5A2Qf

Structure of the hcv ires bound to the human ribosome
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
72
structure length
72
Chain Sequence
KKRKKKSCTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 18S RRNA
publication title Cryo-Em Structure of Hepatitis C Virus Ires Bound to the Human Ribosome at 3.9 Angstrom Resolution
pubmed doi rcsb
molecule tags Ribosome
total genus 5
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF01599 Ribosomal_S27 Ribosomal protein S27a
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.660 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5a2qf00
3J80f 3J81f 5IT9f 5A2Qf 3JAMf 5FLXf
chains in the Genus database with same CATH superfamily
3J81b 3CCQZ 2QRDB 3TE5B 2NVXI 4S1TA 3NFZA 1YUKA 1VQ71 1N8R2 3VB9A 1VQK1 2WAQA 1VQLZ 3CMAZ 1YJNZ 3GTOI 1L1OC 2PM9A 4A3BI 4NBCA 3D6WA 3D2LA 5A2Qf 2P28A 2F4MA 3J80b 3NH4A 2LIYA 4NH1C 1NJI1 2F4OA 1VQ51 3IF8A 3GTJI 1Z03A 1Q862 1VQ7Z 1VQKZ 1SIWA 5FLMI 1Y1WI 3CCV1 1LQLA 3GTLI 4HGZA 3CCU1 3BG1B 1Q7Y2 3EERA 1KC81 2R7ZI 1VQ5Z 2JIMA 3CCJ1 4A3LI 1M901 1VQP1 2VPWA 4E30A 2JIPA 1Y1VI 1KD12 3CCVZ 1RO0A 3GKQA 2V8IA 3ESWA 3J7A4 3CCUZ 3NH8A 3EEDA 4HGYA 4RVHA 4Y7NI 1PFTA 5AN9F 1TWGI 3CCJZ 1N2FA 3VTNA 1VQPZ 1FDIA 2Q51A 2BJOA 1I6HI 2VUGA 3HOWI 4BBSI 4A3KI 1JWHC 1KRLA 2VPXA 1JJ2Y 3CME1 4BBRI 2RBLA 2JIQA 2YADA 1NP6A 4MH4A 2G2KA 3U50C 3CCL1 2JA7I 2NVQI 2WB1A 1K8A2 3HOVI 3PO3I 1VQ81 4BY7I 2EGTA 1W2BY 3CMEZ 3CCE1 5IT9b 2R6MA 3S17I 5C4XI 2V8KA 2M48A 1JJ2Z 2OTJ1 4QTUA 2GU2A 3HOYI 3D9XA 5IP7I 3CCLZ 4XX2A 3QWUA 2JA5I 2K5RA 1VQ41 2JIOA 2JNYA 1Q16A 1VQ8Z 2E9HA 3OW2Y 3I07A 3CCEZ 3LUSA 3JAMf 2YU9I 1Y8CA 2NVYI 5FLXf 2KI7B 2Y0SA 3GTGI 2OTJZ 5A2Qb 4X6AI 5T67A 1QF8A 1DL6A 3MONA 2LFUA 4RV9A 1M1K2 1VQ4Z 3KIHA 4A3MI 2OTLZ 4DQYB 3PO2I 5C3EI 1QYPA 3F3FC 1Q812 3H0GI 2DE6A 2OOYB 4E32A 4E31A 4NBHA 1SFOI 3I56Z 2E2HI 3CPWY 2JUBA 4A3FI 3IFUA 1YJ91 1QVFY 2AKLA 4RVFA 4E2ZA 5IP9I 2R92I 3S1NI 3M4OI 4A3CI 3S16I 3G711 3CD61 3M3YI 3HOZI 2R93I 3IR7A 1NJI2 1RLYA 2RT9A 1Q861 1YJ9Z 1KQSY 1K732 2VUMI 3FKII 2HF1A 3CCR1 1YUAA 4NBFA 3CQZI 3F3PC 1QVFZ 1Q7Y1 4DGLA 3G71Z 3CD6Z 3Q87A 3I551 4NBAA 1KC82 4MONA 2LEXA 3RZDI 1KD11 3CCRZ 1USPA 3GTQI 2NVTI 2JS4A 1KQSZ 4QTTA 2RPRA 3CC4Z 2JA8I 2H85A 2O4HA 1Y1VS 1TWAI 4NBEA 3I55Z 2W03A 2QLVB 2RIQA 3G4SZ 2V3VA 1VQ91 3RZOI 1YIJ1 1VQO1 2J6AA 2PMZA 1Q822 2VPZA 1VQN1 3S1QI 5CM2M 1AA6A 3S1RI 3FQMA 2HU9A 4MXUA 2DE5A 3K7AI 2W04A 5FLXb 1I50I 1VQ9Z 3NDIA 2PK7A 1YIJZ 1ZH1A 3CCM1 1VQOZ 1K9M2 4MRIA 5C4JI 1P9NA 1ML8A 3P5JB 2OTL1 1VQNZ 3PO3S 1YJW1 3CXCY 2QEX1 3FQQA 3H3VJ 1WZNA 2JA6I 2VF1A 2E2II 1I3QI 3GCFA 3S1MI 4DK1A 3I561 5D1OA 1YHQ1 1RO2A 1W2BZ 1Z01A 3CCMZ 1VQM1 3S14I 1Z02A 1YJWZ 4E33A 4BY1I 2QEXZ 5T6BA 2K3RA 1WCMI 4A3JI 1M1K1 3HKZA 3VMHA 3NH5A 3CXCZ 2GTIA 4TNUA 4E2YA 3GTPI 5LL6f 1YHQZ 3I4NI 4Y52I 2VPYA 1Q811 3OW2Z 1USPB 1N8R1 2QRCB 4MD7A 2GTHA 2IZ3A 2IV2X 1TWHI 1VQMZ 4RVDA 2QR1B 3G6E1 1VQ61 1X0TA 3MZKB 3KIFA 3T4NB 3S15I 4NFRA 1FDOA 1S721 2I3CA 3J81f 4E2WA 3TDHB 1QXFA 3GTKI 5D1PA 1RNIA 3CPWZ 4A93I 2AYDA 4E2XA 1K731 3CC41 4A3EI 2JIRA 2QREB 3G6EZ 3CCS1 1S7MA 1VQ6Z 2ZAEB 2M6NA 3NDJA 2OOXB 1WJ2A 3BG0B 3G4S1 3I4MI 5T64A 1S72Z 4A3GI 4RVGA 4EWCA 3CC71 1M902 3IX0A 3J80f 2V8JA 3MZLB 4MD8A 1RQFA 4MD9A 2E7ZA 3CC21 3CCSZ 4NBDA 3S2HI 3HOXI 5D1OB 2Q4ZA 1TWCI 2QA41 4AYBA 3CC7Z 2E2JI 4A3II 2B63I 2OZKA 1NUIA 3VMIA 1K83I 3CC2Z 3GTMI 5C44I 1WW9A 1Q821 4NBGA 3JAMb 4A3DI 1K8A1 2DE7A 4NOZA 1YI21 4CL1A 4BXXI 1TFIA 2QA4Z 1YIT1 3HOUI 4NB9A 1QVGY 2NAPA 3GTMS 2JR6A 1ZB9A 1R9TI 4NB8A 1ZB8A 1K9M1 4NBBA 1RO4A 1YI2Z 1TWFI 4RS4A 3CCQ1 2IZ4A 1YITZ 2QKDA 2O53A 3VMGA 1QVGZ 3S2DI 1VLAA 2JMOA 2RHBA 2P3YA 1X3ZA 1X3WA 1VQL1 1WIIA 1YJN1 3CMA1 2KPIA 4HH4A 2V45A 5IT9f
chains in the Genus database with same CATH topology
3J81b 3CCQZ 2QRDB 3TE5B 2NVXI 4S1TA 3NFZA 1YUKA 1VQ71 1N8R2 3VB9A 1VQK1 2WAQA 1VQLZ 3CMAZ 1YJNZ 3GTOI 1L1OC 2PM9A 4A3BI 4NBCA 3D6WA 5A2Qf 2P28A 2F4MA 3J80b 3NH4A 2LIYA 4NH1C 1NJI1 2F4OA 1VQ51 3IF8A 3GTJI 1Z03A 1Q862 1VQ7Z 1VQKZ 5FLMI 1Y1WI 3CCV1 1LQLA 3GTLI 4HGZA 3CCU1 3BG1B 1Q7Y2 3EERA 1KC81 2R7ZI 1VQ5Z 3CCJ1 4A3LI 1M901 1VQP1 4E30A 1Y1VI 1KD12 3CCVZ 1RO0A 3GKQA 2V8IA 3ESWA 3J7A4 3CCUZ 3NH8A 3EEDA 4HGYA 4RVHA 4Y7NI 1PFTA 5AN9F 1TWGI 3CCJZ 1N2FA 3VTNA 1VQPZ 2Q51A 2BJOA 1I6HI 2VUGA 3HOWI 4BBSI 4A3KI 1JWHC 1KRLA 1JJ2Y 3CME1 4BBRI 2RBLA 2YADA 1NP6A 4MH4A 2G2KA 3U50C 3CCL1 2JA7I 2NVQI 2WB1A 1K8A2 3HOVI 3PO3I 1VQ81 4BY7I 2EGTA 1W2BY 3CMEZ 3CCE1 5IT9b 2R6MA 3S17I 5C4XI 2V8KA 2M48A 1JJ2Z 2OTJ1 4QTUA 2GU2A 3HOYI 3D9XA 5IP7I 3CCLZ 4XX2A 3QWUA 2JA5I 2K5RA 1VQ41 2JNYA 1VQ8Z 2E9HA 3OW2Y 3I07A 3CCEZ 3LUSA 3JAMf 2YU9I 2NVYI 5FLXf 2KI7B 2Y0SA 3GTGI 2OTJZ 5A2Qb 4X6AI 5T67A 1QF8A 1DL6A 3MONA 2LFUA 4RV9A 1M1K2 1VQ4Z 3KIHA 4A3MI 2OTLZ 4DQYB 3PO2I 5C3EI 1QYPA 3F3FC 1Q812 3H0GI 2DE6A 2OOYB 4E32A 4E31A 4NBHA 1SFOI 3I56Z 2E2HI 3CPWY 2JUBA 4A3FI 3IFUA 1YJ91 1QVFY 2AKLA 4RVFA 4E2ZA 5IP9I 2R92I 3S1NI 3M4OI 4A3CI 3S16I 3G711 3CD61 3M3YI 3HOZI 2R93I 1NJI2 1RLYA 2RT9A 1Q861 1YJ9Z 1KQSY 1K732 2VUMI 3FKII 2HF1A 3CCR1 1YUAA 4NBFA 3CQZI 3F3PC 1QVFZ 1Q7Y1 4DGLA 3G71Z 3CD6Z 3Q87A 3I551 4NBAA 1KC82 4MONA 3RZDI 1KD11 3CCRZ 1USPA 3GTQI 2NVTI 2JS4A 1KQSZ 4QTTA 2RPRA 3CC4Z 2JA8I 2H85A 2O4HA 1Y1VS 1TWAI 4NBEA 3I55Z 2W03A 2QLVB 2RIQA 3G4SZ 1VQ91 3RZOI 1YIJ1 1VQO1 2J6AA 2PMZA 1Q822 1VQN1 3S1QI 5CM2M 3S1RI 3FQMA 2HU9A 4MXUA 2DE5A 3K7AI 2W04A 5FLXb 1I50I 1VQ9Z 3NDIA 2PK7A 1YIJZ 1ZH1A 3CCM1 1VQOZ 1K9M2 4MRIA 5C4JI 1P9NA 1ML8A 3P5JB 2OTL1 1VQNZ 3PO3S 1YJW1 3CXCY 2QEX1 3FQQA 3H3VJ 2JA6I 2VF1A 2E2II 1I3QI 3GCFA 3S1MI 4DK1A 3I561 5D1OA 1YHQ1 1RO2A 1W2BZ 1Z01A 3CCMZ 1VQM1 3S14I 1Z02A 1YJWZ 4E33A 4BY1I 2QEXZ 5T6BA 2K3RA 1WCMI 4A3JI 1M1K1 3HKZA 3VMHA 3NH5A 3CXCZ 2GTIA 4TNUA 4E2YA 3GTPI 5LL6f 1YHQZ 3I4NI 4Y52I 1Q811 3OW2Z 1USPB 1N8R1 2QRCB 4MD7A 2GTHA 2IZ3A 1TWHI 1VQMZ 4RVDA 2QR1B 3G6E1 1VQ61 1X0TA 3MZKB 3KIFA 3T4NB 3S15I 4NFRA 1S721 2I3CA 3J81f 4E2WA 3TDHB 3GTKI 5D1PA 1RNIA 3CPWZ 4A93I 4E2XA 1K731 3CC41 4A3EI 2QREB 3G6EZ 3CCS1 1S7MA 1VQ6Z 2ZAEB 2M6NA 3NDJA 2OOXB 3BG0B 3G4S1 3I4MI 5T64A 1S72Z 4A3GI 4RVGA 4EWCA 3CC71 1M902 3IX0A 3J80f 2V8JA 3MZLB 4MD8A 1RQFA 4MD9A 3CC21 3CCSZ 4NBDA 3S2HI 3HOXI 5D1OB 2Q4ZA 1TWCI 2QA41 4AYBA 3CC7Z 2E2JI 4A3II 2B63I 2OZKA 1NUIA 3VMIA 1K83I 3CC2Z 3GTMI 5C44I 1WW9A 1Q821 4NBGA 3JAMb 4A3DI 1K8A1 2DE7A 4NOZA 1YI21 4CL1A 4BXXI 1TFIA 2QA4Z 1YIT1 3HOUI 4NB9A 1QVGY 3GTMS 2JR6A 1ZB9A 1R9TI 4NB8A 1ZB8A 1K9M1 4NBBA 1RO4A 1YI2Z 1TWFI 4RS4A 3CCQ1 2IZ4A 1YITZ 2QKDA 2O53A 3VMGA 1QVGZ 3S2DI 1VLAA 2JMOA 2RHBA 2P3YA 1X3ZA 1X3WA 1VQL1 1WIIA 1YJN1 3CMA1 2KPIA 4HH4A 5IT9f
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J80 f;  3J81 f;  5IT9 f;  5A2Q f;  3JAM f;  5FLX f; 
#chains in the Genus database with same CATH topology
 3J81 b;  3CCQ Z;  2QRD B;  3TE5 B;  2NVX I;  4S1T A;  3NFZ A;  1YUK A;  1VQ7 1;  1N8R 2;  3VB9 A;  1VQK 1;  2WAQ A;  1VQL Z;  3CMA Z;  1YJN Z;  3GTO I;  1L1O C;  2PM9 A;  4A3B I;  4NBC A;  3D6W A;  3D2L A;  5A2Q f;  2P28 A;  2F4M A;  3J80 b;  3NH4 A;  2LIY A;  4NH1 C;  1NJI 1;  2F4O A;  1VQ5 1;  3IF8 A;  3GTJ I;  1Z03 A;  1Q86 2;  1VQ7 Z;  1VQK Z;  1SIW A;  5FLM I;  1Y1W I;  3CCV 1;  1LQL A;  3GTL I;  4HGZ A;  3CCU 1;  3BG1 B;  1Q7Y 2;  3EER A;  1KC8 1;  2R7Z I;  1VQ5 Z;  2JIM A;  3CCJ 1;  4A3L I;  1M90 1;  1VQP 1;  2VPW A;  4E30 A;  2JIP A;  1Y1V I;  1KD1 2;  3CCV Z;  1RO0 A;  3GKQ A;  2V8I A;  3ESW A;  3J7A 4;  3CCU Z;  3NH8 A;  3EED A;  4HGY A;  4RVH A;  4Y7N I;  1PFT A;  5AN9 F;  1TWG I;  3CCJ Z;  1N2F A;  3VTN A;  1VQP Z;  1FDI A;  2Q51 A;  2BJO A;  1I6H I;  2VUG A;  3HOW I;  4BBS I;  4A3K I;  1JWH C;  1KRL A;  2VPX A;  1JJ2 Y;  3CME 1;  4BBR I;  2RBL A;  2JIQ A;  2YAD A;  1NP6 A;  4MH4 A;  2G2K A;  3U50 C;  3CCL 1;  2JA7 I;  2NVQ I;  2WB1 A;  1K8A 2;  3HOV I;  3PO3 I;  1VQ8 1;  4BY7 I;  2EGT A;  1W2B Y;  3CME Z;  3CCE 1;  5IT9 b;  2R6M A;  3S17 I;  5C4X I;  2V8K A;  2M48 A;  1JJ2 Z;  2OTJ 1;  4QTU A;  2GU2 A;  3HOY I;  3D9X A;  5IP7 I;  3CCL Z;  4XX2 A;  3QWU A;  2JA5 I;  2K5R A;  1VQ4 1;  2JIO A;  2JNY A;  1Q16 A;  1VQ8 Z;  2E9H A;  3OW2 Y;  3I07 A;  3CCE Z;  3LUS A;  3JAM f;  2YU9 I;  1Y8C A;  2NVY I;  5FLX f;  2KI7 B;  2Y0S A;  3GTG I;  2OTJ Z;  5A2Q b;  4X6A I;  5T67 A;  1QF8 A;  1DL6 A;  3MON A;  2LFU A;  4RV9 A;  1M1K 2;  1VQ4 Z;  3KIH A;  4A3M I;  2OTL Z;  4DQY B;  3PO2 I;  5C3E I;  1QYP A;  3F3F C;  1Q81 2;  3H0G I;  2DE6 A;  2OOY B;  4E32 A;  4E31 A;  4NBH A;  1SFO I;  3I56 Z;  2E2H I;  3CPW Y;  2JUB A;  4A3F I;  3IFU A;  1YJ9 1;  1QVF Y;  2AKL A;  4RVF A;  4E2Z A;  5IP9 I;  2R92 I;  3S1N I;  3M4O I;  4A3C I;  3S16 I;  3G71 1;  3CD6 1;  3M3Y I;  3HOZ I;  2R93 I;  3IR7 A;  1NJI 2;  1RLY A;  2RT9 A;  1Q86 1;  1YJ9 Z;  1KQS Y;  1K73 2;  2VUM I;  3FKI I;  2HF1 A;  3CCR 1;  1YUA A;  4NBF A;  3CQZ I;  3F3P C;  1QVF Z;  1Q7Y 1;  4DGL A;  3G71 Z;  3CD6 Z;  3Q87 A;  3I55 1;  4NBA A;  1KC8 2;  4MON A;  2LEX A;  3RZD I;  1KD1 1;  3CCR Z;  1USP A;  3GTQ I;  2NVT I;  2JS4 A;  1KQS Z;  4QTT A;  2RPR A;  3CC4 Z;  2JA8 I;  2H85 A;  2O4H A;  1Y1V S;  1TWA I;  4NBE A;  3I55 Z;  2W03 A;  2QLV B;  2RIQ A;  3G4S Z;  2V3V A;  1VQ9 1;  3RZO I;  1YIJ 1;  1VQO 1;  2J6A A;  2PMZ A;  1Q82 2;  2VPZ A;  1VQN 1;  3S1Q I;  5CM2 M;  1AA6 A;  3S1R I;  3FQM A;  2HU9 A;  4MXU A;  2DE5 A;  3K7A I;  2W04 A;  5FLX b;  1I50 I;  1VQ9 Z;  3NDI A;  2PK7 A;  1YIJ Z;  1ZH1 A;  3CCM 1;  1VQO Z;  1K9M 2;  4MRI A;  5C4J I;  1P9N A;  1ML8 A;  3P5J B;  2OTL 1;  1VQN Z;  3PO3 S;  1YJW 1;  3CXC Y;  2QEX 1;  3FQQ A;  3H3V J;  1WZN A;  2JA6 I;  2VF1 A;  2E2I I;  1I3Q I;  3GCF A;  3S1M I;  4DK1 A;  3I56 1;  5D1O A;  1YHQ 1;  1RO2 A;  1W2B Z;  1Z01 A;  3CCM Z;  1VQM 1;  3S14 I;  1Z02 A;  1YJW Z;  4E33 A;  4BY1 I;  2QEX Z;  5T6B A;  2K3R A;  1WCM I;  4A3J I;  1M1K 1;  3HKZ A;  3VMH A;  3NH5 A;  3CXC Z;  2GTI A;  4TNU A;  4E2Y A;  3GTP I;  5LL6 f;  1YHQ Z;  3I4N I;  4Y52 I;  2VPY A;  1Q81 1;  3OW2 Z;  1USP B;  1N8R 1;  2QRC B;  4MD7 A;  2GTH A;  2IZ3 A;  2IV2 X;  1TWH I;  1VQM Z;  4RVD A;  2QR1 B;  3G6E 1;  1VQ6 1;  1X0T A;  3MZK B;  3KIF A;  3T4N B;  3S15 I;  4NFR A;  1FDO A;  1S72 1;  2I3C A;  3J81 f;  4E2W A;  3TDH B;  1QXF A;  3GTK I;  5D1P A;  1RNI A;  3CPW Z;  4A93 I;  2AYD A;  4E2X A;  1K73 1;  3CC4 1;  4A3E I;  2JIR A;  2QRE B;  3G6E Z;  3CCS 1;  1S7M A;  1VQ6 Z;  2ZAE B;  2M6N A;  3NDJ A;  2OOX B;  1WJ2 A;  3BG0 B;  3G4S 1;  3I4M I;  5T64 A;  1S72 Z;  4A3G I;  4RVG A;  4EWC A;  3CC7 1;  1M90 2;  3IX0 A;  3J80 f;  2V8J A;  3MZL B;  4MD8 A;  1RQF A;  4MD9 A;  2E7Z A;  3CC2 1;  3CCS Z;  4NBD A;  3S2H I;  3HOX I;  5D1O B;  2Q4Z A;  1TWC I;  2QA4 1;  4AYB A;  3CC7 Z;  2E2J I;  4A3I I;  2B63 I;  2OZK A;  1NUI A;  3VMI A;  1K83 I;  3CC2 Z;  3GTM I;  5C44 I;  1WW9 A;  1Q82 1;  4NBG A;  3JAM b;  4A3D I;  1K8A 1;  2DE7 A;  4NOZ A;  1YI2 1;  4CL1 A;  4BXX I;  1TFI A;  2QA4 Z;  1YIT 1;  3HOU I;  4NB9 A;  1QVG Y;  2NAP A;  3GTM S;  2JR6 A;  1ZB9 A;  1R9T I;  4NB8 A;  1ZB8 A;  1K9M 1;  4NBB A;  1RO4 A;  1YI2 Z;  1TWF I;  4RS4 A;  3CCQ 1;  2IZ4 A;  1YIT Z;  2QKD A;  2O53 A;  3VMG A;  1QVG Z;  3S2D I;  1VLA A;  2JMO A;  2RHB A;  2P3Y A;  1X3Z A;  1X3W A;  1VQL 1;  1WII A;  1YJN 1;  3CMA 1;  2KPI A;  4HH4 A;  2V45 A;  5IT9 f; 
#chains in the Genus database with same CATH homology
 3J81 b;  3CCQ Z;  2QRD B;  3TE5 B;  2NVX I;  4S1T A;  3NFZ A;  1YUK A;  1VQ7 1;  1N8R 2;  3VB9 A;  1VQK 1;  2WAQ A;  1VQL Z;  3CMA Z;  1YJN Z;  3GTO I;  1L1O C;  2PM9 A;  4A3B I;  4NBC A;  3D6W A;  5A2Q f;  2P28 A;  2F4M A;  3J80 b;  3NH4 A;  2LIY A;  4NH1 C;  1NJI 1;  2F4O A;  1VQ5 1;  3IF8 A;  3GTJ I;  1Z03 A;  1Q86 2;  1VQ7 Z;  1VQK Z;  5FLM I;  1Y1W I;  3CCV 1;  1LQL A;  3GTL I;  4HGZ A;  3CCU 1;  3BG1 B;  1Q7Y 2;  3EER A;  1KC8 1;  2R7Z I;  1VQ5 Z;  3CCJ 1;  4A3L I;  1M90 1;  1VQP 1;  4E30 A;  1Y1V I;  1KD1 2;  3CCV Z;  1RO0 A;  3GKQ A;  2V8I A;  3ESW A;  3J7A 4;  3CCU Z;  3NH8 A;  3EED A;  4HGY A;  4RVH A;  4Y7N I;  1PFT A;  5AN9 F;  1TWG I;  3CCJ Z;  1N2F A;  3VTN A;  1VQP Z;  2Q51 A;  2BJO A;  1I6H I;  2VUG A;  3HOW I;  4BBS I;  4A3K I;  1JWH C;  1KRL A;  1JJ2 Y;  3CME 1;  4BBR I;  2RBL A;  2YAD A;  1NP6 A;  4MH4 A;  2G2K A;  3U50 C;  3CCL 1;  2JA7 I;  2NVQ I;  2WB1 A;  1K8A 2;  3HOV I;  3PO3 I;  1VQ8 1;  4BY7 I;  2EGT A;  1W2B Y;  3CME Z;  3CCE 1;  5IT9 b;  2R6M A;  3S17 I;  5C4X I;  2V8K A;  2M48 A;  1JJ2 Z;  2OTJ 1;  4QTU A;  2GU2 A;  3HOY I;  3D9X A;  5IP7 I;  3CCL Z;  4XX2 A;  3QWU A;  2JA5 I;  2K5R A;  1VQ4 1;  2JNY A;  1VQ8 Z;  2E9H A;  3OW2 Y;  3I07 A;  3CCE Z;  3LUS A;  3JAM f;  2YU9 I;  2NVY I;  5FLX f;  2KI7 B;  2Y0S A;  3GTG I;  2OTJ Z;  5A2Q b;  4X6A I;  5T67 A;  1QF8 A;  1DL6 A;  3MON A;  2LFU A;  4RV9 A;  1M1K 2;  1VQ4 Z;  3KIH A;  4A3M I;  2OTL Z;  4DQY B;  3PO2 I;  5C3E I;  1QYP A;  3F3F C;  1Q81 2;  3H0G I;  2DE6 A;  2OOY B;  4E32 A;  4E31 A;  4NBH A;  1SFO I;  3I56 Z;  2E2H I;  3CPW Y;  2JUB A;  4A3F I;  3IFU A;  1YJ9 1;  1QVF Y;  2AKL A;  4RVF A;  4E2Z A;  5IP9 I;  2R92 I;  3S1N I;  3M4O I;  4A3C I;  3S16 I;  3G71 1;  3CD6 1;  3M3Y I;  3HOZ I;  2R93 I;  1NJI 2;  1RLY A;  2RT9 A;  1Q86 1;  1YJ9 Z;  1KQS Y;  1K73 2;  2VUM I;  3FKI I;  2HF1 A;  3CCR 1;  1YUA A;  4NBF A;  3CQZ I;  3F3P C;  1QVF Z;  1Q7Y 1;  4DGL A;  3G71 Z;  3CD6 Z;  3Q87 A;  3I55 1;  4NBA A;  1KC8 2;  4MON A;  3RZD I;  1KD1 1;  3CCR Z;  1USP A;  3GTQ I;  2NVT I;  2JS4 A;  1KQS Z;  4QTT A;  2RPR A;  3CC4 Z;  2JA8 I;  2H85 A;  2O4H A;  1Y1V S;  1TWA I;  4NBE A;  3I55 Z;  2W03 A;  2QLV B;  2RIQ A;  3G4S Z;  1VQ9 1;  3RZO I;  1YIJ 1;  1VQO 1;  2J6A A;  2PMZ A;  1Q82 2;  1VQN 1;  3S1Q I;  5CM2 M;  3S1R I;  3FQM A;  2HU9 A;  4MXU A;  2DE5 A;  3K7A I;  2W04 A;  5FLX b;  1I50 I;  1VQ9 Z;  3NDI A;  2PK7 A;  1YIJ Z;  1ZH1 A;  3CCM 1;  1VQO Z;  1K9M 2;  4MRI A;  5C4J I;  1P9N A;  1ML8 A;  3P5J B;  2OTL 1;  1VQN Z;  3PO3 S;  1YJW 1;  3CXC Y;  2QEX 1;  3FQQ A;  3H3V J;  2JA6 I;  2VF1 A;  2E2I I;  1I3Q I;  3GCF A;  3S1M I;  4DK1 A;  3I56 1;  5D1O A;  1YHQ 1;  1RO2 A;  1W2B Z;  1Z01 A;  3CCM Z;  1VQM 1;  3S14 I;  1Z02 A;  1YJW Z;  4E33 A;  4BY1 I;  2QEX Z;  5T6B A;  2K3R A;  1WCM I;  4A3J I;  1M1K 1;  3HKZ A;  3VMH A;  3NH5 A;  3CXC Z;  2GTI A;  4TNU A;  4E2Y A;  3GTP I;  5LL6 f;  1YHQ Z;  3I4N I;  4Y52 I;  1Q81 1;  3OW2 Z;  1USP B;  1N8R 1;  2QRC B;  4MD7 A;  2GTH A;  2IZ3 A;  1TWH I;  1VQM Z;  4RVD A;  2QR1 B;  3G6E 1;  1VQ6 1;  1X0T A;  3MZK B;  3KIF A;  3T4N B;  3S15 I;  4NFR A;  1S72 1;  2I3C A;  3J81 f;  4E2W A;  3TDH B;  3GTK I;  5D1P A;  1RNI A;  3CPW Z;  4A93 I;  4E2X A;  1K73 1;  3CC4 1;  4A3E I;  2QRE B;  3G6E Z;  3CCS 1;  1S7M A;  1VQ6 Z;  2ZAE B;  2M6N A;  3NDJ A;  2OOX B;  3BG0 B;  3G4S 1;  3I4M I;  5T64 A;  1S72 Z;  4A3G I;  4RVG A;  4EWC A;  3CC7 1;  1M90 2;  3IX0 A;  3J80 f;  2V8J A;  3MZL B;  4MD8 A;  1RQF A;  4MD9 A;  3CC2 1;  3CCS Z;  4NBD A;  3S2H I;  3HOX I;  5D1O B;  2Q4Z A;  1TWC I;  2QA4 1;  4AYB A;  3CC7 Z;  2E2J I;  4A3I I;  2B63 I;  2OZK A;  1NUI A;  3VMI A;  1K83 I;  3CC2 Z;  3GTM I;  5C44 I;  1WW9 A;  1Q82 1;  4NBG A;  3JAM b;  4A3D I;  1K8A 1;  2DE7 A;  4NOZ A;  1YI2 1;  4CL1 A;  4BXX I;  1TFI A;  2QA4 Z;  1YIT 1;  3HOU I;  4NB9 A;  1QVG Y;  3GTM S;  2JR6 A;  1ZB9 A;  1R9T I;  4NB8 A;  1ZB8 A;  1K9M 1;  4NBB A;  1RO4 A;  1YI2 Z;  1TWF I;  4RS4 A;  3CCQ 1;  2IZ4 A;  1YIT Z;  2QKD A;  2O53 A;  3VMG A;  1QVG Z;  3S2D I;  1VLA A;  2JMO A;  2RHB A;  2P3Y A;  1X3Z A;  1X3W A;  1VQL 1;  1WII A;  1YJN 1;  3CMA 1;  2KPI A;  4HH4 A;  5IT9 f; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...