4A3LI

Rna polymerase ii initial transcribing complex with a 7nt dna-rna hybrid and soaked with ampcpp
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
total genus 13
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3lI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3lI02
2B63I 3VMGA 4NBAA 3S16I 4BBRI 4X6AI 4A3GI 5C3EI 1TWHI 2NVQI 3GTMS 3PO2I 1RO4A 2F4OA 4A3FI 4BXXI 3VMIA 1I3QI 5IP9I 4BY1I 1N2FA 3GTOI 3GKQA 5C4JI 1LQLA 3HOYI 3GTGI 1Y1VS 3GTQI 4Y52I 1VLAA 1ZB9A 1WW9A 1RLYA 3U50C 4QTUA 4A3EI 4NBDA 4QTTA 3S1RI 2VUMI 3I07A 3D6WA 3S15I 2E2JI 2DE6A 4A3DI 1I50I 4A3JI 3PO3I 3HOUI 1SFOI 2DE5A 2DE7A 4NBEA 3I4MI 4Y7NI 3S1MI 1PFTA 3HOVI 3HOWI 4A3KI 1TWGI 3S2DI 3GTLI 2R92I 4A93I 4A3LI 1K83I 3GTMI 3GTKI 5FLMI 1YUAA 3S1QI 5C44I 4MH4A 1I6HI 2JA8I 3CQZI 3VMHA 1QYPA 2RBLA 3S14I 1ZB8A 1Y1VI 3VB9A 2JA7I 2NVTI 3H0GI 4A3MI 3H3VJ 2R93I 1L1OC 2AKLA 2P3YA 3EERA 3HOZI 4NBBA 3RZDI 2F4MA 2R7ZI 5C4XI 4A3BI 1TWFI 3S1NI 2E2II 2J6AA 1X3WA 3GTPI 1ML8A 4NBHA 3HOXI 2JA6I 3S17I 4A3CI 2JS4A 2NVYI 2JR6A 5IP7I 3S2HI 4BY7I 1WCMI 3I4NI 4XX2A 2K5RA 3ESWA 4BBSI 1TFIA 2E2HI 4NBFA 1NUIA 3GTJI 3K7AI 2JNYA 1USPA 2BJOA 1Y1WI 3Q87A 2NVXI 1R9TI 2YU9I 4NBGA 2PK7A 3GCFA 3FKII 4A3II 2JA5I 3M3YI 4NB9A 1TWCI 4NBCA 1DL6A 3LUSA 2KPIA 1USPB 1X3ZA 4NB8A 5CM2M 3PO3S 3M4OI 2HF1A 1TWAI 3RZOI 4NOZA
chains in the Genus database with same CATH superfamily
1VQ8Z 3CCQ1 3I55Z 2JIRA 3CC7Z 4NBAA 3MZKB 4DGLA 4X6AI 2QEXZ 1YJN1 1TWHI 3GTMS 4BXXI 3MZLB 1Z01A 3VMIA 1Q862 3I56Z 1N2FA 3G6E1 5C4JI 3HOYI 1WJ2A 3IFUA 1Y1VS 3G4S1 1VLAA 1WW9A 2QREB 3U50C 1M1K1 4QTTA 2E2JI 1YI21 5FLXf 4NFRA 1QVFZ 2I3CA 2DE7A 2WAQA 4HH4A 1Q16A 1VQP1 1S721 3GTLI 1KD11 2Y0SA 1K83I 3GTKI 2JIQA 5C44I 5IT9b 4MH4A 1RQFA 3J80f 1WZNA 1YIT1 3TE5B 1ZB8A 3IX0A 3JAMf 3CCUZ 2R93I 1L1OC 2P3YA 3HOZI 1K8A2 3RZDI 2RT9A 5A2Qf 1Q7Y1 2J6AA 3F3FC 4CL1A 1ML8A 3HOXI 3S17I 2JS4A 1QVGZ 2RHBA 3NDIA 1WCMI 1K9M2 3I4NI 4XX2A 1VQ7Z 3ESWA 2OTLZ 4NBFA 3GTJI 1JWHC 3D2LA 1USPA 1VQMZ 1N8R1 3IF8A 1M901 1JJ2Y 1Y1WI 3NFZA 4NBGA 2JA5I 3CCE1 3NH8A 2P28A 5D1PA 1NP6A 2NAPA 3KIHA 3LUSA 1Q822 4AYBA 3IR7A 5D1OB 3RZOI 2B63I 1VQ91 3S16I 1QXFA 2RIQA 2LIYA 1RO4A 1K732 1QVGY 1I3QI 2JMOA 1KC82 3GTOI 1Q861 2G2KA 2QRDB 1YIJZ 2VUMI 1VQ5Z 2KI7B 1VQK1 3CME1 3CCL1 4MD8A 1Y8CA 1SFOI 2Q51A 1Q812 4MXUA 3CCS1 2DE5A 1YHQZ 1VQ81 3HOVI 3I551 3HOWI 3CC71 3CCRZ 2R92I 4A93I 3CD6Z 5FLMI 2QEX1 3T4NB 2R6MA 1I6HI 3VMHA 3I561 2RBLA 2NVTI 3H0GI 4A3MI 2VF1A 4E30A 3J81b 5IT9f 2OTJZ 4NBBA 2F4MA 1NJI2 2JIPA 4DQYB 3S1NI 1RO2A 1X3WA 2E7ZA 3CXCZ 4NBHA 4A3CI 2NVYI 4DK1A 2OZKA 1YJWZ 2K5RA 1QF8A 2M6NA 2E2HI 1VQNZ 1NUIA 2V8JA 3P5JB 1K9M1 3CMAZ 2H85A 3QWUA 1W2BZ 2ZAEB 2LFUA 2OOXB 2PK7A 2QKDA 1YJ9Z 2PM9A 3CCJ1 3CCU1 1M1K2 2QR1B 2IV2X 4EWCA 2QLVB 2KPIA 1USPB 1X3ZA 5CM2M 2YADA 3M4OI 1ZH1A 1TWAI 4E2ZA 2EGTA 1Q821 3CC4Z 3VMGA 2IZ3A 4MD7A 1QVFY 3EEDA 4BBRI 3HKZA 1KRLA 3OW2Z 4A3GI 2NVQI 3PO2I 4MONA 3CXCY 2OTL1 4A3FI 1VQM1 2JIMA 4BY1I 1K731 3GKQA 1LQLA 3GTGI 1VQL1 4Y52I 1ZB9A 1KC81 3BG0B 4MD9A 4NBDA 3CCVZ 2W03A 1W2BY 1P9NA 3I07A 2GU2A 2OOYB 3D6WA 4E2YA 5T64A 3S15I 2DE6A 4TNUA 4MRIA 1VQOZ 3HOUI 2WB1A 5T6BA 3KIFA 3I4MI 4Y7NI 1Q811 4A3KI 1TWGI 3G71Z 4A3LI 3S1QI 1FDOA 2JUBA 3FQQA 2JIOA 3CQZI 3MONA 1Z03A 4RVDA 3NH5A 1Z02A 3S14I 3CC2Z 2VPYA 1VQ4Z 3OW2Y 2JA7I 2AKLA 2QA4Z 1YIJ1 1VQ61 2LEXA 5C4XI 3CCMZ 1TWFI 1VQ51 4A3BI 3NDJA 1NJI1 3GTPI 3CCQZ 3J81f 4HGZA 3S2HI 1YHQ1 1YJNZ 4BBSI 3CCR1 3CD61 4RVGA 3G6EZ 2BJOA 2V8KA 3G4SZ 2VPWA 1R9TI 3FKII 4A3II 4NB9A 1K8A1 1YI2Z 4NBCA 1AA6A 1DL6A 2OTJ1 2AYDA 2Q4ZA 4RVHA 3CPWZ 1YUKA 4E2XA 3J7A4 1S7MA 1VQPZ 1S72Z 1YJW1 4E32A 1RNIA 5C3EI 1JJ2Z 1VQN1 2F4OA 3CMA1 4E2WA 1FDIA 1YITZ 4E31A 5IP9I 3FQMA 2PMZA 3GTQI 5FLXb 2HU9A 3TDHB 2E9HA 1RLYA 2GTIA 4QTUA 4A3EI 1YJ91 3S1RI 2VPXA 2IZ4A 3CCJZ 4A3DI 1I50I 4A3JI 3F3PC 2VUGA 3PO3I 5AN9F 2W04A 1VQ71 4NBEA 2V8IA 1KD12 3S1MI 1PFTA 4S1TA 3CC41 3J80b 4HGYA 3S2DI 4RVFA 3CPWY 3JAMb 2V45A 2M48A 3GTMI 2O53A 1YUAA 2JA8I 1KQSZ 1QYPA 5A2Qb 3CCEZ 1Y1VI 3VB9A 3H3VJ 1VQLZ 3EERA 1Q7Y2 2R7ZI 3CCV1 4RS4A 2E2II 4E33A 5LL6f 1WIIA 2JA6I 1VQ9Z 1VQO1 2JR6A 2V3VA 2RPRA 5IP7I 4BY7I 2K3RA 2GTHA 4NH1C 1N8R2 1TFIA 2JNYA 3K7AI 1M902 3G711 1RO0A 2O4HA 5D1OA 4RV9A 3Q87A 2NVXI 2YU9I 2QRCB 3GCFA 3CC21 3M3YI 1SIWA 1VQ41 1TWCI 3NH4A 1VQKZ 3CMEZ 2QA41 3CCLZ 3D9XA 1X0TA 4NB8A 5T67A 1KQSY 3PO3S 1VQ6Z 2HF1A 3CCM1 3CCSZ 3VTNA 3BG1B 4NOZA 2VPZA
chains in the Genus database with same CATH topology
1VQ8Z 3CCQ1 3I55Z 3CC7Z 4NBAA 3MZKB 4DGLA 4X6AI 2QEXZ 1YJN1 1TWHI 3GTMS 4BXXI 3MZLB 1Z01A 3VMIA 1Q862 3I56Z 1N2FA 3G6E1 5C4JI 3HOYI 3IFUA 1Y1VS 3G4S1 1VLAA 1WW9A 2QREB 3U50C 1M1K1 4QTTA 2E2JI 1YI21 5FLXf 4NFRA 1QVFZ 2I3CA 2DE7A 2WAQA 4HH4A 1VQP1 1S721 3GTLI 1KD11 2Y0SA 1K83I 3GTKI 5C44I 5IT9b 4MH4A 1RQFA 3J80f 1YIT1 3TE5B 1ZB8A 3IX0A 3JAMf 3CCUZ 2R93I 1L1OC 2P3YA 3HOZI 1K8A2 3RZDI 2RT9A 5A2Qf 1Q7Y1 2J6AA 3F3FC 4CL1A 1ML8A 3HOXI 3S17I 2JS4A 1QVGZ 2RHBA 3NDIA 1WCMI 1K9M2 3I4NI 4XX2A 1VQ7Z 3ESWA 2OTLZ 4NBFA 3GTJI 1JWHC 1USPA 1VQMZ 1N8R1 3IF8A 1M901 1JJ2Y 1Y1WI 3NFZA 4NBGA 2JA5I 3CCE1 3NH8A 2P28A 5D1PA 1NP6A 3LUSA 3KIHA 1Q822 4AYBA 5D1OB 3RZOI 2B63I 1VQ91 3S16I 2RIQA 2LIYA 1RO4A 1K732 1QVGY 1I3QI 2JMOA 1KC82 3GTOI 1Q861 2G2KA 2QRDB 1YIJZ 2VUMI 1VQ5Z 2KI7B 1VQK1 3CME1 3CCL1 4MD8A 1SFOI 2Q51A 1Q812 4MXUA 3CCS1 2DE5A 1YHQZ 1VQ81 3HOVI 3I551 3HOWI 3CC71 3CCRZ 2R92I 4A93I 3CD6Z 5FLMI 2QEX1 3T4NB 2R6MA 1I6HI 3VMHA 3I561 2RBLA 2NVTI 3H0GI 4A3MI 2VF1A 4E30A 3J81b 5IT9f 2OTJZ 4NBBA 2F4MA 1NJI2 4DQYB 3S1NI 1RO2A 1X3WA 3CXCZ 4NBHA 4A3CI 2NVYI 4DK1A 2OZKA 1YJWZ 2K5RA 1QF8A 2M6NA 2E2HI 1VQNZ 1NUIA 2V8JA 3P5JB 1K9M1 3CMAZ 2H85A 3QWUA 1W2BZ 2ZAEB 2LFUA 2OOXB 2PK7A 2QKDA 1YJ9Z 2PM9A 3CCJ1 3CCU1 1M1K2 2QR1B 4EWCA 2QLVB 2KPIA 1USPB 1X3ZA 5CM2M 2YADA 3M4OI 1ZH1A 1TWAI 4E2ZA 2EGTA 1Q821 3CC4Z 3VMGA 2IZ3A 4MD7A 1QVFY 3EEDA 4BBRI 3HKZA 1KRLA 3OW2Z 4A3GI 2NVQI 3PO2I 4MONA 3CXCY 2OTL1 4A3FI 1VQM1 4BY1I 1K731 3GKQA 1LQLA 3GTGI 1VQL1 4Y52I 1ZB9A 1KC81 3BG0B 4MD9A 4NBDA 3CCVZ 2W03A 1W2BY 1P9NA 3I07A 2GU2A 2OOYB 3D6WA 4E2YA 5T64A 3S15I 2DE6A 4TNUA 4MRIA 1VQOZ 3HOUI 2WB1A 5T6BA 3KIFA 3I4MI 4Y7NI 1Q811 4A3KI 1TWGI 3G71Z 4A3LI 3S1QI 2JUBA 3FQQA 3CQZI 3MONA 1Z03A 4RVDA 3NH5A 1Z02A 3S14I 3CC2Z 1VQ4Z 3OW2Y 2JA7I 2AKLA 2QA4Z 1YIJ1 1VQ61 5C4XI 3CCMZ 1TWFI 1VQ51 4A3BI 3NDJA 1NJI1 3GTPI 3CCQZ 3J81f 4HGZA 3S2HI 1YHQ1 1YJNZ 4BBSI 3CCR1 3CD61 4RVGA 3G6EZ 2BJOA 2V8KA 3G4SZ 1R9TI 3FKII 4A3II 4NB9A 1K8A1 1YI2Z 4NBCA 1DL6A 2OTJ1 2Q4ZA 4RVHA 3CPWZ 1YUKA 4E2XA 3J7A4 1S7MA 1VQPZ 1S72Z 1YJW1 4E32A 1RNIA 5C3EI 1JJ2Z 1VQN1 2F4OA 3CMA1 4E2WA 1YITZ 4E31A 5IP9I 3FQMA 2PMZA 3GTQI 5FLXb 2HU9A 3TDHB 2E9HA 1RLYA 2GTIA 4QTUA 4A3EI 1YJ91 3S1RI 2IZ4A 3CCJZ 4A3DI 1I50I 4A3JI 3F3PC 2VUGA 3PO3I 5AN9F 2W04A 1VQ71 4NBEA 2V8IA 1KD12 3S1MI 1PFTA 4S1TA 3CC41 3J80b 4HGYA 3S2DI 4RVFA 3CPWY 3JAMb 2M48A 3GTMI 2O53A 1YUAA 2JA8I 1KQSZ 1QYPA 5A2Qb 3CCEZ 1Y1VI 3VB9A 3H3VJ 1VQLZ 3EERA 1Q7Y2 2R7ZI 3CCV1 4RS4A 2E2II 4E33A 5LL6f 1WIIA 2JA6I 1VQ9Z 1VQO1 2JR6A 2RPRA 5IP7I 4BY7I 2K3RA 2GTHA 4NH1C 1N8R2 1TFIA 2JNYA 3K7AI 1M902 3G711 1RO0A 2O4HA 5D1OA 4RV9A 3Q87A 2NVXI 2YU9I 2QRCB 3GCFA 3CC21 3M3YI 1VQ41 1TWCI 3NH4A 1VQKZ 3D9XA 2QA41 3CMEZ 3CCLZ 1X0TA 4NB8A 5T67A 1KQSY 3PO3S 1VQ6Z 2HF1A 3CCM1 3CCSZ 3VTNA 3BG1B 4NOZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B63 I;  3VMG A;  4NBA A;  3S16 I;  4BBR I;  4X6A I;  4A3G I;  5C3E I;  1TWH I;  2NVQ I;  3GTM S;  3PO2 I;  1RO4 A;  2F4O A;  4A3F I;  4BXX I;  3VMI A;  1I3Q I;  5IP9 I;  4BY1 I;  1N2F A;  3GTO I;  3GKQ A;  5C4J I;  1LQL A;  3HOY I;  3GTG I;  1Y1V S;  3GTQ I;  4Y52 I;  1VLA A;  1ZB9 A;  1WW9 A;  1RLY A;  3U50 C;  4QTU A;  4A3E I;  4NBD A;  4QTT A;  3S1R I;  2VUM I;  3I07 A;  3D6W A;  3S15 I;  2E2J I;  2DE6 A;  4A3D I;  1I50 I;  4A3J I;  3PO3 I;  3HOU I;  1SFO I;  2DE5 A;  2DE7 A;  4NBE A;  3I4M I;  4Y7N I;  3S1M I;  1PFT A;  3HOV I;  3HOW I;  4A3K I;  1TWG I;  3S2D I;  3GTL I;  2R92 I;  4A93 I;  4A3L I;  1K83 I;  3GTM I;  3GTK I;  5FLM I;  1YUA A;  3S1Q I;  5C44 I;  4MH4 A;  1I6H I;  2JA8 I;  3CQZ I;  3VMH A;  1QYP A;  2RBL A;  3S14 I;  1ZB8 A;  1Y1V I;  3VB9 A;  2JA7 I;  2NVT I;  3H0G I;  4A3M I;  3H3V J;  2R93 I;  1L1O C;  2AKL A;  2P3Y A;  3EER A;  3HOZ I;  4NBB A;  3RZD I;  2F4M A;  2R7Z I;  5C4X I;  4A3B I;  1TWF I;  3S1N I;  2E2I I;  2J6A A;  1X3W A;  3GTP I;  1ML8 A;  4NBH A;  3HOX I;  2JA6 I;  3S17 I;  4A3C I;  2JS4 A;  2NVY I;  2JR6 A;  5IP7 I;  3S2H I;  4BY7 I;  1WCM I;  3I4N I;  4XX2 A;  2K5R A;  3ESW A;  4BBS I;  1TFI A;  2E2H I;  4NBF A;  1NUI A;  3GTJ I;  3K7A I;  2JNY A;  1USP A;  2BJO A;  1Y1W I;  3Q87 A;  2NVX I;  1R9T I;  2YU9 I;  4NBG A;  2PK7 A;  3GCF A;  3FKI I;  4A3I I;  2JA5 I;  3M3Y I;  4NB9 A;  1TWC I;  4NBC A;  1DL6 A;  3LUS A;  2KPI A;  1USP B;  1X3Z A;  4NB8 A;  5CM2 M;  3PO3 S;  3M4O I;  2HF1 A;  1TWA I;  3RZO I;  4NOZ A; 
#chains in the Genus database with same CATH topology
 1VQ8 Z;  3CCQ 1;  3I55 Z;  2JIR A;  3CC7 Z;  4NBA A;  3MZK B;  4DGL A;  4X6A I;  2QEX Z;  1YJN 1;  1TWH I;  3GTM S;  4BXX I;  3MZL B;  1Z01 A;  3VMI A;  1Q86 2;  3I56 Z;  1N2F A;  3G6E 1;  5C4J I;  3HOY I;  1WJ2 A;  3IFU A;  1Y1V S;  3G4S 1;  1VLA A;  1WW9 A;  2QRE B;  3U50 C;  1M1K 1;  4QTT A;  2E2J I;  1YI2 1;  5FLX f;  4NFR A;  1QVF Z;  2I3C A;  2DE7 A;  2WAQ A;  4HH4 A;  1Q16 A;  1VQP 1;  1S72 1;  3GTL I;  1KD1 1;  2Y0S A;  1K83 I;  3GTK I;  2JIQ A;  5C44 I;  5IT9 b;  4MH4 A;  1RQF A;  3J80 f;  1WZN A;  1YIT 1;  3TE5 B;  1ZB8 A;  3IX0 A;  3JAM f;  3CCU Z;  2R93 I;  1L1O C;  2P3Y A;  3HOZ I;  1K8A 2;  3RZD I;  2RT9 A;  5A2Q f;  1Q7Y 1;  2J6A A;  3F3F C;  4CL1 A;  1ML8 A;  3HOX I;  3S17 I;  2JS4 A;  1QVG Z;  2RHB A;  3NDI A;  1WCM I;  1K9M 2;  3I4N I;  4XX2 A;  1VQ7 Z;  3ESW A;  2OTL Z;  4NBF A;  3GTJ I;  1JWH C;  3D2L A;  1USP A;  1VQM Z;  1N8R 1;  3IF8 A;  1M90 1;  1JJ2 Y;  1Y1W I;  3NFZ A;  4NBG A;  2JA5 I;  3CCE 1;  3NH8 A;  2P28 A;  5D1P A;  1NP6 A;  2NAP A;  3KIH A;  3LUS A;  1Q82 2;  4AYB A;  3IR7 A;  5D1O B;  3RZO I;  2B63 I;  1VQ9 1;  3S16 I;  1QXF A;  2RIQ A;  2LIY A;  1RO4 A;  1K73 2;  1QVG Y;  1I3Q I;  2JMO A;  1KC8 2;  3GTO I;  1Q86 1;  2G2K A;  2QRD B;  1YIJ Z;  2VUM I;  1VQ5 Z;  2KI7 B;  1VQK 1;  3CME 1;  3CCL 1;  4MD8 A;  1Y8C A;  1SFO I;  2Q51 A;  1Q81 2;  4MXU A;  3CCS 1;  2DE5 A;  1YHQ Z;  1VQ8 1;  3HOV I;  3I55 1;  3HOW I;  3CC7 1;  3CCR Z;  2R92 I;  4A93 I;  3CD6 Z;  5FLM I;  2QEX 1;  3T4N B;  2R6M A;  1I6H I;  3VMH A;  3I56 1;  2RBL A;  2NVT I;  3H0G I;  4A3M I;  2VF1 A;  4E30 A;  3J81 b;  5IT9 f;  2OTJ Z;  4NBB A;  2F4M A;  1NJI 2;  2JIP A;  4DQY B;  3S1N I;  1RO2 A;  1X3W A;  2E7Z A;  3CXC Z;  4NBH A;  4A3C I;  2NVY I;  4DK1 A;  2OZK A;  1YJW Z;  2K5R A;  1QF8 A;  2M6N A;  2E2H I;  1VQN Z;  1NUI A;  2V8J A;  3P5J B;  1K9M 1;  3CMA Z;  2H85 A;  3QWU A;  1W2B Z;  2ZAE B;  2LFU A;  2OOX B;  2PK7 A;  2QKD A;  1YJ9 Z;  2PM9 A;  3CCJ 1;  3CCU 1;  1M1K 2;  2QR1 B;  2IV2 X;  4EWC A;  2QLV B;  2KPI A;  1USP B;  1X3Z A;  5CM2 M;  2YAD A;  3M4O I;  1ZH1 A;  1TWA I;  4E2Z A;  2EGT A;  1Q82 1;  3CC4 Z;  3VMG A;  2IZ3 A;  4MD7 A;  1QVF Y;  3EED A;  4BBR I;  3HKZ A;  1KRL A;  3OW2 Z;  4A3G I;  2NVQ I;  3PO2 I;  4MON A;  3CXC Y;  2OTL 1;  4A3F I;  1VQM 1;  2JIM A;  4BY1 I;  1K73 1;  3GKQ A;  1LQL A;  3GTG I;  1VQL 1;  4Y52 I;  1ZB9 A;  1KC8 1;  3BG0 B;  4MD9 A;  4NBD A;  3CCV Z;  2W03 A;  1W2B Y;  1P9N A;  3I07 A;  2GU2 A;  2OOY B;  3D6W A;  4E2Y A;  5T64 A;  3S15 I;  2DE6 A;  4TNU A;  4MRI A;  1VQO Z;  3HOU I;  2WB1 A;  5T6B A;  3KIF A;  3I4M I;  4Y7N I;  1Q81 1;  4A3K I;  1TWG I;  3G71 Z;  4A3L I;  3S1Q I;  1FDO A;  2JUB A;  3FQQ A;  2JIO A;  3CQZ I;  3MON A;  1Z03 A;  4RVD A;  3NH5 A;  1Z02 A;  3S14 I;  3CC2 Z;  2VPY A;  1VQ4 Z;  3OW2 Y;  2JA7 I;  2AKL A;  2QA4 Z;  1YIJ 1;  1VQ6 1;  2LEX A;  5C4X I;  3CCM Z;  1TWF I;  1VQ5 1;  4A3B I;  3NDJ A;  1NJI 1;  3GTP I;  3CCQ Z;  3J81 f;  4HGZ A;  3S2H I;  1YHQ 1;  1YJN Z;  4BBS I;  3CCR 1;  3CD6 1;  4RVG A;  3G6E Z;  2BJO A;  2V8K A;  3G4S Z;  2VPW A;  1R9T I;  3FKI I;  4A3I I;  4NB9 A;  1K8A 1;  1YI2 Z;  4NBC A;  1AA6 A;  1DL6 A;  2OTJ 1;  2AYD A;  2Q4Z A;  4RVH A;  3CPW Z;  1YUK A;  4E2X A;  3J7A 4;  1S7M A;  1VQP Z;  1S72 Z;  1YJW 1;  4E32 A;  1RNI A;  5C3E I;  1JJ2 Z;  1VQN 1;  2F4O A;  3CMA 1;  4E2W A;  1FDI A;  1YIT Z;  4E31 A;  5IP9 I;  3FQM A;  2PMZ A;  3GTQ I;  5FLX b;  2HU9 A;  3TDH B;  2E9H A;  1RLY A;  2GTI A;  4QTU A;  4A3E I;  1YJ9 1;  3S1R I;  2VPX A;  2IZ4 A;  3CCJ Z;  4A3D I;  1I50 I;  4A3J I;  3F3P C;  2VUG A;  3PO3 I;  5AN9 F;  2W04 A;  1VQ7 1;  4NBE A;  2V8I A;  1KD1 2;  3S1M I;  1PFT A;  4S1T A;  3CC4 1;  3J80 b;  4HGY A;  3S2D I;  4RVF A;  3CPW Y;  3JAM b;  2V45 A;  2M48 A;  3GTM I;  2O53 A;  1YUA A;  2JA8 I;  1KQS Z;  1QYP A;  5A2Q b;  3CCE Z;  1Y1V I;  3VB9 A;  3H3V J;  1VQL Z;  3EER A;  1Q7Y 2;  2R7Z I;  3CCV 1;  4RS4 A;  2E2I I;  4E33 A;  5LL6 f;  1WII A;  2JA6 I;  1VQ9 Z;  1VQO 1;  2JR6 A;  2V3V A;  2RPR A;  5IP7 I;  4BY7 I;  2K3R A;  2GTH A;  4NH1 C;  1N8R 2;  1TFI A;  2JNY A;  3K7A I;  1M90 2;  3G71 1;  1RO0 A;  2O4H A;  5D1O A;  4RV9 A;  3Q87 A;  2NVX I;  2YU9 I;  2QRC B;  3GCF A;  3CC2 1;  3M3Y I;  1SIW A;  1VQ4 1;  1TWC I;  3NH4 A;  1VQK Z;  3CME Z;  2QA4 1;  3CCL Z;  3D9X A;  1X0T A;  4NB8 A;  5T67 A;  1KQS Y;  3PO3 S;  1VQ6 Z;  2HF1 A;  3CCM 1;  3CCS Z;  3VTN A;  3BG1 B;  4NOZ A;  2VPZ A; 
#chains in the Genus database with same CATH homology
 1VQ8 Z;  3CCQ 1;  3I55 Z;  3CC7 Z;  4NBA A;  3MZK B;  4DGL A;  4X6A I;  2QEX Z;  1YJN 1;  1TWH I;  3GTM S;  4BXX I;  3MZL B;  1Z01 A;  3VMI A;  1Q86 2;  3I56 Z;  1N2F A;  3G6E 1;  5C4J I;  3HOY I;  3IFU A;  1Y1V S;  3G4S 1;  1VLA A;  1WW9 A;  2QRE B;  3U50 C;  1M1K 1;  4QTT A;  2E2J I;  1YI2 1;  5FLX f;  4NFR A;  1QVF Z;  2I3C A;  2DE7 A;  2WAQ A;  4HH4 A;  1VQP 1;  1S72 1;  3GTL I;  1KD1 1;  2Y0S A;  1K83 I;  3GTK I;  5C44 I;  5IT9 b;  4MH4 A;  1RQF A;  3J80 f;  1YIT 1;  3TE5 B;  1ZB8 A;  3IX0 A;  3JAM f;  3CCU Z;  2R93 I;  1L1O C;  2P3Y A;  3HOZ I;  1K8A 2;  3RZD I;  2RT9 A;  5A2Q f;  1Q7Y 1;  2J6A A;  3F3F C;  4CL1 A;  1ML8 A;  3HOX I;  3S17 I;  2JS4 A;  1QVG Z;  2RHB A;  3NDI A;  1WCM I;  1K9M 2;  3I4N I;  4XX2 A;  1VQ7 Z;  3ESW A;  2OTL Z;  4NBF A;  3GTJ I;  1JWH C;  1USP A;  1VQM Z;  1N8R 1;  3IF8 A;  1M90 1;  1JJ2 Y;  1Y1W I;  3NFZ A;  4NBG A;  2JA5 I;  3CCE 1;  3NH8 A;  2P28 A;  5D1P A;  1NP6 A;  3LUS A;  3KIH A;  1Q82 2;  4AYB A;  5D1O B;  3RZO I;  2B63 I;  1VQ9 1;  3S16 I;  2RIQ A;  2LIY A;  1RO4 A;  1K73 2;  1QVG Y;  1I3Q I;  2JMO A;  1KC8 2;  3GTO I;  1Q86 1;  2G2K A;  2QRD B;  1YIJ Z;  2VUM I;  1VQ5 Z;  2KI7 B;  1VQK 1;  3CME 1;  3CCL 1;  4MD8 A;  1SFO I;  2Q51 A;  1Q81 2;  4MXU A;  3CCS 1;  2DE5 A;  1YHQ Z;  1VQ8 1;  3HOV I;  3I55 1;  3HOW I;  3CC7 1;  3CCR Z;  2R92 I;  4A93 I;  3CD6 Z;  5FLM I;  2QEX 1;  3T4N B;  2R6M A;  1I6H I;  3VMH A;  3I56 1;  2RBL A;  2NVT I;  3H0G I;  4A3M I;  2VF1 A;  4E30 A;  3J81 b;  5IT9 f;  2OTJ Z;  4NBB A;  2F4M A;  1NJI 2;  4DQY B;  3S1N I;  1RO2 A;  1X3W A;  3CXC Z;  4NBH A;  4A3C I;  2NVY I;  4DK1 A;  2OZK A;  1YJW Z;  2K5R A;  1QF8 A;  2M6N A;  2E2H I;  1VQN Z;  1NUI A;  2V8J A;  3P5J B;  1K9M 1;  3CMA Z;  2H85 A;  3QWU A;  1W2B Z;  2ZAE B;  2LFU A;  2OOX B;  2PK7 A;  2QKD A;  1YJ9 Z;  2PM9 A;  3CCJ 1;  3CCU 1;  1M1K 2;  2QR1 B;  4EWC A;  2QLV B;  2KPI A;  1USP B;  1X3Z A;  5CM2 M;  2YAD A;  3M4O I;  1ZH1 A;  1TWA I;  4E2Z A;  2EGT A;  1Q82 1;  3CC4 Z;  3VMG A;  2IZ3 A;  4MD7 A;  1QVF Y;  3EED A;  4BBR I;  3HKZ A;  1KRL A;  3OW2 Z;  4A3G I;  2NVQ I;  3PO2 I;  4MON A;  3CXC Y;  2OTL 1;  4A3F I;  1VQM 1;  4BY1 I;  1K73 1;  3GKQ A;  1LQL A;  3GTG I;  1VQL 1;  4Y52 I;  1ZB9 A;  1KC8 1;  3BG0 B;  4MD9 A;  4NBD A;  3CCV Z;  2W03 A;  1W2B Y;  1P9N A;  3I07 A;  2GU2 A;  2OOY B;  3D6W A;  4E2Y A;  5T64 A;  3S15 I;  2DE6 A;  4TNU A;  4MRI A;  1VQO Z;  3HOU I;  2WB1 A;  5T6B A;  3KIF A;  3I4M I;  4Y7N I;  1Q81 1;  4A3K I;  1TWG I;  3G71 Z;  4A3L I;  3S1Q I;  2JUB A;  3FQQ A;  3CQZ I;  3MON A;  1Z03 A;  4RVD A;  3NH5 A;  1Z02 A;  3S14 I;  3CC2 Z;  1VQ4 Z;  3OW2 Y;  2JA7 I;  2AKL A;  2QA4 Z;  1YIJ 1;  1VQ6 1;  5C4X I;  3CCM Z;  1TWF I;  1VQ5 1;  4A3B I;  3NDJ A;  1NJI 1;  3GTP I;  3CCQ Z;  3J81 f;  4HGZ A;  3S2H I;  1YHQ 1;  1YJN Z;  4BBS I;  3CCR 1;  3CD6 1;  4RVG A;  3G6E Z;  2BJO A;  2V8K A;  3G4S Z;  1R9T I;  3FKI I;  4A3I I;  4NB9 A;  1K8A 1;  1YI2 Z;  4NBC A;  1DL6 A;  2OTJ 1;  2Q4Z A;  4RVH A;  3CPW Z;  1YUK A;  4E2X A;  3J7A 4;  1S7M A;  1VQP Z;  1S72 Z;  1YJW 1;  4E32 A;  1RNI A;  5C3E I;  1JJ2 Z;  1VQN 1;  2F4O A;  3CMA 1;  4E2W A;  1YIT Z;  4E31 A;  5IP9 I;  3FQM A;  2PMZ A;  3GTQ I;  5FLX b;  2HU9 A;  3TDH B;  2E9H A;  1RLY A;  2GTI A;  4QTU A;  4A3E I;  1YJ9 1;  3S1R I;  2IZ4 A;  3CCJ Z;  4A3D I;  1I50 I;  4A3J I;  3F3P C;  2VUG A;  3PO3 I;  5AN9 F;  2W04 A;  1VQ7 1;  4NBE A;  2V8I A;  1KD1 2;  3S1M I;  1PFT A;  4S1T A;  3CC4 1;  3J80 b;  4HGY A;  3S2D I;  4RVF A;  3CPW Y;  3JAM b;  2M48 A;  3GTM I;  2O53 A;  1YUA A;  2JA8 I;  1KQS Z;  1QYP A;  5A2Q b;  3CCE Z;  1Y1V I;  3VB9 A;  3H3V J;  1VQL Z;  3EER A;  1Q7Y 2;  2R7Z I;  3CCV 1;  4RS4 A;  2E2I I;  4E33 A;  5LL6 f;  1WII A;  2JA6 I;  1VQ9 Z;  1VQO 1;  2JR6 A;  2RPR A;  5IP7 I;  4BY7 I;  2K3R A;  2GTH A;  4NH1 C;  1N8R 2;  1TFI A;  2JNY A;  3K7A I;  1M90 2;  3G71 1;  1RO0 A;  2O4H A;  5D1O A;  4RV9 A;  3Q87 A;  2NVX I;  2YU9 I;  2QRC B;  3GCF A;  3CC2 1;  3M3Y I;  1VQ4 1;  1TWC I;  3NH4 A;  1VQK Z;  3D9X A;  2QA4 1;  3CME Z;  3CCL Z;  1X0T A;  4NB8 A;  5T67 A;  1KQS Y;  3PO3 S;  1VQ6 Z;  2HF1 A;  3CCM 1;  3CCS Z;  3VTN A;  3BG1 B;  4NOZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...