4A3LI

Rna polymerase ii initial transcribing complex with a 7nt dna-rna hybrid and soaked with ampcpp
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 13
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3lI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3lI02
1X3ZA 4X6AI 5IP9I 3GTPI 3S2HI 2JA6I 2PK7A 4NBHA 5CM2M 4BY7I 3VMGA 5FLMI 4A3CI 4XX2A 2B63I 4A3JI 4BBRI 4A3KI 4A3BI 4NB8A 2KPIA 1DL6A 1TFIA 3GTMI 3GKQA 4A3EI 2YU9I 3H3VJ 3HOVI 1PFTA 4A3LI 3M3YI 3GTMS 2NVQI 2E2HI 1TWHI 2DE7A 4A3II 3M4OI 2VUMI 2BJOA 2P3YA 5C4JI 1WW9A 1USPB 2NVYI 3D6WA 3GTKI 1TWAI 3HOXI 2NVXI 3U50C 4NOZA 2JA7I 1USPA 3Q87A 1Y1VI 3CQZI 4NBCA 3I4NI 3VB9A 1RO4A 4BXXI 4Y7NI 3PO3I 1ZB8A 3RZOI 1WCMI 3VMIA 1Y1VS 2JA5I 3H0GI 3VMHA 3PO3S 1TWCI 2HF1A 4Y52I 1ZB9A 3I4MI 3S1NI 4NBBA 4NBAA 1TWFI 3LUSA 3K7AI 3GTJI 1R9TI 4BBSI 5C3EI 3S15I 1VLAA 3GCFA 2NVTI 2E2II 3HOWI 4A3DI 4A3FI 2R93I 2F4OA 2J6AA 1I3QI 3HOYI 1I6HI 3GTQI 2RBLA 2JNYA 2JA8I 2DE6A 3FKII 5IP7I 3GTGI 4QTUA 1QYPA 3S2DI 4NB9A 3S1RI 4MH4A 4A3MI 1SFOI 4BY1I 1RLYA 2R92I 1NUIA 3EERA 5C44I 4NBFA 3GTLI 1L1OC 3HOUI 2AKLA 4NBEA 1K83I 2E2JI 2JR6A 1I50I 2K5RA 2JS4A 1Y1WI 3RZDI 1LQLA 3S14I 1ML8A 5C4XI 3ESWA 4A3GI 3I07A 3GTOI 1N2FA 3S1MI 4NBGA 2F4MA 4NBDA 4QTTA 3S16I 3S1QI 3PO2I 1TWGI 3HOZI 3S17I 4A93I 1X3WA 1YUAA 2DE5A 2R7ZI
chains in the Genus database with same CATH superfamily
3GTPI 1ZH1A 3S2HI 2PK7A 5CM2M 1VQM1 3VMGA 5FLMI 3CCRZ 1K731 1VQNZ 4BBRI 4A3BI 1DL6A 1VQ41 5IT9f 4RS4A 3GKQA 1YHQZ 2GTIA 3CCLZ 4A3EI 4MD9A 2VPWA 1PFTA 1AA6A 1K732 3NFZA 1S721 3M3YI 3BG1B 1JJ2Y 3JAMb 1W2BZ 4A3II 3M4OI 2P3YA 1VQPZ 3QWUA 1QXFA 1USPA 1Y1VI 3KIFA 3MZKB 2VPYA 2OTJ1 3BG0B 4Y7NI 3G6E1 5A2Qf 3CCJZ 1Z02A 2V8IA 3H0GI 1Q7Y1 2E9HA 2HF1A 4Y52I 1ZB9A 3S1NI 3CCEZ 1YI21 3D2LA 1Z03A 4BBSI 2W04A 3GCFA 4A3DI 4HGYA 2QEX1 2J6AA 2V8KA 2RHBA 3CCU1 3CCQZ 1RO2A 2JA8I 2DE6A 3I56Z 3FKII 2JMOA 3GTGI 3IF8A 4QTUA 2QKDA 3G4SZ 2V3VA 4NB9A 3IR7A 3S1RI 1VQ51 2JUBA 4A3MI 3I55Z 3CXCY 2R6MA 4E33A 5D1OA 2OZKA 3CCS1 4DGLA 1YJ9Z 2GTHA 1P9NA 1I50I 2OOXB 1LQLA 3NH5A 1KQSZ 3ESWA 2M48A 2QR1B 1K8A1 1VQ81 3CCV1 4NBDA 4E32A 3S1QI 3PO2I 3CMA1 3CC41 1VQ9Z 1K8A2 3OW2Y 2DE5A 2NAPA 4RV9A 3T4NB 5IP9I 1VQK1 1VQ61 2OTLZ 2Y0SA 3FQMA 2QA4Z 4BY7I 2I3CA 1YJW1 4S1TA 4XX2A 1X0TA 3J80b 3CD6Z 2H85A 1VQ71 1N8R1 2YU9I 3H3VJ 3NH8A 2EGTA 3GTMS 3CCR1 1VQN1 2OOYB 1M1K1 1N8R2 3J80f 1VQO1 1USPB 2NVYI 3GTKI 1TWAI 3CCL1 1NP6A 3EEDA 1QVFY 1M1K2 3I4NI 1RO4A 3CMEZ 1ZB8A 1WCMI 1WZNA 1TWCI 1Y8CA 2LIYA 5A2Qb 4HGZA 1TWFI 3LUSA 1R9TI 5C3EI 3CCJ1 1YJNZ 1K9M1 3HOWI 1S7MA 3IX0A 3CPWY 2R93I 3TDHB 4E2WA 2W03A 1I6HI 3GTQI 2JNYA 3CCE1 2E7ZA 5IP7I 4CL1A 1M901 1QYPA 3S2DI 5D1OB 4BY1I 1NUIA 3EERA 3CCMZ 1WIIA 3F3FC 3D9XA 3CCQ1 3GTLI 2AKLA 4NBEA 1K83I 3I561 4DQYB 1Q7Y2 1YITZ 1NJI1 2K5RA 2JS4A 2QRCB 3G4S1 2M6NA 1Q861 3I551 2PMZA 1NJI2 5FLXf 1Q862 2RIQA 3CC21 2JIRA 2LEXA 3CC7Z 3NH4A 1VQLZ 1JJ2Z 2JA6I 1WJ2A 4NBHA 1VQ91 2B63I 2RPRA 4A3KI 4NB8A 2KPIA 3CPWZ 2IV2X 3GTMI 1YIJZ 1Q821 4E2YA 4A3LI 4RVFA 5T6BA 2QEXZ 2QA41 2NVQI 3J7A4 3IFUA 2E2HI 2DE7A 3G71Z 1QVGY 3CD61 4DK1A 1WW9A 3D6WA 2NVXI 4NOZA 1KD11 1RO0A 3Q87A 1YUKA 4NBCA 1KC81 3KIHA 3CCSZ 4MXUA 4TNUA 1KD12 2QLVB 3VMIA 3VMHA 1W2BY 1KC82 3PO3S 3NDIA 3CCVZ 2O4HA 4NBBA 2GU2A 3P5JB 4NBAA 2PM9A 3MZLB 4E31A 3J81b 3K7AI 3GTJI 3CXCZ 2JIQA 3CME1 3S15I 1SIWA 2E2II 1YHQ1 4A3FI 2HU9A 3HOYI 2V8JA 2RBLA 4NFRA 4MONA 3J81f 1VQP1 1YJN1 4MH4A 1SFOI 5C44I 4NBFA 3OW2Z 2JR6A 1QVGZ 2V45A 5C4XI 4A3GI 1VQOZ 3I07A 1FDOA 2QRDB 2VPXA 3GTOI 3CCM1 4RVHA 1FDIA 4NBGA 2F4MA 1K9M2 4QTTA 1VQMZ 1TWGI 3HOZI 5AN9F 4MD8A 1YIT1 2QREB 4A93I 1X3WA 2JIMA 2VPZA 1VQ4Z 2R7ZI 2IZ4A 4E30A 1X3ZA 4X6AI 2G2KA 1RQFA 2VUGA 3VTNA 2P28A 1M902 1KQSY 1Q811 5FLXb 1S72Z 4AYBA 5LL6f 4MD7A 4A3CI 4A3JI 3JAMf 3FQQA 1TFIA 3CC71 1Q812 1QVFZ 2YADA 1VQL1 3HOVI 3F3PC 1KRLA 2O53A 1YJ91 4MRIA 1TWHI 2OTJZ 3G6EZ 2VUMI 4NH1C 2BJOA 5C4JI 1YIJ1 3HOXI 2KI7B 3U50C 3HKZA 2JA7I 3CQZI 1YI2Z 3VB9A 4BXXI 3PO3I 3G711 3RZOI 1Y1VS 2JA5I 2IZ3A 3TE5B 2LFUA 2OTL1 3CCUZ 3I4MI 4EWCA 3NDJA 1Q822 1Q16A 2WAQA 4RVGA 1VLAA 2NVTI 3CC2Z 1VQ5Z 2F4OA 1I3QI 2AYDA 2WB1A 5T64A 1VQ8Z 2R92I 1RLYA 1QF8A 4HH4A 1L1OC 1RNIA 3HOUI 3CMAZ 5T67A 4E2ZA 2E2JI 3CC4Z 2JIPA 2VF1A 1JWHC 1Y1WI 3RZDI 4RVDA 3S14I 1ML8A 2RT9A 2Q51A 1Z01A 1VQKZ 1VQ6Z 1N2FA 3S1MI 2Q4ZA 2ZAEB 3S16I 3MONA 1YJWZ 2K3RA 3S17I 4E2XA 1YUAA 5IT9b 5D1PA 1VQ7Z 2JIOA
chains in the Genus database with same CATH topology
3GTPI 1ZH1A 3S2HI 2PK7A 5CM2M 1VQM1 3VMGA 5FLMI 3CCRZ 1K731 1VQNZ 4BBRI 4A3BI 1DL6A 1VQ41 5IT9f 4RS4A 3GKQA 1YHQZ 2GTIA 3CCLZ 4A3EI 4MD9A 1PFTA 1K732 3NFZA 1S721 3M3YI 3BG1B 1JJ2Y 3JAMb 1W2BZ 4A3II 3M4OI 2P3YA 1VQPZ 3QWUA 1USPA 1Y1VI 3KIFA 3MZKB 2OTJ1 3BG0B 4Y7NI 3G6E1 5A2Qf 3CCJZ 1Z02A 2V8IA 3H0GI 1Q7Y1 2E9HA 2HF1A 4Y52I 1ZB9A 3S1NI 3CCEZ 1YI21 1Z03A 4BBSI 2W04A 3GCFA 4A3DI 4HGYA 2QEX1 2J6AA 2V8KA 2RHBA 3CCU1 3CCQZ 1RO2A 2JA8I 2DE6A 3I56Z 3FKII 2JMOA 3GTGI 3IF8A 4QTUA 2QKDA 3G4SZ 4NB9A 3S1RI 1VQ51 2JUBA 4A3MI 3I55Z 3CXCY 2R6MA 4E33A 5D1OA 2OZKA 3CCS1 4DGLA 1YJ9Z 2GTHA 1P9NA 1I50I 2OOXB 1LQLA 3NH5A 1KQSZ 3ESWA 2M48A 2QR1B 1K8A1 1VQ81 3CCV1 4NBDA 4E32A 3S1QI 3PO2I 3CMA1 3CC41 1VQ9Z 1K8A2 3OW2Y 2DE5A 4RV9A 3T4NB 5IP9I 1VQK1 1VQ61 2OTLZ 2Y0SA 3FQMA 2QA4Z 4BY7I 2I3CA 1YJW1 4S1TA 4XX2A 1X0TA 3J80b 3CD6Z 2H85A 1VQ71 1N8R1 2YU9I 3H3VJ 3NH8A 2EGTA 3GTMS 3CCR1 1VQN1 2OOYB 1M1K1 1N8R2 3J80f 1VQO1 1USPB 2NVYI 3GTKI 1TWAI 3CCL1 1NP6A 3EEDA 1QVFY 1M1K2 3I4NI 1RO4A 3CMEZ 1ZB8A 1WCMI 1TWCI 2LIYA 5A2Qb 4HGZA 1TWFI 3LUSA 1R9TI 5C3EI 3CCJ1 1YJNZ 1K9M1 3HOWI 1S7MA 3IX0A 3CPWY 2R93I 3TDHB 4E2WA 2W03A 1I6HI 3GTQI 2JNYA 3CCE1 5IP7I 4CL1A 1M901 1QYPA 3S2DI 5D1OB 4BY1I 1NUIA 3EERA 3CCMZ 1WIIA 3F3FC 3D9XA 3CCQ1 3GTLI 2AKLA 4NBEA 1K83I 3I561 4DQYB 1Q7Y2 1YITZ 1NJI1 2K5RA 2JS4A 2QRCB 3G4S1 2M6NA 1Q861 3I551 2PMZA 1NJI2 5FLXf 1Q862 2RIQA 3CC21 3CC7Z 3NH4A 1VQLZ 1JJ2Z 2JA6I 4NBHA 1VQ91 2B63I 2RPRA 4A3KI 4NB8A 2KPIA 3CPWZ 3GTMI 1YIJZ 1Q821 4E2YA 4A3LI 4RVFA 5T6BA 2QEXZ 2QA41 2NVQI 3J7A4 3IFUA 2E2HI 2DE7A 3G71Z 1QVGY 3CD61 4DK1A 1WW9A 3D6WA 2NVXI 4NOZA 1KD11 1RO0A 3Q87A 1YUKA 4NBCA 1KC81 3KIHA 3CCSZ 4MXUA 4TNUA 1KD12 2QLVB 3VMIA 3VMHA 1W2BY 1KC82 3PO3S 3NDIA 3CCVZ 2O4HA 4NBBA 2GU2A 3P5JB 4NBAA 2PM9A 3MZLB 4E31A 3J81b 3K7AI 3GTJI 3CXCZ 3CME1 3S15I 2E2II 1YHQ1 4A3FI 2HU9A 3HOYI 2V8JA 2RBLA 4NFRA 4MONA 3J81f 1VQP1 1YJN1 4MH4A 1SFOI 5C44I 4NBFA 3OW2Z 2JR6A 1QVGZ 5C4XI 4A3GI 1VQOZ 3I07A 2QRDB 3GTOI 3CCM1 4RVHA 4NBGA 2F4MA 1K9M2 4QTTA 1VQMZ 1TWGI 3HOZI 5AN9F 4MD8A 1YIT1 2QREB 4A93I 1X3WA 1VQ4Z 2R7ZI 2IZ4A 4E30A 1X3ZA 4X6AI 2G2KA 1RQFA 2VUGA 3VTNA 2P28A 1M902 1KQSY 1Q811 5FLXb 1S72Z 4AYBA 5LL6f 4MD7A 4A3CI 4A3JI 3JAMf 3FQQA 1TFIA 3CC71 1Q812 1QVFZ 2YADA 1VQL1 3HOVI 3F3PC 1KRLA 2O53A 1YJ91 4MRIA 1TWHI 2OTJZ 3G6EZ 2VUMI 4NH1C 2BJOA 5C4JI 1YIJ1 3HOXI 2KI7B 3U50C 3HKZA 2JA7I 3CQZI 1YI2Z 3VB9A 4BXXI 3PO3I 3G711 3RZOI 1Y1VS 2JA5I 2IZ3A 3TE5B 2LFUA 2OTL1 3CCUZ 3I4MI 4EWCA 3NDJA 1Q822 2WAQA 4RVGA 1VLAA 2NVTI 3CC2Z 1VQ5Z 2F4OA 1I3QI 2WB1A 5T64A 1VQ8Z 2R92I 1RLYA 1QF8A 4HH4A 1L1OC 1RNIA 3HOUI 3CMAZ 5T67A 4E2ZA 2E2JI 3CC4Z 2VF1A 1JWHC 1Y1WI 3RZDI 4RVDA 3S14I 1ML8A 2RT9A 2Q51A 1Z01A 1VQKZ 1VQ6Z 1N2FA 3S1MI 2Q4ZA 2ZAEB 3S16I 3MONA 1YJWZ 2K3RA 3S17I 4E2XA 1YUAA 5IT9b 5D1PA 1VQ7Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3Z A;  4X6A I;  5IP9 I;  3GTP I;  3S2H I;  2JA6 I;  2PK7 A;  4NBH A;  5CM2 M;  4BY7 I;  3VMG A;  5FLM I;  4A3C I;  4XX2 A;  2B63 I;  4A3J I;  4BBR I;  4A3K I;  4A3B I;  4NB8 A;  2KPI A;  1DL6 A;  1TFI A;  3GTM I;  3GKQ A;  4A3E I;  2YU9 I;  3H3V J;  3HOV I;  1PFT A;  4A3L I;  3M3Y I;  3GTM S;  2NVQ I;  2E2H I;  1TWH I;  2DE7 A;  4A3I I;  3M4O I;  2VUM I;  2BJO A;  2P3Y A;  5C4J I;  1WW9 A;  1USP B;  2NVY I;  3D6W A;  3GTK I;  1TWA I;  3HOX I;  2NVX I;  3U50 C;  4NOZ A;  2JA7 I;  1USP A;  3Q87 A;  1Y1V I;  3CQZ I;  4NBC A;  3I4N I;  3VB9 A;  1RO4 A;  4BXX I;  4Y7N I;  3PO3 I;  1ZB8 A;  3RZO I;  1WCM I;  3VMI A;  1Y1V S;  2JA5 I;  3H0G I;  3VMH A;  3PO3 S;  1TWC I;  2HF1 A;  4Y52 I;  1ZB9 A;  3I4M I;  3S1N I;  4NBB A;  4NBA A;  1TWF I;  3LUS A;  3K7A I;  3GTJ I;  1R9T I;  4BBS I;  5C3E I;  3S15 I;  1VLA A;  3GCF A;  2NVT I;  2E2I I;  3HOW I;  4A3D I;  4A3F I;  2R93 I;  2F4O A;  2J6A A;  1I3Q I;  3HOY I;  1I6H I;  3GTQ I;  2RBL A;  2JNY A;  2JA8 I;  2DE6 A;  3FKI I;  5IP7 I;  3GTG I;  4QTU A;  1QYP A;  3S2D I;  4NB9 A;  3S1R I;  4MH4 A;  4A3M I;  1SFO I;  4BY1 I;  1RLY A;  2R92 I;  1NUI A;  3EER A;  5C44 I;  4NBF A;  3GTL I;  1L1O C;  3HOU I;  2AKL A;  4NBE A;  1K83 I;  2E2J I;  2JR6 A;  1I50 I;  2K5R A;  2JS4 A;  1Y1W I;  3RZD I;  1LQL A;  3S14 I;  1ML8 A;  5C4X I;  3ESW A;  4A3G I;  3I07 A;  3GTO I;  1N2F A;  3S1M I;  4NBG A;  2F4M A;  4NBD A;  4QTT A;  3S16 I;  3S1Q I;  3PO2 I;  1TWG I;  3HOZ I;  3S17 I;  4A93 I;  1X3W A;  1YUA A;  2DE5 A;  2R7Z I; 
#chains in the Genus database with same CATH topology
 3GTP I;  1ZH1 A;  3S2H I;  2PK7 A;  5CM2 M;  1VQM 1;  3VMG A;  5FLM I;  3CCR Z;  1K73 1;  1VQN Z;  4BBR I;  4A3B I;  1DL6 A;  1VQ4 1;  5IT9 f;  4RS4 A;  3GKQ A;  1YHQ Z;  2GTI A;  3CCL Z;  4A3E I;  4MD9 A;  2VPW A;  1PFT A;  1AA6 A;  1K73 2;  3NFZ A;  1S72 1;  3M3Y I;  3BG1 B;  1JJ2 Y;  3JAM b;  1W2B Z;  4A3I I;  3M4O I;  2P3Y A;  1VQP Z;  3QWU A;  1QXF A;  1USP A;  1Y1V I;  3KIF A;  3MZK B;  2VPY A;  2OTJ 1;  3BG0 B;  4Y7N I;  3G6E 1;  5A2Q f;  3CCJ Z;  1Z02 A;  2V8I A;  3H0G I;  1Q7Y 1;  2E9H A;  2HF1 A;  4Y52 I;  1ZB9 A;  3S1N I;  3CCE Z;  1YI2 1;  3D2L A;  1Z03 A;  4BBS I;  2W04 A;  3GCF A;  4A3D I;  4HGY A;  2QEX 1;  2J6A A;  2V8K A;  2RHB A;  3CCU 1;  3CCQ Z;  1RO2 A;  2JA8 I;  2DE6 A;  3I56 Z;  3FKI I;  2JMO A;  3GTG I;  3IF8 A;  4QTU A;  2QKD A;  3G4S Z;  2V3V A;  4NB9 A;  3IR7 A;  3S1R I;  1VQ5 1;  2JUB A;  4A3M I;  3I55 Z;  3CXC Y;  2R6M A;  4E33 A;  5D1O A;  2OZK A;  3CCS 1;  4DGL A;  1YJ9 Z;  2GTH A;  1P9N A;  1I50 I;  2OOX B;  1LQL A;  3NH5 A;  1KQS Z;  3ESW A;  2M48 A;  2QR1 B;  1K8A 1;  1VQ8 1;  3CCV 1;  4NBD A;  4E32 A;  3S1Q I;  3PO2 I;  3CMA 1;  3CC4 1;  1VQ9 Z;  1K8A 2;  3OW2 Y;  2DE5 A;  2NAP A;  4RV9 A;  3T4N B;  5IP9 I;  1VQK 1;  1VQ6 1;  2OTL Z;  2Y0S A;  3FQM A;  2QA4 Z;  4BY7 I;  2I3C A;  1YJW 1;  4S1T A;  4XX2 A;  1X0T A;  3J80 b;  3CD6 Z;  2H85 A;  1VQ7 1;  1N8R 1;  2YU9 I;  3H3V J;  3NH8 A;  2EGT A;  3GTM S;  3CCR 1;  1VQN 1;  2OOY B;  1M1K 1;  1N8R 2;  3J80 f;  1VQO 1;  1USP B;  2NVY I;  3GTK I;  1TWA I;  3CCL 1;  1NP6 A;  3EED A;  1QVF Y;  1M1K 2;  3I4N I;  1RO4 A;  3CME Z;  1ZB8 A;  1WCM I;  1WZN A;  1TWC I;  1Y8C A;  2LIY A;  5A2Q b;  4HGZ A;  1TWF I;  3LUS A;  1R9T I;  5C3E I;  3CCJ 1;  1YJN Z;  1K9M 1;  3HOW I;  1S7M A;  3IX0 A;  3CPW Y;  2R93 I;  3TDH B;  4E2W A;  2W03 A;  1I6H I;  3GTQ I;  2JNY A;  3CCE 1;  2E7Z A;  5IP7 I;  4CL1 A;  1M90 1;  1QYP A;  3S2D I;  5D1O B;  4BY1 I;  1NUI A;  3EER A;  3CCM Z;  1WII A;  3F3F C;  3D9X A;  3CCQ 1;  3GTL I;  2AKL A;  4NBE A;  1K83 I;  3I56 1;  4DQY B;  1Q7Y 2;  1YIT Z;  1NJI 1;  2K5R A;  2JS4 A;  2QRC B;  3G4S 1;  2M6N A;  1Q86 1;  3I55 1;  2PMZ A;  1NJI 2;  5FLX f;  1Q86 2;  2RIQ A;  3CC2 1;  2JIR A;  2LEX A;  3CC7 Z;  3NH4 A;  1VQL Z;  1JJ2 Z;  2JA6 I;  1WJ2 A;  4NBH A;  1VQ9 1;  2B63 I;  2RPR A;  4A3K I;  4NB8 A;  2KPI A;  3CPW Z;  2IV2 X;  3GTM I;  1YIJ Z;  1Q82 1;  4E2Y A;  4A3L I;  4RVF A;  5T6B A;  2QEX Z;  2QA4 1;  2NVQ I;  3J7A 4;  3IFU A;  2E2H I;  2DE7 A;  3G71 Z;  1QVG Y;  3CD6 1;  4DK1 A;  1WW9 A;  3D6W A;  2NVX I;  4NOZ A;  1KD1 1;  1RO0 A;  3Q87 A;  1YUK A;  4NBC A;  1KC8 1;  3KIH A;  3CCS Z;  4MXU A;  4TNU A;  1KD1 2;  2QLV B;  3VMI A;  3VMH A;  1W2B Y;  1KC8 2;  3PO3 S;  3NDI A;  3CCV Z;  2O4H A;  4NBB A;  2GU2 A;  3P5J B;  4NBA A;  2PM9 A;  3MZL B;  4E31 A;  3J81 b;  3K7A I;  3GTJ I;  3CXC Z;  2JIQ A;  3CME 1;  3S15 I;  1SIW A;  2E2I I;  1YHQ 1;  4A3F I;  2HU9 A;  3HOY I;  2V8J A;  2RBL A;  4NFR A;  4MON A;  3J81 f;  1VQP 1;  1YJN 1;  4MH4 A;  1SFO I;  5C44 I;  4NBF A;  3OW2 Z;  2JR6 A;  1QVG Z;  2V45 A;  5C4X I;  4A3G I;  1VQO Z;  3I07 A;  1FDO A;  2QRD B;  2VPX A;  3GTO I;  3CCM 1;  4RVH A;  1FDI A;  4NBG A;  2F4M A;  1K9M 2;  4QTT A;  1VQM Z;  1TWG I;  3HOZ I;  5AN9 F;  4MD8 A;  1YIT 1;  2QRE B;  4A93 I;  1X3W A;  2JIM A;  2VPZ A;  1VQ4 Z;  2R7Z I;  2IZ4 A;  4E30 A;  1X3Z A;  4X6A I;  2G2K A;  1RQF A;  2VUG A;  3VTN A;  2P28 A;  1M90 2;  1KQS Y;  1Q81 1;  5FLX b;  1S72 Z;  4AYB A;  5LL6 f;  4MD7 A;  4A3C I;  4A3J I;  3JAM f;  3FQQ A;  1TFI A;  3CC7 1;  1Q81 2;  1QVF Z;  2YAD A;  1VQL 1;  3HOV I;  3F3P C;  1KRL A;  2O53 A;  1YJ9 1;  4MRI A;  1TWH I;  2OTJ Z;  3G6E Z;  2VUM I;  4NH1 C;  2BJO A;  5C4J I;  1YIJ 1;  3HOX I;  2KI7 B;  3U50 C;  3HKZ A;  2JA7 I;  3CQZ I;  1YI2 Z;  3VB9 A;  4BXX I;  3PO3 I;  3G71 1;  3RZO I;  1Y1V S;  2JA5 I;  2IZ3 A;  3TE5 B;  2LFU A;  2OTL 1;  3CCU Z;  3I4M I;  4EWC A;  3NDJ A;  1Q82 2;  1Q16 A;  2WAQ A;  4RVG A;  1VLA A;  2NVT I;  3CC2 Z;  1VQ5 Z;  2F4O A;  1I3Q I;  2AYD A;  2WB1 A;  5T64 A;  1VQ8 Z;  2R92 I;  1RLY A;  1QF8 A;  4HH4 A;  1L1O C;  1RNI A;  3HOU I;  3CMA Z;  5T67 A;  4E2Z A;  2E2J I;  3CC4 Z;  2JIP A;  2VF1 A;  1JWH C;  1Y1W I;  3RZD I;  4RVD A;  3S14 I;  1ML8 A;  2RT9 A;  2Q51 A;  1Z01 A;  1VQK Z;  1VQ6 Z;  1N2F A;  3S1M I;  2Q4Z A;  2ZAE B;  3S16 I;  3MON A;  1YJW Z;  2K3R A;  3S17 I;  4E2X A;  1YUA A;  5IT9 b;  5D1P A;  1VQ7 Z;  2JIO A; 
#chains in the Genus database with same CATH homology
 3GTP I;  1ZH1 A;  3S2H I;  2PK7 A;  5CM2 M;  1VQM 1;  3VMG A;  5FLM I;  3CCR Z;  1K73 1;  1VQN Z;  4BBR I;  4A3B I;  1DL6 A;  1VQ4 1;  5IT9 f;  4RS4 A;  3GKQ A;  1YHQ Z;  2GTI A;  3CCL Z;  4A3E I;  4MD9 A;  1PFT A;  1K73 2;  3NFZ A;  1S72 1;  3M3Y I;  3BG1 B;  1JJ2 Y;  3JAM b;  1W2B Z;  4A3I I;  3M4O I;  2P3Y A;  1VQP Z;  3QWU A;  1USP A;  1Y1V I;  3KIF A;  3MZK B;  2OTJ 1;  3BG0 B;  4Y7N I;  3G6E 1;  5A2Q f;  3CCJ Z;  1Z02 A;  2V8I A;  3H0G I;  1Q7Y 1;  2E9H A;  2HF1 A;  4Y52 I;  1ZB9 A;  3S1N I;  3CCE Z;  1YI2 1;  1Z03 A;  4BBS I;  2W04 A;  3GCF A;  4A3D I;  4HGY A;  2QEX 1;  2J6A A;  2V8K A;  2RHB A;  3CCU 1;  3CCQ Z;  1RO2 A;  2JA8 I;  2DE6 A;  3I56 Z;  3FKI I;  2JMO A;  3GTG I;  3IF8 A;  4QTU A;  2QKD A;  3G4S Z;  4NB9 A;  3S1R I;  1VQ5 1;  2JUB A;  4A3M I;  3I55 Z;  3CXC Y;  2R6M A;  4E33 A;  5D1O A;  2OZK A;  3CCS 1;  4DGL A;  1YJ9 Z;  2GTH A;  1P9N A;  1I50 I;  2OOX B;  1LQL A;  3NH5 A;  1KQS Z;  3ESW A;  2M48 A;  2QR1 B;  1K8A 1;  1VQ8 1;  3CCV 1;  4NBD A;  4E32 A;  3S1Q I;  3PO2 I;  3CMA 1;  3CC4 1;  1VQ9 Z;  1K8A 2;  3OW2 Y;  2DE5 A;  4RV9 A;  3T4N B;  5IP9 I;  1VQK 1;  1VQ6 1;  2OTL Z;  2Y0S A;  3FQM A;  2QA4 Z;  4BY7 I;  2I3C A;  1YJW 1;  4S1T A;  4XX2 A;  1X0T A;  3J80 b;  3CD6 Z;  2H85 A;  1VQ7 1;  1N8R 1;  2YU9 I;  3H3V J;  3NH8 A;  2EGT A;  3GTM S;  3CCR 1;  1VQN 1;  2OOY B;  1M1K 1;  1N8R 2;  3J80 f;  1VQO 1;  1USP B;  2NVY I;  3GTK I;  1TWA I;  3CCL 1;  1NP6 A;  3EED A;  1QVF Y;  1M1K 2;  3I4N I;  1RO4 A;  3CME Z;  1ZB8 A;  1WCM I;  1TWC I;  2LIY A;  5A2Q b;  4HGZ A;  1TWF I;  3LUS A;  1R9T I;  5C3E I;  3CCJ 1;  1YJN Z;  1K9M 1;  3HOW I;  1S7M A;  3IX0 A;  3CPW Y;  2R93 I;  3TDH B;  4E2W A;  2W03 A;  1I6H I;  3GTQ I;  2JNY A;  3CCE 1;  5IP7 I;  4CL1 A;  1M90 1;  1QYP A;  3S2D I;  5D1O B;  4BY1 I;  1NUI A;  3EER A;  3CCM Z;  1WII A;  3F3F C;  3D9X A;  3CCQ 1;  3GTL I;  2AKL A;  4NBE A;  1K83 I;  3I56 1;  4DQY B;  1Q7Y 2;  1YIT Z;  1NJI 1;  2K5R A;  2JS4 A;  2QRC B;  3G4S 1;  2M6N A;  1Q86 1;  3I55 1;  2PMZ A;  1NJI 2;  5FLX f;  1Q86 2;  2RIQ A;  3CC2 1;  3CC7 Z;  3NH4 A;  1VQL Z;  1JJ2 Z;  2JA6 I;  4NBH A;  1VQ9 1;  2B63 I;  2RPR A;  4A3K I;  4NB8 A;  2KPI A;  3CPW Z;  3GTM I;  1YIJ Z;  1Q82 1;  4E2Y A;  4A3L I;  4RVF A;  5T6B A;  2QEX Z;  2QA4 1;  2NVQ I;  3J7A 4;  3IFU A;  2E2H I;  2DE7 A;  3G71 Z;  1QVG Y;  3CD6 1;  4DK1 A;  1WW9 A;  3D6W A;  2NVX I;  4NOZ A;  1KD1 1;  1RO0 A;  3Q87 A;  1YUK A;  4NBC A;  1KC8 1;  3KIH A;  3CCS Z;  4MXU A;  4TNU A;  1KD1 2;  2QLV B;  3VMI A;  3VMH A;  1W2B Y;  1KC8 2;  3PO3 S;  3NDI A;  3CCV Z;  2O4H A;  4NBB A;  2GU2 A;  3P5J B;  4NBA A;  2PM9 A;  3MZL B;  4E31 A;  3J81 b;  3K7A I;  3GTJ I;  3CXC Z;  3CME 1;  3S15 I;  2E2I I;  1YHQ 1;  4A3F I;  2HU9 A;  3HOY I;  2V8J A;  2RBL A;  4NFR A;  4MON A;  3J81 f;  1VQP 1;  1YJN 1;  4MH4 A;  1SFO I;  5C44 I;  4NBF A;  3OW2 Z;  2JR6 A;  1QVG Z;  5C4X I;  4A3G I;  1VQO Z;  3I07 A;  2QRD B;  3GTO I;  3CCM 1;  4RVH A;  4NBG A;  2F4M A;  1K9M 2;  4QTT A;  1VQM Z;  1TWG I;  3HOZ I;  5AN9 F;  4MD8 A;  1YIT 1;  2QRE B;  4A93 I;  1X3W A;  1VQ4 Z;  2R7Z I;  2IZ4 A;  4E30 A;  1X3Z A;  4X6A I;  2G2K A;  1RQF A;  2VUG A;  3VTN A;  2P28 A;  1M90 2;  1KQS Y;  1Q81 1;  5FLX b;  1S72 Z;  4AYB A;  5LL6 f;  4MD7 A;  4A3C I;  4A3J I;  3JAM f;  3FQQ A;  1TFI A;  3CC7 1;  1Q81 2;  1QVF Z;  2YAD A;  1VQL 1;  3HOV I;  3F3P C;  1KRL A;  2O53 A;  1YJ9 1;  4MRI A;  1TWH I;  2OTJ Z;  3G6E Z;  2VUM I;  4NH1 C;  2BJO A;  5C4J I;  1YIJ 1;  3HOX I;  2KI7 B;  3U50 C;  3HKZ A;  2JA7 I;  3CQZ I;  1YI2 Z;  3VB9 A;  4BXX I;  3PO3 I;  3G71 1;  3RZO I;  1Y1V S;  2JA5 I;  2IZ3 A;  3TE5 B;  2LFU A;  2OTL 1;  3CCU Z;  3I4M I;  4EWC A;  3NDJ A;  1Q82 2;  2WAQ A;  4RVG A;  1VLA A;  2NVT I;  3CC2 Z;  1VQ5 Z;  2F4O A;  1I3Q I;  2WB1 A;  5T64 A;  1VQ8 Z;  2R92 I;  1RLY A;  1QF8 A;  4HH4 A;  1L1O C;  1RNI A;  3HOU I;  3CMA Z;  5T67 A;  4E2Z A;  2E2J I;  3CC4 Z;  2VF1 A;  1JWH C;  1Y1W I;  3RZD I;  4RVD A;  3S14 I;  1ML8 A;  2RT9 A;  2Q51 A;  1Z01 A;  1VQK Z;  1VQ6 Z;  1N2F A;  3S1M I;  2Q4Z A;  2ZAE B;  3S16 I;  3MON A;  1YJW Z;  2K3R A;  3S17 I;  4E2X A;  1YUA A;  5IT9 b;  5D1P A;  1VQ7 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...