5A2Qf

Structure of the hcv ires bound to the human ribosome
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
72
structure length
72
Chain Sequence
KKRKKKSCTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cryo-Em Structure of Hepatitis C Virus Ires Bound to the Human Ribosome at 3.9 Angstrom Resolution
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 18S RRNA
total genus 5
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF01599 Ribosomal_S27 Ribosomal protein S27a
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.660 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5a2qf00
3JAMf 3J81f 5IT9f 5A2Qf 3J80f 5FLXf
chains in the Genus database with same CATH superfamily
1X3ZA 4CL1A 5A2Qf 1SFOI 2PMZA 4QTUA 3VMIA 1TWFI 4NH1C 1KD11 3T4NB 1M902 3VB9A 2V8JA 3CPWY 3H3VJ 2JIPA 5T67A 3CCQZ 4A93I 2B63I 1K731 1K8A1 3GTMI 2R93I 1YHQZ 3S17I 2OZKA 3S2HI 4RS4A 3HOYI 3HOVI 2V3VA 2NAPA 4Y52I 2DE5A 2IV2X 2VPZA 5IT9f 4MXUA 1AA6A 3S2DI 2HF1A 3J80b 2IZ3A 3CCQ1 2P28A 1Z02A 2DE6A 3KIFA 1VQ51 1YITZ 2F4OA 3CCL1 1K9M2 4NBDA 3G71Z 3Q87A 2Q4ZA 4NBHA 1YIJZ 2VPYA 2O4HA 4E2WA 2RT9A 4NB8A 3F3PC 3M4OI 1FDIA 2JIRA 3CQZI 1RNIA 1Q16A 2JA6I 4HGZA 1VQ71 1NJI1 3QWUA 4X6AI 4E31A 5FLXb 1WIIA 3CXCY 1N8R2 4E33A 2EGTA 3HOZI 2H85A 4MH4A 1RO0A 2OTJ1 1YJN1 1VQLZ 1Y1VI 1M1K2 4MD8A 3FKII 3NDJA 1VQ41 4A3GI 2JNYA 1S72Z 1WZNA 3CXCZ 1YIJ1 5T6BA 2J6AA 3S1NI 3J81f 1NJI2 1QXFA 3HOXI 1VQO1 2I3CA 1ZB8A 2KI7B 4A3BI 2PK7A 3I561 3JAMf 1Y1VS 3HKZA 3K7AI 2DE7A 1VQPZ 1YI2Z 5FLMI 3GTOI 2QR1B 3J80f 1QVFY 1YI21 3LUSA 5T64A 4A3MI 4MD7A 2LEXA 4RVHA 3I56Z 3NDIA 1VQN1 1W2BY 1VQK1 1K9M1 3GTPI 1VQOZ 4A3DI 3EERA 1VQMZ 3MZLB 1S721 1YHQ1 3D6WA 2JA7I 1Y1WI 2W03A 1TFIA 3H0GI 5C44I 1FDOA 2OOXB 2WAQA 3CCE1 1W2BZ 3NFZA 4A3EI 2O53A 4DK1A 1X0TA 3CCMZ 3GTQI 2V45A 2OTL1 3MONA 2OTJZ 1PFTA 3KIHA 3CD61 3PO3S 3GTJI 2YADA 3S1RI 3BG0B 1VLAA 3I07A 4RVDA 3CCU1 4RV9A 3CD6Z 4AYBA 1SIWA 4DQYB 1KC82 3CCSZ 2V8KA 4RVFA 2R92I 3BG1B 4BXXI 3CCVZ 2ZAEB 2VUGA 2RHBA 1VQ9Z 1S7MA 3CCJ1 3IR7A 4NFRA 5CM2M 3I551 2AYDA 2JIMA 1QVGZ 2E2II 2K3RA 5FLXf 5D1PA 1Q822 4E30A 1VQKZ 4MRIA 2VPWA 5D1OB 4TNUA 1ML8A 3G711 3GTLI 1VQ5Z 3JAMb 2RPRA 1Q821 1VQ6Z 5C4JI 3S16I 4BY1I 1YJWZ 3S14I 2QREB 1WCMI 1M901 4HH4A 3OW2Y 2Y0SA 2QLVB 4XX2A 3HOUI 2AKLA 2IZ4A 1P9NA 4A3CI 3TDHB 4NBBA 1X3WA 4A3FI 1QYPA 5IP7I 3OW2Z 3I55Z 1TWAI 1RQFA 2JMOA 2JA8I 4NBEA 3CPWZ 2LFUA 1VQ8Z 2RBLA 3CMAZ 4E2YA 3CC2Z 4HGYA 2JIQA 2VPXA 2E9HA 2QRDB 3P5JB 4A3II 1KD12 1K83I 1VQ7Z 1Y8CA 4NBFA 1I3QI 1YUAA 3GKQA 1ZB9A 3G4SZ 3CMA1 2NVQI 3CCM1 3I4NI 5A2Qb 3G4S1 2R7ZI 1KRLA 5AN9F 2BJOA 2Q51A 1I50I 3FQQA 4BBSI 2QRCB 1Q7Y1 1NUIA 2E2HI 1DL6A 2KPIA 2JIOA 2R6MA 2NVTI 1YUKA 1VQNZ 2NVYI 1LQLA 1QVFZ 3CCLZ 3NH5A 5C3EI 3IF8A 4DGLA 1ZH1A 4S1TA 3VMHA 4A3KI 1RLYA 2JR6A 1KQSZ 4MD9A 1N2FA 1RO2A 1VQP1 2QEX1 4NBAA 3D9XA 2YU9I 2LIYA 4E2ZA 1YJW1 1QVGY 1JJ2Z 1N8R1 1TWHI 2GTHA 2JUBA 2M6NA 1VQ61 3TE5B 3CCJZ 2W04A 1KQSY 2M48A 1VQ4Z 3FQMA 3RZOI 3GCFA 3CCV1 2GU2A 1TWCI 1Q811 1VQL1 3NH8A 1Q861 3PO3I 3S1QI 1K732 4E2XA 3RZDI 2G2KA 1JJ2Y 1VQ91 3VMGA 1R9TI 1RO4A 2OTLZ 1JWHC 1TWGI 1M1K1 4RVGA 2F4MA 3ESWA 3F3FC 2JA5I 4A3LI 2RIQA 3CCS1 3PO2I 1YJ91 5C4XI 1VQM1 3G6EZ 1USPA 3CC21 5IP9I 2VUMI 1NP6A 3I4MI 4QTTA 3CC4Z 4EWCA 4NB9A 1VQ81 3CCEZ 1YIT1 3EEDA 4NBGA 2HU9A 1Q862 3D2LA 2OOYB 3CCRZ 5IT9b 3S15I 2QA41 3J81b 1I6HI 2VF1A 3CME1 1Q812 3CC7Z 3U50C 1L1OC 3S1MI 4BY7I 1USPB 3CC71 2JS4A 5D1OA 4BBRI 3CMEZ 2QA4Z 3GTKI 2QKDA 3CCR1 1Z03A 2PM9A 2QEXZ 1QF8A 3GTMS 3VTNA 2P3YA 1WJ2A 2WB1A 4E32A 2K5RA 1WW9A 2GTIA 3M3YI 2V8IA 3IFUA 3CC41 1YJNZ 3IX0A 1KC81 5LL6f 4Y7NI 3MZKB 1YJ9Z 3G6E1 2NVXI 4MONA 1K8A2 3J7A4 3HOWI 3NH4A 3GTGI 2E2JI 1Z01A 4A3JI 4NBCA 2E7ZA 1Q7Y2 3CCUZ 4NOZA
chains in the Genus database with same CATH topology
1X3ZA 4CL1A 5A2Qf 1SFOI 2PMZA 4QTUA 3VMIA 1TWFI 4NH1C 1KD11 3T4NB 1M902 3VB9A 2V8JA 3CPWY 3H3VJ 5T67A 3CCQZ 4A93I 2B63I 1K731 1K8A1 3GTMI 2R93I 1YHQZ 3S17I 2OZKA 3S2HI 4RS4A 3HOYI 3HOVI 4Y52I 2DE5A 5IT9f 4MXUA 3S2DI 2HF1A 3J80b 2IZ3A 3CCQ1 2P28A 1Z02A 2DE6A 3KIFA 1VQ51 1YITZ 2F4OA 3CCL1 1K9M2 4NBDA 3G71Z 3Q87A 2Q4ZA 4NBHA 1YIJZ 2O4HA 4E2WA 2RT9A 4NB8A 3F3PC 3M4OI 3CQZI 1RNIA 2JA6I 4HGZA 1VQ71 1NJI1 3QWUA 4X6AI 4E31A 5FLXb 1WIIA 3CXCY 1N8R2 4E33A 2EGTA 3HOZI 2H85A 4MH4A 1RO0A 2OTJ1 1YJN1 1VQLZ 1Y1VI 1M1K2 4MD8A 3FKII 3NDJA 1VQ41 4A3GI 2JNYA 1S72Z 3CXCZ 1YIJ1 5T6BA 2J6AA 3S1NI 3J81f 1NJI2 3HOXI 1VQO1 2I3CA 1ZB8A 2KI7B 4A3BI 2PK7A 3I561 3JAMf 1Y1VS 3HKZA 3K7AI 2DE7A 1VQPZ 1YI2Z 5FLMI 3GTOI 2QR1B 3J80f 1QVFY 1YI21 3LUSA 5T64A 4A3MI 4MD7A 4RVHA 3I56Z 3NDIA 1VQN1 1W2BY 1VQK1 1K9M1 3GTPI 1VQOZ 4A3DI 3EERA 1VQMZ 3MZLB 1S721 1YHQ1 3D6WA 2JA7I 1Y1WI 2W03A 1TFIA 3H0GI 5C44I 1W2BZ 2OOXB 2WAQA 3CCE1 3NFZA 4A3EI 2O53A 4DK1A 1X0TA 3CCMZ 3GTQI 2OTL1 3MONA 2OTJZ 1PFTA 3KIHA 3CD61 3PO3S 3GTJI 2YADA 3S1RI 3BG0B 1VLAA 3I07A 4RVDA 3CCU1 4RV9A 3CD6Z 4AYBA 4DQYB 1KC82 2V8KA 3CCSZ 4RVFA 2R92I 3BG1B 4BXXI 3CCVZ 2ZAEB 2VUGA 2RHBA 1VQ9Z 1S7MA 3CCJ1 4NFRA 5CM2M 3I551 1QVGZ 2E2II 2K3RA 5FLXf 5D1PA 1Q822 4E30A 1VQKZ 4MRIA 5D1OB 4TNUA 1ML8A 3G711 3GTLI 1VQ5Z 3JAMb 2RPRA 1Q821 1VQ6Z 5C4JI 3S16I 4BY1I 1YJWZ 3S14I 2QREB 1WCMI 1M901 4HH4A 3OW2Y 2Y0SA 2QLVB 4XX2A 3HOUI 2AKLA 2IZ4A 1P9NA 4A3CI 3TDHB 4NBBA 1X3WA 4A3FI 1QYPA 5IP7I 3OW2Z 3I55Z 1TWAI 1RQFA 2JMOA 2JA8I 4NBEA 3CPWZ 2LFUA 1VQ8Z 2RBLA 3CMAZ 4E2YA 3CC2Z 4HGYA 2E9HA 2QRDB 3P5JB 4A3II 1KD12 1K83I 1VQ7Z 4NBFA 1I3QI 1YUAA 3GKQA 1ZB9A 3G4SZ 3CMA1 2NVQI 3CCM1 3I4NI 5A2Qb 3G4S1 2R7ZI 1KRLA 5AN9F 2BJOA 2Q51A 1I50I 3FQQA 4BBSI 2QRCB 1Q7Y1 1NUIA 2E2HI 1DL6A 2KPIA 2R6MA 2NVTI 1YUKA 1VQNZ 2NVYI 1LQLA 1QVFZ 3CCLZ 3NH5A 5C3EI 3IF8A 4DGLA 1ZH1A 4S1TA 3VMHA 4A3KI 1RLYA 2JR6A 1KQSZ 4MD9A 1N2FA 1RO2A 1VQP1 2QEX1 4NBAA 3D9XA 2YU9I 2LIYA 4E2ZA 1YJW1 1QVGY 1JJ2Z 1N8R1 1TWHI 2GTHA 2JUBA 2M6NA 1VQ61 3TE5B 3CCJZ 2W04A 1KQSY 2M48A 1VQ4Z 3FQMA 3RZOI 3GCFA 3CCV1 2GU2A 1TWCI 1Q811 1VQL1 3NH8A 1Q861 3PO3I 3S1QI 1K732 4E2XA 3RZDI 2G2KA 1JJ2Y 1VQ91 3VMGA 1R9TI 1RO4A 2OTLZ 1JWHC 1TWGI 1M1K1 4RVGA 2F4MA 3ESWA 3F3FC 2JA5I 4A3LI 2RIQA 3CCS1 3PO2I 1YJ91 5C4XI 1VQM1 3G6EZ 1USPA 3CC21 5IP9I 2VUMI 1NP6A 3I4MI 4QTTA 3CC4Z 4EWCA 4NB9A 1VQ81 3CCEZ 3EEDA 1YIT1 4NBGA 2HU9A 1Q862 2OOYB 3CCRZ 5IT9b 3S15I 2QA41 3J81b 1I6HI 2VF1A 3CME1 1Q812 3CC7Z 3U50C 1L1OC 3S1MI 4BY7I 1USPB 3CC71 2JS4A 5D1OA 4BBRI 3CMEZ 2QA4Z 3GTKI 2QKDA 3CCR1 1Z03A 2PM9A 2QEXZ 1QF8A 3GTMS 3VTNA 2P3YA 2WB1A 4E32A 2K5RA 1WW9A 2GTIA 3M3YI 2V8IA 3IFUA 3CC41 1YJNZ 3IX0A 1KC81 5LL6f 4Y7NI 3MZKB 1YJ9Z 3G6E1 2NVXI 4MONA 1K8A2 3J7A4 3HOWI 3NH4A 3GTGI 2E2JI 1Z01A 4A3JI 4NBCA 1Q7Y2 3CCUZ 4NOZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAM f;  3J81 f;  5IT9 f;  5A2Q f;  3J80 f;  5FLX f; 
#chains in the Genus database with same CATH topology
 1X3Z A;  4CL1 A;  5A2Q f;  1SFO I;  2PMZ A;  4QTU A;  3VMI A;  1TWF I;  4NH1 C;  1KD1 1;  3T4N B;  1M90 2;  3VB9 A;  2V8J A;  3CPW Y;  3H3V J;  2JIP A;  5T67 A;  3CCQ Z;  4A93 I;  2B63 I;  1K73 1;  1K8A 1;  3GTM I;  2R93 I;  1YHQ Z;  3S17 I;  2OZK A;  3S2H I;  4RS4 A;  3HOY I;  3HOV I;  2V3V A;  2NAP A;  4Y52 I;  2DE5 A;  2IV2 X;  2VPZ A;  5IT9 f;  4MXU A;  1AA6 A;  3S2D I;  2HF1 A;  3J80 b;  2IZ3 A;  3CCQ 1;  2P28 A;  1Z02 A;  2DE6 A;  3KIF A;  1VQ5 1;  1YIT Z;  2F4O A;  3CCL 1;  1K9M 2;  4NBD A;  3G71 Z;  3Q87 A;  2Q4Z A;  4NBH A;  1YIJ Z;  2VPY A;  2O4H A;  4E2W A;  2RT9 A;  4NB8 A;  3F3P C;  3M4O I;  1FDI A;  2JIR A;  3CQZ I;  1RNI A;  1Q16 A;  2JA6 I;  4HGZ A;  1VQ7 1;  1NJI 1;  3QWU A;  4X6A I;  4E31 A;  5FLX b;  1WII A;  3CXC Y;  1N8R 2;  4E33 A;  2EGT A;  3HOZ I;  2H85 A;  4MH4 A;  1RO0 A;  2OTJ 1;  1YJN 1;  1VQL Z;  1Y1V I;  1M1K 2;  4MD8 A;  3FKI I;  3NDJ A;  1VQ4 1;  4A3G I;  2JNY A;  1S72 Z;  1WZN A;  3CXC Z;  1YIJ 1;  5T6B A;  2J6A A;  3S1N I;  3J81 f;  1NJI 2;  1QXF A;  3HOX I;  1VQO 1;  2I3C A;  1ZB8 A;  2KI7 B;  4A3B I;  2PK7 A;  3I56 1;  3JAM f;  1Y1V S;  3HKZ A;  3K7A I;  2DE7 A;  1VQP Z;  1YI2 Z;  5FLM I;  3GTO I;  2QR1 B;  3J80 f;  1QVF Y;  1YI2 1;  3LUS A;  5T64 A;  4A3M I;  4MD7 A;  2LEX A;  4RVH A;  3I56 Z;  3NDI A;  1VQN 1;  1W2B Y;  1VQK 1;  1K9M 1;  3GTP I;  1VQO Z;  4A3D I;  3EER A;  1VQM Z;  3MZL B;  1S72 1;  1YHQ 1;  3D6W A;  2JA7 I;  1Y1W I;  2W03 A;  1TFI A;  3H0G I;  5C44 I;  1FDO A;  2OOX B;  2WAQ A;  3CCE 1;  1W2B Z;  3NFZ A;  4A3E I;  2O53 A;  4DK1 A;  1X0T A;  3CCM Z;  3GTQ I;  2V45 A;  2OTL 1;  3MON A;  2OTJ Z;  1PFT A;  3KIH A;  3CD6 1;  3PO3 S;  3GTJ I;  2YAD A;  3S1R I;  3BG0 B;  1VLA A;  3I07 A;  4RVD A;  3CCU 1;  4RV9 A;  3CD6 Z;  4AYB A;  1SIW A;  4DQY B;  1KC8 2;  3CCS Z;  2V8K A;  4RVF A;  2R92 I;  3BG1 B;  4BXX I;  3CCV Z;  2ZAE B;  2VUG A;  2RHB A;  1VQ9 Z;  1S7M A;  3CCJ 1;  3IR7 A;  4NFR A;  5CM2 M;  3I55 1;  2AYD A;  2JIM A;  1QVG Z;  2E2I I;  2K3R A;  5FLX f;  5D1P A;  1Q82 2;  4E30 A;  1VQK Z;  4MRI A;  2VPW A;  5D1O B;  4TNU A;  1ML8 A;  3G71 1;  3GTL I;  1VQ5 Z;  3JAM b;  2RPR A;  1Q82 1;  1VQ6 Z;  5C4J I;  3S16 I;  4BY1 I;  1YJW Z;  3S14 I;  2QRE B;  1WCM I;  1M90 1;  4HH4 A;  3OW2 Y;  2Y0S A;  2QLV B;  4XX2 A;  3HOU I;  2AKL A;  2IZ4 A;  1P9N A;  4A3C I;  3TDH B;  4NBB A;  1X3W A;  4A3F I;  1QYP A;  5IP7 I;  3OW2 Z;  3I55 Z;  1TWA I;  1RQF A;  2JMO A;  2JA8 I;  4NBE A;  3CPW Z;  2LFU A;  1VQ8 Z;  2RBL A;  3CMA Z;  4E2Y A;  3CC2 Z;  4HGY A;  2JIQ A;  2VPX A;  2E9H A;  2QRD B;  3P5J B;  4A3I I;  1KD1 2;  1K83 I;  1VQ7 Z;  1Y8C A;  4NBF A;  1I3Q I;  1YUA A;  3GKQ A;  1ZB9 A;  3G4S Z;  3CMA 1;  2NVQ I;  3CCM 1;  3I4N I;  5A2Q b;  3G4S 1;  2R7Z I;  1KRL A;  5AN9 F;  2BJO A;  2Q51 A;  1I50 I;  3FQQ A;  4BBS I;  2QRC B;  1Q7Y 1;  1NUI A;  2E2H I;  1DL6 A;  2KPI A;  2JIO A;  2R6M A;  2NVT I;  1YUK A;  1VQN Z;  2NVY I;  1LQL A;  1QVF Z;  3CCL Z;  3NH5 A;  5C3E I;  3IF8 A;  4DGL A;  1ZH1 A;  4S1T A;  3VMH A;  4A3K I;  1RLY A;  2JR6 A;  1KQS Z;  4MD9 A;  1N2F A;  1RO2 A;  1VQP 1;  2QEX 1;  4NBA A;  3D9X A;  2YU9 I;  2LIY A;  4E2Z A;  1YJW 1;  1QVG Y;  1JJ2 Z;  1N8R 1;  1TWH I;  2GTH A;  2JUB A;  2M6N A;  1VQ6 1;  3TE5 B;  3CCJ Z;  2W04 A;  1KQS Y;  2M48 A;  1VQ4 Z;  3FQM A;  3RZO I;  3GCF A;  3CCV 1;  2GU2 A;  1TWC I;  1Q81 1;  1VQL 1;  3NH8 A;  1Q86 1;  3PO3 I;  3S1Q I;  1K73 2;  4E2X A;  3RZD I;  2G2K A;  1JJ2 Y;  1VQ9 1;  3VMG A;  1R9T I;  1RO4 A;  2OTL Z;  1JWH C;  1TWG I;  1M1K 1;  4RVG A;  2F4M A;  3ESW A;  3F3F C;  2JA5 I;  4A3L I;  2RIQ A;  3CCS 1;  3PO2 I;  1YJ9 1;  5C4X I;  1VQM 1;  3G6E Z;  1USP A;  3CC2 1;  5IP9 I;  2VUM I;  1NP6 A;  3I4M I;  4QTT A;  3CC4 Z;  4EWC A;  4NB9 A;  1VQ8 1;  3CCE Z;  1YIT 1;  3EED A;  4NBG A;  2HU9 A;  1Q86 2;  3D2L A;  2OOY B;  3CCR Z;  5IT9 b;  3S15 I;  2QA4 1;  3J81 b;  1I6H I;  2VF1 A;  3CME 1;  1Q81 2;  3CC7 Z;  3U50 C;  1L1O C;  3S1M I;  4BY7 I;  1USP B;  3CC7 1;  2JS4 A;  5D1O A;  4BBR I;  3CME Z;  2QA4 Z;  3GTK I;  2QKD A;  3CCR 1;  1Z03 A;  2PM9 A;  2QEX Z;  1QF8 A;  3GTM S;  3VTN A;  2P3Y A;  1WJ2 A;  2WB1 A;  4E32 A;  2K5R A;  1WW9 A;  2GTI A;  3M3Y I;  2V8I A;  3IFU A;  3CC4 1;  1YJN Z;  3IX0 A;  1KC8 1;  5LL6 f;  4Y7N I;  3MZK B;  1YJ9 Z;  3G6E 1;  2NVX I;  4MON A;  1K8A 2;  3J7A 4;  3HOW I;  3NH4 A;  3GTG I;  2E2J I;  1Z01 A;  4A3J I;  4NBC A;  2E7Z A;  1Q7Y 2;  3CCU Z;  4NOZ A; 
#chains in the Genus database with same CATH homology
 1X3Z A;  4CL1 A;  5A2Q f;  1SFO I;  2PMZ A;  4QTU A;  3VMI A;  1TWF I;  4NH1 C;  1KD1 1;  3T4N B;  1M90 2;  3VB9 A;  2V8J A;  3CPW Y;  3H3V J;  5T67 A;  3CCQ Z;  4A93 I;  2B63 I;  1K73 1;  1K8A 1;  3GTM I;  2R93 I;  1YHQ Z;  3S17 I;  2OZK A;  3S2H I;  4RS4 A;  3HOY I;  3HOV I;  4Y52 I;  2DE5 A;  5IT9 f;  4MXU A;  3S2D I;  2HF1 A;  3J80 b;  2IZ3 A;  3CCQ 1;  2P28 A;  1Z02 A;  2DE6 A;  3KIF A;  1VQ5 1;  1YIT Z;  2F4O A;  3CCL 1;  1K9M 2;  4NBD A;  3G71 Z;  3Q87 A;  2Q4Z A;  4NBH A;  1YIJ Z;  2O4H A;  4E2W A;  2RT9 A;  4NB8 A;  3F3P C;  3M4O I;  3CQZ I;  1RNI A;  2JA6 I;  4HGZ A;  1VQ7 1;  1NJI 1;  3QWU A;  4X6A I;  4E31 A;  5FLX b;  1WII A;  3CXC Y;  1N8R 2;  4E33 A;  2EGT A;  3HOZ I;  2H85 A;  4MH4 A;  1RO0 A;  2OTJ 1;  1YJN 1;  1VQL Z;  1Y1V I;  1M1K 2;  4MD8 A;  3FKI I;  3NDJ A;  1VQ4 1;  4A3G I;  2JNY A;  1S72 Z;  3CXC Z;  1YIJ 1;  5T6B A;  2J6A A;  3S1N I;  3J81 f;  1NJI 2;  3HOX I;  1VQO 1;  2I3C A;  1ZB8 A;  2KI7 B;  4A3B I;  2PK7 A;  3I56 1;  3JAM f;  1Y1V S;  3HKZ A;  3K7A I;  2DE7 A;  1VQP Z;  1YI2 Z;  5FLM I;  3GTO I;  2QR1 B;  3J80 f;  1QVF Y;  1YI2 1;  3LUS A;  5T64 A;  4A3M I;  4MD7 A;  4RVH A;  3I56 Z;  3NDI A;  1VQN 1;  1W2B Y;  1VQK 1;  1K9M 1;  3GTP I;  1VQO Z;  4A3D I;  3EER A;  1VQM Z;  3MZL B;  1S72 1;  1YHQ 1;  3D6W A;  2JA7 I;  1Y1W I;  2W03 A;  1TFI A;  3H0G I;  5C44 I;  1W2B Z;  2OOX B;  2WAQ A;  3CCE 1;  3NFZ A;  4A3E I;  2O53 A;  4DK1 A;  1X0T A;  3CCM Z;  3GTQ I;  2OTL 1;  3MON A;  2OTJ Z;  1PFT A;  3KIH A;  3CD6 1;  3PO3 S;  3GTJ I;  2YAD A;  3S1R I;  3BG0 B;  1VLA A;  3I07 A;  4RVD A;  3CCU 1;  4RV9 A;  3CD6 Z;  4AYB A;  4DQY B;  1KC8 2;  2V8K A;  3CCS Z;  4RVF A;  2R92 I;  3BG1 B;  4BXX I;  3CCV Z;  2ZAE B;  2VUG A;  2RHB A;  1VQ9 Z;  1S7M A;  3CCJ 1;  4NFR A;  5CM2 M;  3I55 1;  1QVG Z;  2E2I I;  2K3R A;  5FLX f;  5D1P A;  1Q82 2;  4E30 A;  1VQK Z;  4MRI A;  5D1O B;  4TNU A;  1ML8 A;  3G71 1;  3GTL I;  1VQ5 Z;  3JAM b;  2RPR A;  1Q82 1;  1VQ6 Z;  5C4J I;  3S16 I;  4BY1 I;  1YJW Z;  3S14 I;  2QRE B;  1WCM I;  1M90 1;  4HH4 A;  3OW2 Y;  2Y0S A;  2QLV B;  4XX2 A;  3HOU I;  2AKL A;  2IZ4 A;  1P9N A;  4A3C I;  3TDH B;  4NBB A;  1X3W A;  4A3F I;  1QYP A;  5IP7 I;  3OW2 Z;  3I55 Z;  1TWA I;  1RQF A;  2JMO A;  2JA8 I;  4NBE A;  3CPW Z;  2LFU A;  1VQ8 Z;  2RBL A;  3CMA Z;  4E2Y A;  3CC2 Z;  4HGY A;  2E9H A;  2QRD B;  3P5J B;  4A3I I;  1KD1 2;  1K83 I;  1VQ7 Z;  4NBF A;  1I3Q I;  1YUA A;  3GKQ A;  1ZB9 A;  3G4S Z;  3CMA 1;  2NVQ I;  3CCM 1;  3I4N I;  5A2Q b;  3G4S 1;  2R7Z I;  1KRL A;  5AN9 F;  2BJO A;  2Q51 A;  1I50 I;  3FQQ A;  4BBS I;  2QRC B;  1Q7Y 1;  1NUI A;  2E2H I;  1DL6 A;  2KPI A;  2R6M A;  2NVT I;  1YUK A;  1VQN Z;  2NVY I;  1LQL A;  1QVF Z;  3CCL Z;  3NH5 A;  5C3E I;  3IF8 A;  4DGL A;  1ZH1 A;  4S1T A;  3VMH A;  4A3K I;  1RLY A;  2JR6 A;  1KQS Z;  4MD9 A;  1N2F A;  1RO2 A;  1VQP 1;  2QEX 1;  4NBA A;  3D9X A;  2YU9 I;  2LIY A;  4E2Z A;  1YJW 1;  1QVG Y;  1JJ2 Z;  1N8R 1;  1TWH I;  2GTH A;  2JUB A;  2M6N A;  1VQ6 1;  3TE5 B;  3CCJ Z;  2W04 A;  1KQS Y;  2M48 A;  1VQ4 Z;  3FQM A;  3RZO I;  3GCF A;  3CCV 1;  2GU2 A;  1TWC I;  1Q81 1;  1VQL 1;  3NH8 A;  1Q86 1;  3PO3 I;  3S1Q I;  1K73 2;  4E2X A;  3RZD I;  2G2K A;  1JJ2 Y;  1VQ9 1;  3VMG A;  1R9T I;  1RO4 A;  2OTL Z;  1JWH C;  1TWG I;  1M1K 1;  4RVG A;  2F4M A;  3ESW A;  3F3F C;  2JA5 I;  4A3L I;  2RIQ A;  3CCS 1;  3PO2 I;  1YJ9 1;  5C4X I;  1VQM 1;  3G6E Z;  1USP A;  3CC2 1;  5IP9 I;  2VUM I;  1NP6 A;  3I4M I;  4QTT A;  3CC4 Z;  4EWC A;  4NB9 A;  1VQ8 1;  3CCE Z;  3EED A;  1YIT 1;  4NBG A;  2HU9 A;  1Q86 2;  2OOY B;  3CCR Z;  5IT9 b;  3S15 I;  2QA4 1;  3J81 b;  1I6H I;  2VF1 A;  3CME 1;  1Q81 2;  3CC7 Z;  3U50 C;  1L1O C;  3S1M I;  4BY7 I;  1USP B;  3CC7 1;  2JS4 A;  5D1O A;  4BBR I;  3CME Z;  2QA4 Z;  3GTK I;  2QKD A;  3CCR 1;  1Z03 A;  2PM9 A;  2QEX Z;  1QF8 A;  3GTM S;  3VTN A;  2P3Y A;  2WB1 A;  4E32 A;  2K5R A;  1WW9 A;  2GTI A;  3M3Y I;  2V8I A;  3IFU A;  3CC4 1;  1YJN Z;  3IX0 A;  1KC8 1;  5LL6 f;  4Y7N I;  3MZK B;  1YJ9 Z;  3G6E 1;  2NVX I;  4MON A;  1K8A 2;  3J7A 4;  3HOW I;  3NH4 A;  3GTG I;  2E2J I;  1Z01 A;  4A3J I;  4NBC A;  1Q7Y 2;  3CCU Z;  4NOZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...