  3J80 f;  3JAM f;  3J81 f; 
#chains in the Genus database with same CATH topology
 3NH5 A;  2JMO A;  2QR1 B;  4A3I I;  2G2K A;  1I6H I;  1K9M 2;  3LUS A;  3IX0 A;  1QVF Y;  2LEX A;  2E2I I;  4RV9 A;  3S2H I;  2R92 I;  1YIT 1;  1KD1 1;  2NVQ I;  5IP9 I;  1WJ2 A;  2IZ4 A;  5AN9 F;  4A3L I;  3MZK B;  3PO2 I;  1YIJ Z;  4E33 A;  4MD9 A;  3I56 Z;  1M1K 1;  2V8K A;  3S17 I;  1S72 1;  2QKD A;  3S14 I;  3GTJ I;  1VQ4 Z;  4EWC A;  4E2W A;  3TDH B;  3I55 1;  2WAQ A;  3GCF A;  1K9M 1;  4QTU A;  1QF8 A;  3S15 I;  3CMA 1;  1FDO A;  3I07 A;  2BJO A;  3HOY I;  4AYB A;  1I50 I;  3IR7 A;  1VQN 1;  2QRC B;  2NAP A;  5A2Q f;  3D2L A;  2V8I A;  3F3F C;  2HF1 A;  1VQ8 1;  2Y0S A;  2RIQ A;  1Y1V I;  3S1M I;  3CC2 Z;  2VUG A;  2R7Z I;  1NJI 2;  4RVF A;  1Q7Y 2;  3CCJ 1;  3PO3 S;  1TWA I;  2E2J I;  3CCV 1;  3CCU Z;  3D9X A;  2QA4 Z;  2M6N A;  1Y1V S;  3K7A I;  5C44 I;  3G4S 1;  1RLY A;  1X3W A;  4RVH A;  3IFU A;  2RBL A;  4BBR I;  1VQ6 Z;  2JA8 I;  1KC8 2;  2Q4Z A;  1W2B Z;  4A3G I;  1VQM 1;  1Y8C A;  2OTJ 1;  3M3Y I;  1VQK 1;  1K73 2;  3GTO I;  2E9H A;  2JIM A;  1Y1W I;  3CCE 1;  2VPX A;  5D1O A;  4A3E I;  1JWH C;  1YUA A;  1NJI 1;  4MD8 A;  3FQQ A;  4NBD A;  1AA6 A;  1TWC I;  1Q7Y 1;  2AKL A;  2R6M A;  3CME Z;  1ZB8 A;  3CCQ 1;  3RZO I;  1QVF Z;  1TWF I;  3GTL I;  1TWH I;  3GTM I;  1W2B Y;  3S2D I;  1VQP Z;  2NVX I;  2IZ3 A;  3VB9 A;  2PMZ A;  3KIF A;  4E2Y A;  3I4M I;  3U50 C;  1KC8 1;  3G71 1;  3CD6 1;  4MXU A;  2GU2 A;  3GTM S;  1VQO Z;  1Q86 2;  4NBH A;  2VUM I;  1ZH1 A;  5A2Q b;  1K73 1;  3RZD I;  3CCQ Z;  3VTN A;  4NFR A;  3CCM Z;  2R93 I;  1DL6 A;  4TNU A;  2M48 A;  3S1N I;  3CCL Z;  4E31 A;  1WW9 A;  3CCR 1;  2DE7 A;  2JS4 A;  2P28 A;  3NFZ A;  3CCS 1;  1RO2 A;  2HU9 A;  2AYD A;  2VPY A;  3G71 Z;  1VQ9 1;  2O4H A;  1ZB9 A;  2IV2 X;  3VMH A;  2QEX 1;  2RPR A;  1YJN 1;  2YAD A;  3HOV I;  1USP A;  5LL6 f;  3TE5 B;  1N8R 2;  3CPW Y;  2JA5 I;  3GTQ I;  5C3E I;  1YHQ 1;  3NH4 A;  1Q86 1;  3G6E 1;  2OOY B;  1WZN A;  1YIT Z;  1VLA A;  2JA7 I;  2F4M A;  2JIR A;  4A3B I;  3EER A;  3GKQ A;  2JUB A;  2RHB A;  3I4N I;  1YJ9 1;  2GTI A;  3HOW I;  2OTL 1;  1S72 Z;  2JA6 I;  3HOU I;  2GTH A;  1VQ7 1;  3I55 Z;  2QLV B;  2Q51 A;  1P9N A;  4NB9 A;  5D1O B;  1TFI A;  1LQL A;  3HKZ A;  2ZAE B;  3CMA Z;  4NOZ A;  2H85 A;  4MRI A;  3D6W A;  2W03 A;  5T6B A;  2PK7 A;  1N8R 1;  1WCM I;  2JIO A;  4E32 A;  1VQN Z;  1Q82 2;  4RVD A;  2DE5 A;  1M90 2;  5CM2 M;  4A3C I;  1Q16 A;  4A3D I;  2VPW A;  1VQ8 Z;  2QRD B;  3H0G I;  1YJW 1;  4S1T A;  1Q81 2;  3HOZ I;  3GTK I;  3CC7 1;  3MON A;  1RO0 A;  1Z02 A;  2VPZ A;  4NBB A;  4A3K I;  4NBA A;  3CCJ Z;  4HH4 A;  1ML8 A;  4MD7 A;  3BG1 B;  3CCV Z;  4XX2 A;  1SFO I;  4HGY A;  2KI7 B;  1YI2 1;  3G4S Z;  3CXC Z;  3EED A;  1KQS Y;  4X6A I;  3H3V J;  1RNI A;  1Q82 1;  1VQL 1;  2J6A A;  2PM9 A;  2KPI A;  1YJW Z;  1VQM Z;  2OTJ Z;  1M90 1;  5C4J I;  4E2Z A;  1VQ5 1;  1VQK Z;  3HOX I;  3GTP I;  2K3R A;  3ESW A;  1QXF A;  2JNY A;  3CCE Z;  5IT9 f;  1Q81 1;  1USP B;  3CC4 1;  3P5J B;  1NUI A;  1R9T I;  4HGZ A;  4A93 I;  3CXC Y;  3CQZ I;  5FLX b;  4MH4 A;  3S16 I;  4DK1 A;  1K83 I;  2DE6 A;  3S1Q I;  5T67 A;  3CPW Z;  2QRE B;  3NDI A;  1L1O C;  1YIJ 1;  4Y7N I;  1VQ5 Z;  2VF1 A;  1QVG Z;  3I56 1;  1X0T A;  3CD6 Z;  3VMI A;  3GTG I;  3CC4 Z;  1VQ4 1;  3NDJ A;  2E7Z A;  1PFT A;  4A3F I;  4NBF A;  4DGL A;  2K5R A;  1RQF A;  3CCR Z;  2OZK A;  2WB1 A;  3F3P C;  4NH1 C;  3CCS Z;  4A3J I;  2RT9 A;  1Z03 A;  4Y52 I;  4QTT A;  2E2H I;  1QVG Y;  1VQ9 Z;  2B63 I;  4A3M I;  4RVG A;  2OOX B;  1RO4 A;  2NVT I;  5FLX f;  1K8A 2;  1YUK A;  3CC2 1;  3JAM f;  2NVY I;  2QEX Z;  1NP6 A;  5C4X I;  3BG0 B;  1YJN Z;  3J80 b;  3OW2 Z;  2O53 A;  3FKI I;  1YHQ Z;  1WII A;  3G6E Z;  4BY7 I;  2I3C A;  2W04 A;  3J81 b;  5IP7 I;  3KIH A;  4NB8 A;  4BY1 I;  4NBG A;  3CCU 1;  2QA4 1;  4NBE A;  4RS4 A;  4CL1 A;  3Q87 A;  3PO3 I;  1I3Q I;  2JR6 A;  2YU9 I;  3NH8 A;  4BBS I;  5IT9 b;  1YJ9 Z;  5FLM I;  2V8J A;  5T64 A;  2JIQ A;  2OTL Z;  1VQ6 1;  2F4O A;  1KQS Z;  1FDI A;  1KRL A;  1VQ7 Z;  3OW2 Y;  1JJ2 Z;  3T4N B;  1Z01 A;  1K8A 1;  4E2X A;  2LFU A;  3M4O I;  2LIY A;  3IF8 A;  1N2F A;  3MZL B;  5D1P A;  3CME 1;  4MON A;  4BXX I;  4NBC A;  1QYP A;  4DQY B;  3J80 f;  2V3V A;  1VQP 1;  1JJ2 Y;  2V45 A;  1X3Z A;  3J81 f;  4E30 A;  3S1R I;  3CC7 Z;  2EGT A;  1S7M A;  3QWU A;  2JIP A;  1VQO 1;  1KD1 2;  1YI2 Z;  3J7A 4;  3CCM 1;  3FQM A;  3VMG A;  2P3Y A;  1TWG I;  3CCL 1;  1SIW A;  3JAM b;  1VQL Z;  1M1K 2; 
#chains in the Genus database with same CATH homology
 3NH5 A;  2JMO A;  2QR1 B;  4A3I I;  2G2K A;  1I6H I;  1K9M 2;  3LUS A;  3IX0 A;  1QVF Y;  2E2I I;  4RV9 A;  3S2H I;  2R92 I;  1YIT 1;  1KD1 1;  2NVQ I;  5IP9 I;  2IZ4 A;  5AN9 F;  4A3L I;  3MZK B;  3PO2 I;  1YIJ Z;  4E33 A;  4MD9 A;  3I56 Z;  1M1K 1;  2V8K A;  3S17 I;  1S72 1;  2QKD A;  3S14 I;  3GTJ I;  1VQ4 Z;  4EWC A;  4E2W A;  3TDH B;  3I55 1;  2WAQ A;  3GCF A;  1K9M 1;  4QTU A;  1QF8 A;  3S15 I;  3CMA 1;  3I07 A;  2BJO A;  3HOY I;  4AYB A;  1I50 I;  1VQN 1;  2QRC B;  5A2Q f;  2V8I A;  3F3F C;  2HF1 A;  1VQ8 1;  2Y0S A;  2RIQ A;  1Y1V I;  3S1M I;  3CC2 Z;  2VUG A;  2R7Z I;  1NJI 2;  4RVF A;  1Q7Y 2;  3CCJ 1;  3PO3 S;  1TWA I;  2E2J I;  3CCV 1;  3CCU Z;  3D9X A;  2QA4 Z;  2M6N A;  1Y1V S;  3K7A I;  5C44 I;  3G4S 1;  1RLY A;  1X3W A;  4RVH A;  3IFU A;  2RBL A;  4BBR I;  1VQ6 Z;  2JA8 I;  1KC8 2;  2Q4Z A;  1W2B Z;  4A3G I;  1VQM 1;  2OTJ 1;  3M3Y I;  1VQK 1;  1K73 2;  3GTO I;  2E9H A;  1Y1W I;  3CCE 1;  4A3E I;  5D1O A;  1JWH C;  1YUA A;  1NJI 1;  4MD8 A;  3FQQ A;  4NBD A;  1Q7Y 1;  1TWC I;  2AKL A;  2R6M A;  3CME Z;  1ZB8 A;  3CCQ 1;  3RZO I;  1QVF Z;  1TWF I;  3GTL I;  1TWH I;  3GTM I;  1W2B Y;  3S2D I;  1VQP Z;  2NVX I;  2IZ3 A;  3VB9 A;  2PMZ A;  3KIF A;  4E2Y A;  3I4M I;  3U50 C;  1KC8 1;  3G71 1;  3CD6 1;  4MXU A;  2GU2 A;  3GTM S;  1VQO Z;  1Q86 2;  4NBH A;  2VUM I;  1ZH1 A;  5A2Q b;  1K73 1;  3RZD I;  3CCQ Z;  3VTN A;  4NFR A;  3CCM Z;  2R93 I;  1DL6 A;  4TNU A;  2M48 A;  3S1N I;  3CCL Z;  4E31 A;  1WW9 A;  3CCR 1;  2JS4 A;  2DE7 A;  2P28 A;  3NFZ A;  3CCS 1;  1RO2 A;  2HU9 A;  1VQ9 1;  3G71 Z;  2O4H A;  1ZB9 A;  3VMH A;  2QEX 1;  2RPR A;  1YJN 1;  2YAD A;  3HOV I;  1USP A;  5LL6 f;  3TE5 B;  1N8R 2;  3CPW Y;  2JA5 I;  3GTQ I;  5C3E I;  1YHQ 1;  3NH4 A;  1Q86 1;  3G6E 1;  2OOY B;  1YIT Z;  1VLA A;  2JA7 I;  2F4M A;  4A3B I;  3EER A;  3GKQ A;  2JUB A;  2RHB A;  3I4N I;  1YJ9 1;  2GTI A;  3HOW I;  2OTL 1;  1S72 Z;  2JA6 I;  3HOU I;  2GTH A;  1VQ7 1;  3I55 Z;  2QLV B;  2Q51 A;  1P9N A;  4NB9 A;  5D1O B;  1TFI A;  1LQL A;  3HKZ A;  2ZAE B;  3CMA Z;  4NOZ A;  2H85 A;  4MRI A;  3D6W A;  2W03 A;  5T6B A;  2PK7 A;  1N8R 1;  1WCM I;  4E32 A;  1VQN Z;  1Q82 2;  4RVD A;  2DE5 A;  1M90 2;  5CM2 M;  4A3C I;  4A3D I;  1VQ8 Z;  2QRD B;  3H0G I;  1YJW 1;  4S1T A;  1Q81 2;  3HOZ I;  3GTK I;  3CC7 1;  3MON A;  1RO0 A;  1Z02 A;  4NBB A;  4A3K I;  4NBA A;  3CCJ Z;  4HH4 A;  1ML8 A;  4MD7 A;  3BG1 B;  3CCV Z;  4XX2 A;  1SFO I;  4HGY A;  2KI7 B;  1YI2 1;  3G4S Z;  3CXC Z;  3EED A;  1KQS Y;  4X6A I;  3H3V J;  1RNI A;  1Q82 1;  1VQL 1;  2J6A A;  2PM9 A;  2KPI A;  1YJW Z;  1VQM Z;  2OTJ Z;  1M90 1;  5C4J I;  4E2Z A;  1VQ5 1;  1VQK Z;  3HOX I;  3GTP I;  2K3R A;  3ESW A;  2JNY A;  3CCE Z;  5IT9 f;  1Q81 1;  1USP B;  3CC4 1;  3P5J B;  1NUI A;  1R9T I;  4HGZ A;  4A93 I;  3CXC Y;  3CQZ I;  5FLX b;  4MH4 A;  3S16 I;  4DK1 A;  1K83 I;  2DE6 A;  3S1Q I;  5T67 A;  3CPW Z;  2QRE B;  3NDI A;  1L1O C;  1YIJ 1;  4Y7N I;  1VQ5 Z;  2VF1 A;  1QVG Z;  3I56 1;  1X0T A;  3CD6 Z;  3VMI A;  3GTG I;  3CC4 Z;  1VQ4 1;  3NDJ A;  1PFT A;  4A3F I;  4NBF A;  4DGL A;  2K5R A;  1RQF A;  3CCR Z;  2OZK A;  2WB1 A;  3F3P C;  4NH1 C;  3CCS Z;  4A3J I;  2RT9 A;  1Z03 A;  4Y52 I;  4QTT A;  2E2H I;  1QVG Y;  1VQ9 Z;  2B63 I;  4A3M I;  4RVG A;  2OOX B;  1RO4 A;  2NVT I;  5FLX f;  1K8A 2;  1YUK A;  3CC2 1;  3JAM f;  2NVY I;  2QEX Z;  1NP6 A;  5C4X I;  3BG0 B;  1YJN Z;  3J80 b;  3OW2 Z;  2O53 A;  3FKI I;  1YHQ Z;  1WII A;  3G6E Z;  4BY7 I;  2I3C A;  2W04 A;  3J81 b;  5IP7 I;  3KIH A;  4NB8 A;  4BY1 I;  4NBG A;  3CCU 1;  2QA4 1;  4NBE A;  4RS4 A;  4CL1 A;  3Q87 A;  3PO3 I;  1I3Q I;  2JR6 A;  2YU9 I;  3NH8 A;  4BBS I;  5IT9 b;  1YJ9 Z;  5FLM I;  2V8J A;  5T64 A;  1VQ6 1;  2OTL Z;  2F4O A;  1KQS Z;  1KRL A;  1VQ7 Z;  3OW2 Y;  1JJ2 Z;  3T4N B;  1Z01 A;  1K8A 1;  4E2X A;  2LFU A;  3M4O I;  2LIY A;  3IF8 A;  1N2F A;  3MZL B;  5D1P A;  3CME 1;  4MON A;  4BXX I;  4NBC A;  1QYP A;  4DQY B;  3J80 f;  1VQP 1;  1JJ2 Y;  1X3Z A;  3J81 f;  4E30 A;  3S1R I;  3CC7 Z;  2EGT A;  1S7M A;  3QWU A;  1VQO 1;  1KD1 2;  1YI2 Z;  3J7A 4;  3CCM 1;  3FQM A;  3VMG A;  2P3Y A;  1TWG I;  3CCL 1;  3JAM b;  1VQL Z;  1M1K 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...