4A3LI

Rna polymerase ii initial transcribing complex with a 7nt dna-rna hybrid and soaked with ampcpp
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 13
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3lI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3lI02
3GCFA 1PFTA 2R92I 1X3ZA 3HOZI 2RBLA 2R7ZI 4NBHA 5C4JI 1NUIA 3H0GI 3HOXI 4BBSI 1L1OC 4QTUA 1DL6A 3I4NI 3M3YI 3GTMI 3K7AI 1K83I 1USPA 1QYPA 3Q87A 1WCMI 4A3FI 4NBGA 4A3GI 3PO3S 3GTLI 3S2HI 2JS4A 2PK7A 2JA7I 4A3BI 2JA8I 3HOYI 4QTTA 1TFIA 2E2HI 3U50C 1TWGI 1TWFI 5C4XI 2E2II 3RZDI 4Y52I 4BY1I 2JR6A 1Y1VS 5IP9I 1ML8A 4BXXI 2KPIA 3GKQA 2JA6I 4BY7I 4A3DI 2NVYI 4X6AI 3EERA 3LUSA 3VB9A 3RZOI 3H3VJ 1SFOI 3HOWI 2JA5I 2DE5A 1TWHI 3VMHA 2K5RA 4A3LI 3VMGA 1TWCI 4A3KI 3S1MI 3PO3I 3S17I 3I4MI 3HOVI 3GTPI 1TWAI 3S1QI 3S2DI 4NBAA 4NBFA 2E2JI 3S15I 2R93I 3ESWA 5C44I 2DE7A 3S1RI 2JNYA 5FLMI 3HOUI 1I3QI 4A3JI 2NVQI 1Y1VI 5IP7I 4XX2A 4NBDA 5C3EI 4A3EI 1USPB 2YU9I 1YUAA 1LQLA 1ZB9A 4MH4A 4BBRI 3D6WA 3PO2I 4NB8A 4A3CI 2F4MA 3GTQI 1Y1WI 3S1NI 1I50I 3GTOI 4NBCA 2J6AA 2NVXI 2HF1A 2NVTI 2BJOA 3GTKI 1X3WA 1R9TI 4NOZA 4Y7NI 4A93I 1RLYA 1I6HI 3M4OI 3GTMS 1WW9A 4NBEA 2F4OA 3CQZI 2VUMI 5CM2M 1ZB8A 2DE6A 2P3YA 4A3II 2B63I 3S16I 3S14I 4A3MI 4NB9A 1N2FA 4NBBA 3GTGI 1VLAA 3I07A 3VMIA 3GTJI 1RO4A 2AKLA 3FKII
chains in the Genus database with same CATH superfamily
1JJ2Y 2QA41 2R92I 3HOZI 4MD9A 2KI7B 1SIWA 1Z03A 4BBSI 4S1TA 4QTUA 3NH8A 3IR7A 3G6E1 2IV2X 1YUKA 4RVFA 3GTMI 1KRLA 1QYPA 1WCMI 2QEX1 4A3FI 4NBGA 1YI2Z 1FDOA 5T64A 1TFIA 2VPXA 3J81f 1TWGI 3RZDI 4Y52I 1VQP1 2QA4Z 2OOXB 2JMOA 3EEDA 4EWCA 5IP9I 1VQM1 1NJI1 3NDJA 2IZ4A 4BXXI 2M48A 2KPIA 3MZLB 2JA6I 4A3DI 2VPZA 3CC7Z 3EERA 3KIHA 3RZOI 2QEXZ 3CXCZ 1TWCI 4DQYB 1VQ8Z 2E7ZA 3QWUA 1VQPZ 1WJ2A 3CME1 2OTL1 1FDIA 3S15I 3VTNA 3CXCY 3P5JB 1VQNZ 5FLMI 3HOUI 1I3QI 2W03A 4A3JI 1K9M2 2VPWA 4NBDA 5C3EI 2OOYB 3CCEZ 4MD7A 4DK1A 4E2YA 4RVDA 2AYDA 1S721 2RT9A 1QXFA 1LQLA 4RVHA 1YHQZ 1M902 3D6WA 3PO2I 3CPWZ 1Z01A 3GTOI 3HKZA 3CMEZ 2VUGA 4RVGA 1X3WA 3BG0B 3I55Z 4Y7NI 2W04A 3CPWY 3FQQA 1VQK1 2F4OA 1KQSZ 2GTHA 4E2ZA 1YIJZ 3CD6Z 3CCRZ 1S72Z 2JIMA 2RHBA 1VQ91 1KQSY 3CCJZ 1NJI2 1N8R2 3BG1B 3I07A 2AKLA 2Y0SA 1QF8A 3GCFA 1VQL1 1VQOZ 2RIQA 1NUIA 1L1OC 3I561 1Q16A 1DL6A 3NDIA 3I4NI 2QRCB 3K7AI 1USPA 2V3VA 1Q7Y2 1WIIA 3GTLI 2JIOA 3S2HI 4E30A 4A3BI 3CCVZ 3CCM1 1YJWZ 1TWFI 2YADA 4MRIA 4E32A 4HH4A 4E31A 1VQLZ 2WAQA 1M901 3CC4Z 1QVGZ 3G4SZ 4BY7I 2NVYI 4MXUA 3F3PC 3G71Z 3H3VJ 1KD12 2JA5I 1QVGY 1RO2A 4A3KI 5IT9b 2QR1B 3I4MI 3GTPI 2O4HA 3S1QI 3S2DI 1W2BZ 3F3FC 4NBFA 2R93I 3ESWA 5C44I 2OTJ1 5FLXf 1YJ91 2LFUA 2NVQI 1N8R1 1W2BY 2QKDA 2G2KA 3G6EZ 3NH4A 2RPRA 1USPB 1S7MA 4RS4A 3CCU1 4CL1A 4HGZA 4BBRI 2Q4ZA 5D1OB 4NB8A 4TNUA 1K731 5T67A 3TDHB 1RNIA 1I50I 1Q7Y1 1Q861 1YJN1 1VQMZ 3M4OI 1ZH1A 2VUMI 2EGTA 1ZB8A 4A3II 3S14I 3D2LA 4E33A 3J7A4 4MD8A 3CC21 2V45A 1P9NA 3FKII 1PFTA 1KD11 2QLVB 2OTLZ 4HGYA 2R7ZI 4NBHA 1KC82 3H0GI 3OW2Z 1JWHC 2GTIA 3Q87A 4A3GI 3TE5B 5T6BA 2JS4A 3OW2Y 2JA8I 2R6MA 2LIYA 3HOYI 4QTTA 2E2HI 3U50C 1NP6A 1VQ51 4BY1I 3JAMb 3CCS1 2JR6A 2M6NA 2E9HA 1Z02A 3FQMA 1K732 4RV9A 1VQKZ 1VQ61 3LUSA 3VB9A 1Q821 5IT9f 5A2Qb 3KIFA 1TWHI 2Q51A 2LEXA 2K5RA 1Q862 2V8IA 1VQ9Z 3CMA1 3S17I 3HOVI 1TWAI 1X0TA 1VQ5Z 2E2JI 1RO0A 2QRDB 2JNYA 2K3RA 5IP7I 3I56Z 3CCQ1 2YU9I 5D1PA 1YI21 1JJ2Z 1YUAA 1KC81 1VQ41 2NAPA 3CMAZ 4A3CI 3CCMZ 1M1K1 2HU9A 2F4MA 1Y1WI 3T4NB 2WB1A 4NBCA 2NVXI 4MONA 2NVTI 2BJOA 3GTKI 3MONA 1R9TI 1RLYA 1I6HI 2I3CA 1WW9A 3CC71 4NBEA 2ZAEB 5CM2M 2PM9A 2DE6A 3CCQZ 2VF1A 3J80b 4A3MI 1WZNA 2VPYA 1VQ4Z 4NBBA 1VQ81 2IZ3A 3GTGI 1AA6A 1VQ71 1Q822 1X3ZA 2RBLA 1VQN1 2OTJZ 5C4JI 4NFRA 1YJ9Z 3HOXI 3CCE1 3M3YI 1RQFA 1K83I 4E2XA 3IFUA 3PO3S 3CCUZ 1YHQ1 2PK7A 2JA7I 3CCL1 2H85A 1Q811 3JAMf 2O53A 3NFZA 4NH1C 4E2WA 5C4XI 2E2II 1VQ7Z 1K8A2 3IX0A 3J81b 3NH5A 3I551 1Y1VS 1ML8A 1YJNZ 2JIQA 3GKQA 5A2Qf 4X6AI 5FLXb 1M1K2 4DGLA 1SFOI 3HOWI 1YIJ1 3CD61 3CCR1 5LL6f 2DE5A 3VMHA 4A3LI 3VMGA 3CCLZ 3CCJ1 3S1MI 3PO3I 2V8JA 1Y8CA 3CC2Z 4NBAA 3S1RI 2JIRA 2DE7A 1VQO1 1Y1VI 3IF8A 2GU2A 2PMZA 3D9XA 4XX2A 1YIT1 2JIPA 4A3EI 5AN9F 3CCV1 1ZB9A 4MH4A 1QVFZ 1YJW1 2JUBA 3GTQI 3S1NI 2P28A 2J6AA 2HF1A 3CCSZ 1QVFY 4NOZA 3CC41 4A93I 3MZKB 3G4S1 3J80f 1Q812 3GTMS 1YITZ 3G711 3CQZI 2V8KA 1VQ6Z 2P3YA 2B63I 3S16I 1K8A1 2OZKA 4NB9A 1N2FA 1K9M1 5D1OA 2QREB 1VLAA 3VMIA 3GTJI 1RO4A 4AYBA
chains in the Genus database with same CATH topology
1JJ2Y 2QA41 2R92I 3HOZI 4MD9A 2KI7B 1Z03A 4BBSI 4S1TA 4QTUA 3NH8A 3G6E1 1YUKA 4RVFA 3GTMI 1KRLA 1QYPA 1WCMI 2QEX1 4A3FI 4NBGA 1YI2Z 5T64A 1TFIA 3J81f 1TWGI 3RZDI 4Y52I 1VQP1 2QA4Z 2OOXB 2JMOA 3EEDA 4EWCA 5IP9I 1VQM1 1NJI1 3NDJA 2IZ4A 4BXXI 2M48A 2KPIA 3MZLB 2JA6I 4A3DI 3CC7Z 3EERA 3KIHA 3RZOI 2QEXZ 3CXCZ 1TWCI 4DQYB 1VQ8Z 3QWUA 1VQPZ 3CME1 2OTL1 3S15I 3VTNA 3CXCY 3P5JB 1VQNZ 5FLMI 3HOUI 1I3QI 2W03A 4A3JI 1K9M2 4NBDA 5C3EI 2OOYB 3CCEZ 4MD7A 4DK1A 4E2YA 4RVDA 1S721 2RT9A 1LQLA 4RVHA 1YHQZ 1M902 3D6WA 3PO2I 3CPWZ 1Z01A 3GTOI 3HKZA 3CMEZ 2VUGA 4RVGA 1X3WA 3BG0B 3I55Z 4Y7NI 2W04A 3CPWY 3FQQA 1VQK1 2F4OA 1KQSZ 2GTHA 4E2ZA 1YIJZ 3CD6Z 3CCRZ 1S72Z 2RHBA 1VQ91 1KQSY 3CCJZ 1NJI2 1N8R2 3BG1B 3I07A 2AKLA 2Y0SA 1QF8A 3GCFA 1VQL1 1VQOZ 2RIQA 1NUIA 1L1OC 3I561 1DL6A 3NDIA 3I4NI 2QRCB 3K7AI 1USPA 1Q7Y2 1WIIA 3GTLI 3S2HI 4E30A 4A3BI 3CCVZ 3CCM1 1YJWZ 1TWFI 2YADA 4MRIA 4E32A 4HH4A 4E31A 1VQLZ 2WAQA 1M901 3CC4Z 1QVGZ 3G4SZ 4BY7I 2NVYI 4MXUA 3F3PC 3G71Z 3H3VJ 1KD12 2JA5I 1QVGY 1RO2A 4A3KI 5IT9b 2QR1B 3I4MI 3GTPI 2O4HA 3S1QI 3S2DI 1W2BZ 3F3FC 4NBFA 2R93I 3ESWA 5C44I 2OTJ1 5FLXf 1YJ91 2LFUA 2NVQI 1N8R1 1W2BY 2QKDA 2G2KA 3G6EZ 3NH4A 2RPRA 1USPB 1S7MA 4RS4A 3CCU1 4CL1A 4HGZA 4BBRI 2Q4ZA 5D1OB 4NB8A 4TNUA 1K731 5T67A 3TDHB 1RNIA 1I50I 1Q7Y1 1Q861 1YJN1 1VQMZ 3M4OI 1ZH1A 2VUMI 2EGTA 1ZB8A 4A3II 3S14I 4E33A 3J7A4 4MD8A 3CC21 1P9NA 3FKII 1PFTA 1KD11 2QLVB 2OTLZ 4HGYA 2R7ZI 4NBHA 1KC82 3H0GI 3OW2Z 1JWHC 2GTIA 3Q87A 4A3GI 3TE5B 5T6BA 2JS4A 3OW2Y 2JA8I 2R6MA 2LIYA 3HOYI 4QTTA 2E2HI 3U50C 1NP6A 1VQ51 4BY1I 3JAMb 3CCS1 2JR6A 2M6NA 2E9HA 1Z02A 3FQMA 1K732 4RV9A 1VQKZ 1VQ61 3LUSA 3VB9A 1Q821 5IT9f 5A2Qb 3KIFA 1TWHI 2Q51A 2K5RA 1Q862 2V8IA 1VQ9Z 3CMA1 3S17I 3HOVI 1TWAI 1X0TA 1VQ5Z 2E2JI 1RO0A 2QRDB 2JNYA 2K3RA 5IP7I 3I56Z 3CCQ1 2YU9I 5D1PA 1YI21 1JJ2Z 1YUAA 1KC81 1VQ41 3CMAZ 4A3CI 3CCMZ 1M1K1 2HU9A 2F4MA 1Y1WI 3T4NB 2WB1A 4NBCA 2NVXI 4MONA 2NVTI 2BJOA 3GTKI 3MONA 1R9TI 1RLYA 1I6HI 2I3CA 1WW9A 3CC71 4NBEA 2ZAEB 5CM2M 2PM9A 2DE6A 3CCQZ 2VF1A 3J80b 4A3MI 1VQ4Z 4NBBA 1VQ81 2IZ3A 3GTGI 1VQ71 1Q822 1X3ZA 2RBLA 1VQN1 2OTJZ 5C4JI 4NFRA 1YJ9Z 3HOXI 3CCE1 3M3YI 1RQFA 1K83I 4E2XA 3IFUA 3PO3S 3CCUZ 1YHQ1 2PK7A 2JA7I 3CCL1 2H85A 1Q811 3JAMf 2O53A 3NFZA 4NH1C 4E2WA 5C4XI 2E2II 1VQ7Z 1K8A2 3IX0A 3J81b 3NH5A 3I551 1Y1VS 1ML8A 1YJNZ 3GKQA 5A2Qf 4X6AI 5FLXb 1M1K2 4DGLA 1SFOI 3HOWI 1YIJ1 3CD61 3CCR1 5LL6f 2DE5A 3VMHA 4A3LI 3VMGA 3CCLZ 3CCJ1 3S1MI 3PO3I 2V8JA 3CC2Z 4NBAA 3S1RI 1VQO1 2DE7A 1Y1VI 3IF8A 2GU2A 2PMZA 3D9XA 4XX2A 1YIT1 4A3EI 5AN9F 3CCV1 1ZB9A 4MH4A 1QVFZ 1YJW1 2JUBA 3GTQI 3S1NI 2P28A 2J6AA 2HF1A 3CCSZ 1QVFY 4NOZA 3CC41 4A93I 3MZKB 3G4S1 3J80f 1Q812 3GTMS 1YITZ 3G711 3CQZI 2V8KA 1VQ6Z 2P3YA 2B63I 3S16I 1K8A1 2OZKA 4NB9A 1N2FA 1K9M1 5D1OA 2QREB 1VLAA 3VMIA 3GTJI 1RO4A 4AYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GCF A;  1PFT A;  2R92 I;  1X3Z A;  3HOZ I;  2RBL A;  2R7Z I;  4NBH A;  5C4J I;  1NUI A;  3H0G I;  3HOX I;  4BBS I;  1L1O C;  4QTU A;  1DL6 A;  3I4N I;  3M3Y I;  3GTM I;  3K7A I;  1K83 I;  1USP A;  1QYP A;  3Q87 A;  1WCM I;  4A3F I;  4NBG A;  4A3G I;  3PO3 S;  3GTL I;  3S2H I;  2JS4 A;  2PK7 A;  2JA7 I;  4A3B I;  2JA8 I;  3HOY I;  4QTT A;  1TFI A;  2E2H I;  3U50 C;  1TWG I;  1TWF I;  5C4X I;  2E2I I;  3RZD I;  4Y52 I;  4BY1 I;  2JR6 A;  1Y1V S;  5IP9 I;  1ML8 A;  4BXX I;  2KPI A;  3GKQ A;  2JA6 I;  4BY7 I;  4A3D I;  2NVY I;  4X6A I;  3EER A;  3LUS A;  3VB9 A;  3RZO I;  3H3V J;  1SFO I;  3HOW I;  2JA5 I;  2DE5 A;  1TWH I;  3VMH A;  2K5R A;  4A3L I;  3VMG A;  1TWC I;  4A3K I;  3S1M I;  3PO3 I;  3S17 I;  3I4M I;  3HOV I;  3GTP I;  1TWA I;  3S1Q I;  3S2D I;  4NBA A;  4NBF A;  2E2J I;  3S15 I;  2R93 I;  3ESW A;  5C44 I;  2DE7 A;  3S1R I;  2JNY A;  5FLM I;  3HOU I;  1I3Q I;  4A3J I;  2NVQ I;  1Y1V I;  5IP7 I;  4XX2 A;  4NBD A;  5C3E I;  4A3E I;  1USP B;  2YU9 I;  1YUA A;  1LQL A;  1ZB9 A;  4MH4 A;  4BBR I;  3D6W A;  3PO2 I;  4NB8 A;  4A3C I;  2F4M A;  3GTQ I;  1Y1W I;  3S1N I;  1I50 I;  3GTO I;  4NBC A;  2J6A A;  2NVX I;  2HF1 A;  2NVT I;  2BJO A;  3GTK I;  1X3W A;  1R9T I;  4NOZ A;  4Y7N I;  4A93 I;  1RLY A;  1I6H I;  3M4O I;  3GTM S;  1WW9 A;  4NBE A;  2F4O A;  3CQZ I;  2VUM I;  5CM2 M;  1ZB8 A;  2DE6 A;  2P3Y A;  4A3I I;  2B63 I;  3S16 I;  3S14 I;  4A3M I;  4NB9 A;  1N2F A;  4NBB A;  3GTG I;  1VLA A;  3I07 A;  3VMI A;  3GTJ I;  1RO4 A;  2AKL A;  3FKI I; 
#chains in the Genus database with same CATH topology
 1JJ2 Y;  2QA4 1;  2R92 I;  3HOZ I;  4MD9 A;  2KI7 B;  1SIW A;  1Z03 A;  4BBS I;  4S1T A;  4QTU A;  3NH8 A;  3IR7 A;  3G6E 1;  2IV2 X;  1YUK A;  4RVF A;  3GTM I;  1KRL A;  1QYP A;  1WCM I;  2QEX 1;  4A3F I;  4NBG A;  1YI2 Z;  1FDO A;  5T64 A;  1TFI A;  2VPX A;  3J81 f;  1TWG I;  3RZD I;  4Y52 I;  1VQP 1;  2QA4 Z;  2OOX B;  2JMO A;  3EED A;  4EWC A;  5IP9 I;  1VQM 1;  1NJI 1;  3NDJ A;  2IZ4 A;  4BXX I;  2M48 A;  2KPI A;  3MZL B;  2JA6 I;  4A3D I;  2VPZ A;  3CC7 Z;  3EER A;  3KIH A;  3RZO I;  2QEX Z;  3CXC Z;  1TWC I;  4DQY B;  1VQ8 Z;  2E7Z A;  3QWU A;  1VQP Z;  1WJ2 A;  3CME 1;  2OTL 1;  1FDI A;  3S15 I;  3VTN A;  3CXC Y;  3P5J B;  1VQN Z;  5FLM I;  3HOU I;  1I3Q I;  2W03 A;  4A3J I;  1K9M 2;  2VPW A;  4NBD A;  5C3E I;  2OOY B;  3CCE Z;  4MD7 A;  4DK1 A;  4E2Y A;  4RVD A;  2AYD A;  1S72 1;  2RT9 A;  1QXF A;  1LQL A;  4RVH A;  1YHQ Z;  1M90 2;  3D6W A;  3PO2 I;  3CPW Z;  1Z01 A;  3GTO I;  3HKZ A;  3CME Z;  2VUG A;  4RVG A;  1X3W A;  3BG0 B;  3I55 Z;  4Y7N I;  2W04 A;  3CPW Y;  3FQQ A;  1VQK 1;  2F4O A;  1KQS Z;  2GTH A;  4E2Z A;  1YIJ Z;  3CD6 Z;  3CCR Z;  1S72 Z;  2JIM A;  2RHB A;  1VQ9 1;  1KQS Y;  3CCJ Z;  1NJI 2;  1N8R 2;  3BG1 B;  3I07 A;  2AKL A;  2Y0S A;  1QF8 A;  3GCF A;  1VQL 1;  1VQO Z;  2RIQ A;  1NUI A;  1L1O C;  3I56 1;  1Q16 A;  1DL6 A;  3NDI A;  3I4N I;  2QRC B;  3K7A I;  1USP A;  2V3V A;  1Q7Y 2;  1WII A;  3GTL I;  2JIO A;  3S2H I;  4E30 A;  4A3B I;  3CCV Z;  3CCM 1;  1YJW Z;  1TWF I;  2YAD A;  4MRI A;  4E32 A;  4HH4 A;  4E31 A;  1VQL Z;  2WAQ A;  1M90 1;  3CC4 Z;  1QVG Z;  3G4S Z;  4BY7 I;  2NVY I;  4MXU A;  3F3P C;  3G71 Z;  3H3V J;  1KD1 2;  2JA5 I;  1QVG Y;  1RO2 A;  4A3K I;  5IT9 b;  2QR1 B;  3I4M I;  3GTP I;  2O4H A;  3S1Q I;  3S2D I;  1W2B Z;  3F3F C;  4NBF A;  2R93 I;  3ESW A;  5C44 I;  2OTJ 1;  5FLX f;  1YJ9 1;  2LFU A;  2NVQ I;  1N8R 1;  1W2B Y;  2QKD A;  2G2K A;  3G6E Z;  3NH4 A;  2RPR A;  1USP B;  1S7M A;  4RS4 A;  3CCU 1;  4CL1 A;  4HGZ A;  4BBR I;  2Q4Z A;  5D1O B;  4NB8 A;  4TNU A;  1K73 1;  5T67 A;  3TDH B;  1RNI A;  1I50 I;  1Q7Y 1;  1Q86 1;  1YJN 1;  1VQM Z;  3M4O I;  1ZH1 A;  2VUM I;  2EGT A;  1ZB8 A;  4A3I I;  3S14 I;  3D2L A;  4E33 A;  3J7A 4;  4MD8 A;  3CC2 1;  2V45 A;  1P9N A;  3FKI I;  1PFT A;  1KD1 1;  2QLV B;  2OTL Z;  4HGY A;  2R7Z I;  4NBH A;  1KC8 2;  3H0G I;  3OW2 Z;  1JWH C;  2GTI A;  3Q87 A;  4A3G I;  3TE5 B;  5T6B A;  2JS4 A;  3OW2 Y;  2JA8 I;  2R6M A;  2LIY A;  3HOY I;  4QTT A;  2E2H I;  3U50 C;  1NP6 A;  1VQ5 1;  4BY1 I;  3JAM b;  3CCS 1;  2JR6 A;  2M6N A;  2E9H A;  1Z02 A;  3FQM A;  1K73 2;  4RV9 A;  1VQK Z;  1VQ6 1;  3LUS A;  3VB9 A;  1Q82 1;  5IT9 f;  5A2Q b;  3KIF A;  1TWH I;  2Q51 A;  2LEX A;  2K5R A;  1Q86 2;  2V8I A;  1VQ9 Z;  3CMA 1;  3S17 I;  3HOV I;  1TWA I;  1X0T A;  1VQ5 Z;  2E2J I;  1RO0 A;  2QRD B;  2JNY A;  2K3R A;  5IP7 I;  3I56 Z;  3CCQ 1;  2YU9 I;  5D1P A;  1YI2 1;  1JJ2 Z;  1YUA A;  1KC8 1;  1VQ4 1;  2NAP A;  3CMA Z;  4A3C I;  3CCM Z;  1M1K 1;  2HU9 A;  2F4M A;  1Y1W I;  3T4N B;  2WB1 A;  4NBC A;  2NVX I;  4MON A;  2NVT I;  2BJO A;  3GTK I;  3MON A;  1R9T I;  1RLY A;  1I6H I;  2I3C A;  1WW9 A;  3CC7 1;  4NBE A;  2ZAE B;  5CM2 M;  2PM9 A;  2DE6 A;  3CCQ Z;  2VF1 A;  3J80 b;  4A3M I;  1WZN A;  2VPY A;  1VQ4 Z;  4NBB A;  1VQ8 1;  2IZ3 A;  3GTG I;  1AA6 A;  1VQ7 1;  1Q82 2;  1X3Z A;  2RBL A;  1VQN 1;  2OTJ Z;  5C4J I;  4NFR A;  1YJ9 Z;  3HOX I;  3CCE 1;  3M3Y I;  1RQF A;  1K83 I;  4E2X A;  3IFU A;  3PO3 S;  3CCU Z;  1YHQ 1;  2PK7 A;  2JA7 I;  3CCL 1;  2H85 A;  1Q81 1;  3JAM f;  2O53 A;  3NFZ A;  4NH1 C;  4E2W A;  5C4X I;  2E2I I;  1VQ7 Z;  1K8A 2;  3IX0 A;  3J81 b;  3NH5 A;  3I55 1;  1Y1V S;  1ML8 A;  1YJN Z;  2JIQ A;  3GKQ A;  5A2Q f;  4X6A I;  5FLX b;  1M1K 2;  4DGL A;  1SFO I;  3HOW I;  1YIJ 1;  3CD6 1;  3CCR 1;  5LL6 f;  2DE5 A;  3VMH A;  4A3L I;  3VMG A;  3CCL Z;  3CCJ 1;  3S1M I;  3PO3 I;  2V8J A;  1Y8C A;  3CC2 Z;  4NBA A;  3S1R I;  2JIR A;  2DE7 A;  1VQO 1;  1Y1V I;  3IF8 A;  2GU2 A;  2PMZ A;  3D9X A;  4XX2 A;  1YIT 1;  2JIP A;  4A3E I;  5AN9 F;  3CCV 1;  1ZB9 A;  4MH4 A;  1QVF Z;  1YJW 1;  2JUB A;  3GTQ I;  3S1N I;  2P28 A;  2J6A A;  2HF1 A;  3CCS Z;  1QVF Y;  4NOZ A;  3CC4 1;  4A93 I;  3MZK B;  3G4S 1;  3J80 f;  1Q81 2;  3GTM S;  1YIT Z;  3G71 1;  3CQZ I;  2V8K A;  1VQ6 Z;  2P3Y A;  2B63 I;  3S16 I;  1K8A 1;  2OZK A;  4NB9 A;  1N2F A;  1K9M 1;  5D1O A;  2QRE B;  1VLA A;  3VMI A;  3GTJ I;  1RO4 A;  4AYB A; 
#chains in the Genus database with same CATH homology
 1JJ2 Y;  2QA4 1;  2R92 I;  3HOZ I;  4MD9 A;  2KI7 B;  1Z03 A;  4BBS I;  4S1T A;  4QTU A;  3NH8 A;  3G6E 1;  1YUK A;  4RVF A;  3GTM I;  1KRL A;  1QYP A;  1WCM I;  2QEX 1;  4A3F I;  4NBG A;  1YI2 Z;  5T64 A;  1TFI A;  3J81 f;  1TWG I;  3RZD I;  4Y52 I;  1VQP 1;  2QA4 Z;  2OOX B;  2JMO A;  3EED A;  4EWC A;  5IP9 I;  1VQM 1;  1NJI 1;  3NDJ A;  2IZ4 A;  4BXX I;  2M48 A;  2KPI A;  3MZL B;  2JA6 I;  4A3D I;  3CC7 Z;  3EER A;  3KIH A;  3RZO I;  2QEX Z;  3CXC Z;  1TWC I;  4DQY B;  1VQ8 Z;  3QWU A;  1VQP Z;  3CME 1;  2OTL 1;  3S15 I;  3VTN A;  3CXC Y;  3P5J B;  1VQN Z;  5FLM I;  3HOU I;  1I3Q I;  2W03 A;  4A3J I;  1K9M 2;  4NBD A;  5C3E I;  2OOY B;  3CCE Z;  4MD7 A;  4DK1 A;  4E2Y A;  4RVD A;  1S72 1;  2RT9 A;  1LQL A;  4RVH A;  1YHQ Z;  1M90 2;  3D6W A;  3PO2 I;  3CPW Z;  1Z01 A;  3GTO I;  3HKZ A;  3CME Z;  2VUG A;  4RVG A;  1X3W A;  3BG0 B;  3I55 Z;  4Y7N I;  2W04 A;  3CPW Y;  3FQQ A;  1VQK 1;  2F4O A;  1KQS Z;  2GTH A;  4E2Z A;  1YIJ Z;  3CD6 Z;  3CCR Z;  1S72 Z;  2RHB A;  1VQ9 1;  1KQS Y;  3CCJ Z;  1NJI 2;  1N8R 2;  3BG1 B;  3I07 A;  2AKL A;  2Y0S A;  1QF8 A;  3GCF A;  1VQL 1;  1VQO Z;  2RIQ A;  1NUI A;  1L1O C;  3I56 1;  1DL6 A;  3NDI A;  3I4N I;  2QRC B;  3K7A I;  1USP A;  1Q7Y 2;  1WII A;  3GTL I;  3S2H I;  4E30 A;  4A3B I;  3CCV Z;  3CCM 1;  1YJW Z;  1TWF I;  2YAD A;  4MRI A;  4E32 A;  4HH4 A;  4E31 A;  1VQL Z;  2WAQ A;  1M90 1;  3CC4 Z;  1QVG Z;  3G4S Z;  4BY7 I;  2NVY I;  4MXU A;  3F3P C;  3G71 Z;  3H3V J;  1KD1 2;  2JA5 I;  1QVG Y;  1RO2 A;  4A3K I;  5IT9 b;  2QR1 B;  3I4M I;  3GTP I;  2O4H A;  3S1Q I;  3S2D I;  1W2B Z;  3F3F C;  4NBF A;  2R93 I;  3ESW A;  5C44 I;  2OTJ 1;  5FLX f;  1YJ9 1;  2LFU A;  2NVQ I;  1N8R 1;  1W2B Y;  2QKD A;  2G2K A;  3G6E Z;  3NH4 A;  2RPR A;  1USP B;  1S7M A;  4RS4 A;  3CCU 1;  4CL1 A;  4HGZ A;  4BBR I;  2Q4Z A;  5D1O B;  4NB8 A;  4TNU A;  1K73 1;  5T67 A;  3TDH B;  1RNI A;  1I50 I;  1Q7Y 1;  1Q86 1;  1YJN 1;  1VQM Z;  3M4O I;  1ZH1 A;  2VUM I;  2EGT A;  1ZB8 A;  4A3I I;  3S14 I;  4E33 A;  3J7A 4;  4MD8 A;  3CC2 1;  1P9N A;  3FKI I;  1PFT A;  1KD1 1;  2QLV B;  2OTL Z;  4HGY A;  2R7Z I;  4NBH A;  1KC8 2;  3H0G I;  3OW2 Z;  1JWH C;  2GTI A;  3Q87 A;  4A3G I;  3TE5 B;  5T6B A;  2JS4 A;  3OW2 Y;  2JA8 I;  2R6M A;  2LIY A;  3HOY I;  4QTT A;  2E2H I;  3U50 C;  1NP6 A;  1VQ5 1;  4BY1 I;  3JAM b;  3CCS 1;  2JR6 A;  2M6N A;  2E9H A;  1Z02 A;  3FQM A;  1K73 2;  4RV9 A;  1VQK Z;  1VQ6 1;  3LUS A;  3VB9 A;  1Q82 1;  5IT9 f;  5A2Q b;  3KIF A;  1TWH I;  2Q51 A;  2K5R A;  1Q86 2;  2V8I A;  1VQ9 Z;  3CMA 1;  3S17 I;  3HOV I;  1TWA I;  1X0T A;  1VQ5 Z;  2E2J I;  1RO0 A;  2QRD B;  2JNY A;  2K3R A;  5IP7 I;  3I56 Z;  3CCQ 1;  2YU9 I;  5D1P A;  1YI2 1;  1JJ2 Z;  1YUA A;  1KC8 1;  1VQ4 1;  3CMA Z;  4A3C I;  3CCM Z;  1M1K 1;  2HU9 A;  2F4M A;  1Y1W I;  3T4N B;  2WB1 A;  4NBC A;  2NVX I;  4MON A;  2NVT I;  2BJO A;  3GTK I;  3MON A;  1R9T I;  1RLY A;  1I6H I;  2I3C A;  1WW9 A;  3CC7 1;  4NBE A;  2ZAE B;  5CM2 M;  2PM9 A;  2DE6 A;  3CCQ Z;  2VF1 A;  3J80 b;  4A3M I;  1VQ4 Z;  4NBB A;  1VQ8 1;  2IZ3 A;  3GTG I;  1VQ7 1;  1Q82 2;  1X3Z A;  2RBL A;  1VQN 1;  2OTJ Z;  5C4J I;  4NFR A;  1YJ9 Z;  3HOX I;  3CCE 1;  3M3Y I;  1RQF A;  1K83 I;  4E2X A;  3IFU A;  3PO3 S;  3CCU Z;  1YHQ 1;  2PK7 A;  2JA7 I;  3CCL 1;  2H85 A;  1Q81 1;  3JAM f;  2O53 A;  3NFZ A;  4NH1 C;  4E2W A;  5C4X I;  2E2I I;  1VQ7 Z;  1K8A 2;  3IX0 A;  3J81 b;  3NH5 A;  3I55 1;  1Y1V S;  1ML8 A;  1YJN Z;  3GKQ A;  5A2Q f;  4X6A I;  5FLX b;  1M1K 2;  4DGL A;  1SFO I;  3HOW I;  1YIJ 1;  3CD6 1;  3CCR 1;  5LL6 f;  2DE5 A;  3VMH A;  4A3L I;  3VMG A;  3CCL Z;  3CCJ 1;  3S1M I;  3PO3 I;  2V8J A;  3CC2 Z;  4NBA A;  3S1R I;  1VQO 1;  2DE7 A;  1Y1V I;  3IF8 A;  2GU2 A;  2PMZ A;  3D9X A;  4XX2 A;  1YIT 1;  4A3E I;  5AN9 F;  3CCV 1;  1ZB9 A;  4MH4 A;  1QVF Z;  1YJW 1;  2JUB A;  3GTQ I;  3S1N I;  2P28 A;  2J6A A;  2HF1 A;  3CCS Z;  1QVF Y;  4NOZ A;  3CC4 1;  4A93 I;  3MZK B;  3G4S 1;  3J80 f;  1Q81 2;  3GTM S;  1YIT Z;  3G71 1;  3CQZ I;  2V8K A;  1VQ6 Z;  2P3Y A;  2B63 I;  3S16 I;  1K8A 1;  2OZK A;  4NB9 A;  1N2F A;  1K9M 1;  5D1O A;  2QRE B;  1VLA A;  3VMI A;  3GTJ I;  1RO4 A;  4AYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...