1VQ7Z

The structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
73
structure length
73
Chain Sequence
b'RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vq7Z00
3CCQZ 3G71Z 1JJ2Z 1VQK1 1N8R2 1JJ2Y 1Q821 1VQLZ 1KC82 3CC4Z 1VQNZ 3CMEZ 1K8A2 1N8R1 1KC81 3CCQ1 3CCVZ 1W2BZ 3CCU1 1M1K2 1W2BY 3CCJZ 3CC7Z 1QVGZ 1QVGY 1Q811 3CC41 1M1K1 1VQN1 1VQ91 3CD6Z 1YI2Z 1VQMZ 1VQ41 3CCJ1 3CC71 1Q7Y2 1YJ9Z 3CCRZ 3I55Z 1YJNZ 3CCEZ 1YJW1 1Q862 3CMA1 3CD61 3G6EZ 1YIJZ 1Q7Y1 2QEXZ 1K732 1YI21 1S72Z 3I56Z 3G711 3CCLZ 1Q861 1YHQZ 1K8A1 3CCSZ 3CCMZ 1K731 1VQL1 1YJ91 3I551 1YJN1 1VQPZ 3CCE1 3CME1 3G4SZ 3G6E1 1YIJ1 1VQ6Z 1YITZ 2QEX1 1KQSZ 1VQOZ 1S721 3CCV1 3I561 1KQSY 2OTJZ 1VQ7Z 3CCL1 3OW2Z 3OW2Y 1VQKZ 1YIT1 1VQ61 1VQM1 3CPWZ 2OTJ1 1NJI2 3CPWY 1VQ5Z 1VQ8Z 3CCR1 3CCUZ 1NJI1 2QA4Z 1QVFZ 1M902 3CXCZ 1QVFY 3CXCY 1VQ9Z 1VQ51 1YHQ1 2OTLZ 3CCS1 3CCM1 1VQ81 3CC2Z 1Q812 1KD11 1M901 1VQ4Z 1VQP1 3G4S1 2QA41 1KD12 1K9M2 1VQO1 1K9M1 1VQ71 1YJWZ 3CMAZ 2OTL1 1Q822 3CC21
chains in the Genus database with same CATH superfamily
2VF1A 3GTLI 3S1QI 1Y1WI 1N8R2 1NP6A 4A3JI 1Q821 2P3YA 3CC4Z 4NBGA 2Q51A 1X3ZA 1K8A2 3MZLB 1RLYA 3JAMb 3GTMS 1TWHI 3GKQA 2RPRA 1Q16A 3CCU1 1M1K2 1W2BY 1QVGZ 1Q811 5C4JI 3CC41 3I4NI 4A3DI 3F3PC 5D1OB 3QWUA 1VQMZ 2W03A 3IFUA 1Q7Y2 1Z01A 5IP7I 3I55Z 3CCEZ 1YJW1 3G6EZ 1QXFA 3NFZA 4NBAA 1S72Z 3I56Z 3G711 2M6NA 2QRCB 2YU9I 3JAMf 3CCLZ 4BBRI 4DQYB 1Q861 1YHQZ 4A3KI 1X3WA 2G2KA 2RT9A 3T4NB 3I551 3HOZI 3CCE1 1VQPZ 3G6E1 1ZB9A 3FQQA 1KQSZ 1S721 3Q87A 3I561 2JA8I 1VQ7Z 3CCL1 4A3EI 3I07A 3J7A4 1TWAI 4E2WA 3OW2Y 3EEDA 3NDIA 3CPWY 2QREB 1VQ5Z 3VTNA 2E9HA 4A3BI 2ZAEB 5FLXb 2R6MA 3GTOI 3NH5A 5IT9f 1QVFY 2JIRA 3H3VJ 2E2HI 1S7MA 1VQ51 1TWFI 2QKDA 3CCM1 5C4XI 4MD9A 4E31A 4QTUA 2E2II 3NH8A 1KD12 1VQO1 1K9M1 3CMAZ 4DGLA 1Z03A 1VQK1 3HOVI 1KC82 1FDIA 5FLXf 2AKLA 2K3RA 3CMEZ 1DL6A 2PK7A 1N8R1 3HOYI 3CCVZ 4TNUA 5LL6f 1W2BZ 3VMIA 1WW9A 5D1OA 1I6HI 2YADA 4RVFA 1M1K1 1VQ91 4E2YA 1Y8CA 2QR1B 3U50C 2LEXA 3S2HI 2KI7B 2IZ4A 3BG0B 2GTIA 1KRLA 1TWCI 3IF8A 1USPB 1YJNZ 3H0GI 3NH4A 1Q7Y1 1ZH1A 4S1TA 4E33A 2RHBA 3S15I 2JA5I 2NAPA 1N2FA 1YJN1 3VB9A 2DE6A 2DE7A 2F4OA 1VQ6Z 2Q4ZA 2LFUA 2EGTA 3VMHA 2JR6A 3OW2Z 1L1OC 2NVYI 1VQ61 1VQM1 3J80b 5D1PA 3CPWZ 4NBHA 2OOXB 1NJI2 1WCMI 4NBDA 1WIIA 2V8JA 1JWHC 2RBLA 1X0TA 4HH4A 4MD7A 1QVFZ 5T6BA 5FLMI 3CXCY 4NBFA 2BJOA 1YHQ1 1RQFA 1Q812 2H85A 1RO4A 1VQ4Z 2I3CA 1VQP1 4E30A 3TDHB 3GTJI 2AYDA 2GTHA 1VQ71 5C44I 3J80f 5AN9F 4EWCA 2RIQA 1KD11 2LIYA 4AYBA 1I3QI 4E2ZA 4RVDA 3S14I 3GTKI 2J6AA 4A3CI 3HOXI 4A93I 1FDOA 3LUSA 2IZ3A 2V8IA 1JJ2Y 3S16I 1VQLZ 2OOYB 2IV2X 3IX0A 2V3VA 3MONA 1KC81 3TE5B 1Z02A 3CC7Z 3S1MI 3IR7A 1ML8A 3KIHA 4CL1A 2QLVB 2F4MA 4RVHA 2R92I 4NFRA 1USPA 3CC71 2HU9A 1YJ9Z 3CCRZ 3PO2I 2JA7I 3GTGI 5T67A 3CMA1 2VPYA 4NBBA 2QRDB 4X6AI 2QEXZ 1K732 4E2XA 3D6WA 2R7ZI 4MD8A 4RS4A 2KPIA 4A3LI 1RO0A 1QF8A 3CCSZ 3FQMA 1K8A1 2HF1A 4BY1I 1YJ91 1ZB8A 4NH1C 4NB9A 3G4SZ 3CME1 3S1RI 2QEX1 1P9NA 3CCV1 2JIOA 4NB8A 2OTJZ 2OZKA 1R9TI 1Y1VI 1VLAA 2NVXI 4NOZA 2JNYA 2VPWA 3D2LA 2NVQI 4Y52I 2B63I 2OTJ1 2JIPA 4MONA 2VPXA 1VQ8Z 2JA6I 4A3FI 1K83I 3CCUZ 1NJI1 2QA4Z 1M902 3CXCZ 2NVTI 3I4MI 2OTLZ 1VQ81 4MRIA 2QA41 1K9M2 3M4OI 3P5JB 3GTQI 1YUAA 3HKZA 3KIFA 4XX2A 1YJWZ 2OTL1 4HGZA 4RV9A 1Q822 3ESWA 3HOUI 3CCQZ 3G71Z 1RO2A 3M3YI 5CM2M 1JJ2Z 3F3FC 1TFIA 2GU2A 3S1NI 1VQNZ 3PO3I 2E7ZA 3CCQ1 3BG1B 3CCJZ 2M48A 5IP9I 3VMGA 4BXXI 1TWGI 4BBSI 1QVGY 4BY7I 1YUKA 1VQN1 4A3MI 1LQLA 3J81b 3CD6Z 5IT9b 2JS4A 2PMZA 5T64A 2P28A 3K7AI 1SFOI 2VUMI 2VPZA 1YI2Z 2VUGA 1PFTA 2V45A 1VQ41 4NBCA 3CCJ1 3RZOI 2R93I 2WB1A 4E32A 3GTMI 2WAQA 1Q862 2V8KA 3CD61 1Y1VS 1YIJZ 2K5RA 1YI21 4A3GI 3EERA 5A2Qb 3CCMZ 1K731 1VQL1 4DK1A 3S2DI 2JUBA 3HOWI 3GTPI 1AA6A 1YIJ1 3MZKB 3CQZI 1YITZ 3RZDI 3J81f 1VQOZ 2Y0SA 1KQSY 1I50I 1WZNA 1SIWA 3D9XA 3S17I 2PM9A 3GCFA 1NUIA 2DE5A 1YIT1 1VQKZ 2W04A 2JMOA 2JIMA 2E2JI 5A2Qf 3CCR1 4Y7NI 4QTTA 4RVGA 1RNIA 2O53A 1VQ9Z 4NBEA 3CCS1 3CC2Z 1M901 4MH4A 4A3II 2JIQA 3PO3S 5C3EI 1WJ2A 3G4S1 4MXUA 3FKII 4HGYA 1QYPA 3NDJA 3CC21 2O4HA
chains in the Genus database with same CATH topology
2VF1A 3GTLI 3S1QI 1Y1WI 1N8R2 1NP6A 4A3JI 1Q821 2P3YA 3CC4Z 4NBGA 2Q51A 1X3ZA 1K8A2 3MZLB 1RLYA 3JAMb 3GTMS 1TWHI 3GKQA 2RPRA 3CCU1 1M1K2 1W2BY 1QVGZ 1Q811 5C4JI 3CC41 3I4NI 4A3DI 3F3PC 5D1OB 3QWUA 1VQMZ 2W03A 3IFUA 1Q7Y2 1Z01A 5IP7I 3I55Z 3CCEZ 1YJW1 3G6EZ 3NFZA 4NBAA 1S72Z 3I56Z 3G711 2M6NA 2QRCB 2YU9I 3JAMf 3CCLZ 4BBRI 4DQYB 1Q861 1YHQZ 4A3KI 1X3WA 2G2KA 2RT9A 3T4NB 3I551 3HOZI 3CCE1 1VQPZ 3G6E1 1ZB9A 3FQQA 1KQSZ 1S721 3Q87A 3I561 2JA8I 1VQ7Z 3CCL1 4A3EI 3I07A 3J7A4 1TWAI 4E2WA 3OW2Y 3EEDA 3NDIA 3CPWY 2QREB 1VQ5Z 3VTNA 2E9HA 4A3BI 2ZAEB 5FLXb 2R6MA 3GTOI 3NH5A 5IT9f 1QVFY 3H3VJ 2E2HI 1S7MA 1VQ51 1TWFI 2QKDA 3CCM1 5C4XI 4MD9A 4E31A 4QTUA 2E2II 3NH8A 1KD12 1VQO1 1K9M1 3CMAZ 4DGLA 1Z03A 1VQK1 3HOVI 1KC82 5FLXf 2AKLA 2K3RA 3CMEZ 1DL6A 2PK7A 1N8R1 3HOYI 3CCVZ 4TNUA 5LL6f 1W2BZ 3VMIA 1WW9A 5D1OA 1I6HI 2YADA 4RVFA 1M1K1 1VQ91 4E2YA 2QR1B 3U50C 3S2HI 2KI7B 2IZ4A 3BG0B 2GTIA 1KRLA 1TWCI 3IF8A 1USPB 1YJNZ 3H0GI 3NH4A 1Q7Y1 1ZH1A 4S1TA 4E33A 2RHBA 3S15I 2JA5I 1N2FA 1YJN1 3VB9A 2DE6A 2DE7A 2F4OA 1VQ6Z 2Q4ZA 2LFUA 2EGTA 3VMHA 2JR6A 3OW2Z 1L1OC 2NVYI 1VQ61 1VQM1 3J80b 5D1PA 3CPWZ 4NBHA 2OOXB 1NJI2 1WCMI 4NBDA 1WIIA 2V8JA 1JWHC 2RBLA 1X0TA 4HH4A 4MD7A 1QVFZ 5T6BA 5FLMI 3CXCY 4NBFA 2BJOA 1YHQ1 1RQFA 1Q812 2H85A 1RO4A 1VQ4Z 2I3CA 1VQP1 4E30A 3TDHB 3GTJI 2GTHA 1VQ71 5C44I 3J80f 5AN9F 4EWCA 2RIQA 1KD11 2LIYA 4AYBA 1I3QI 4E2ZA 4RVDA 3S14I 3GTKI 2J6AA 4A3CI 3HOXI 4A93I 3LUSA 2IZ3A 2V8IA 1JJ2Y 3S16I 1VQLZ 2OOYB 3IX0A 3MONA 1KC81 3TE5B 1Z02A 3CC7Z 3S1MI 1ML8A 3KIHA 4CL1A 2QLVB 2F4MA 4RVHA 2R92I 4NFRA 1USPA 3CC71 2HU9A 1YJ9Z 3CCRZ 3PO2I 2JA7I 3GTGI 5T67A 3CMA1 4NBBA 2QRDB 4X6AI 2QEXZ 1K732 4E2XA 3D6WA 2R7ZI 4MD8A 4RS4A 2KPIA 4A3LI 1RO0A 1QF8A 3CCSZ 3FQMA 1K8A1 2HF1A 4BY1I 1YJ91 1ZB8A 4NH1C 4NB9A 3G4SZ 3CME1 3S1RI 2QEX1 1P9NA 3CCV1 4NB8A 2OTJZ 2OZKA 1R9TI 1Y1VI 1VLAA 2NVXI 4NOZA 2JNYA 2NVQI 4Y52I 2B63I 2OTJ1 4MONA 1VQ8Z 2JA6I 4A3FI 1K83I 3CCUZ 1NJI1 2QA4Z 1M902 3CXCZ 2NVTI 3I4MI 2OTLZ 1VQ81 4MRIA 2QA41 1K9M2 3M4OI 3P5JB 3GTQI 1YUAA 3HKZA 3KIFA 4XX2A 1YJWZ 2OTL1 4HGZA 4RV9A 1Q822 3ESWA 3HOUI 3CCQZ 3G71Z 1RO2A 3M3YI 5CM2M 1JJ2Z 3F3FC 1TFIA 2GU2A 3S1NI 1VQNZ 3PO3I 3CCQ1 3BG1B 3CCJZ 2M48A 5IP9I 3VMGA 4BXXI 1TWGI 4BBSI 1QVGY 4BY7I 1YUKA 1VQN1 4A3MI 1LQLA 3J81b 3CD6Z 5IT9b 2JS4A 2PMZA 5T64A 2P28A 3K7AI 1SFOI 2VUMI 1YI2Z 2VUGA 1PFTA 1VQ41 4NBCA 3CCJ1 3RZOI 2R93I 2WB1A 4E32A 3GTMI 2WAQA 1Q862 2V8KA 3CD61 1Y1VS 1YIJZ 2K5RA 1YI21 4A3GI 3EERA 5A2Qb 3CCMZ 1K731 1VQL1 4DK1A 3S2DI 2JUBA 3HOWI 3GTPI 1YIJ1 3MZKB 3CQZI 1YITZ 3RZDI 3J81f 1VQOZ 2Y0SA 1KQSY 1I50I 3D9XA 3S17I 2PM9A 3GCFA 1NUIA 2DE5A 1YIT1 1VQKZ 2W04A 2JMOA 2E2JI 5A2Qf 3CCR1 4Y7NI 4QTTA 4RVGA 1RNIA 2O53A 1VQ9Z 4NBEA 3CCS1 3CC2Z 1M901 4MH4A 4A3II 3PO3S 5C3EI 3G4S1 4MXUA 3FKII 4HGYA 1QYPA 3NDJA 3CC21 2O4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCQ Z;  3G71 Z;  1JJ2 Z;  1VQK 1;  1N8R 2;  1JJ2 Y;  1Q82 1;  1VQL Z;  1KC8 2;  3CC4 Z;  1VQN Z;  3CME Z;  1K8A 2;  1N8R 1;  1KC8 1;  3CCQ 1;  3CCV Z;  1W2B Z;  3CCU 1;  1M1K 2;  1W2B Y;  3CCJ Z;  3CC7 Z;  1QVG Z;  1QVG Y;  1Q81 1;  3CC4 1;  1M1K 1;  1VQN 1;  1VQ9 1;  3CD6 Z;  1YI2 Z;  1VQM Z;  1VQ4 1;  3CCJ 1;  3CC7 1;  1Q7Y 2;  1YJ9 Z;  3CCR Z;  3I55 Z;  1YJN Z;  3CCE Z;  1YJW 1;  1Q86 2;  3CMA 1;  3CD6 1;  3G6E Z;  1YIJ Z;  1Q7Y 1;  2QEX Z;  1K73 2;  1YI2 1;  1S72 Z;  3I56 Z;  3G71 1;  3CCL Z;  1Q86 1;  1YHQ Z;  1K8A 1;  3CCS Z;  3CCM Z;  1K73 1;  1VQL 1;  1YJ9 1;  3I55 1;  1YJN 1;  1VQP Z;  3CCE 1;  3CME 1;  3G4S Z;  3G6E 1;  1YIJ 1;  1VQ6 Z;  1YIT Z;  2QEX 1;  1KQS Z;  1VQO Z;  1S72 1;  3CCV 1;  3I56 1;  1KQS Y;  2OTJ Z;  1VQ7 Z;  3CCL 1;  3OW2 Z;  3OW2 Y;  1VQK Z;  1YIT 1;  1VQ6 1;  1VQM 1;  3CPW Z;  2OTJ 1;  1NJI 2;  3CPW Y;  1VQ5 Z;  1VQ8 Z;  3CCR 1;  3CCU Z;  1NJI 1;  2QA4 Z;  1QVF Z;  1M90 2;  3CXC Z;  1QVF Y;  3CXC Y;  1VQ9 Z;  1VQ5 1;  1YHQ 1;  2OTL Z;  3CCS 1;  3CCM 1;  1VQ8 1;  3CC2 Z;  1Q81 2;  1KD1 1;  1M90 1;  1VQ4 Z;  1VQP 1;  3G4S 1;  2QA4 1;  1KD1 2;  1K9M 2;  1VQO 1;  1K9M 1;  1VQ7 1;  1YJW Z;  3CMA Z;  2OTL 1;  1Q82 2;  3CC2 1; 
#chains in the Genus database with same CATH topology
 2VF1 A;  3GTL I;  3S1Q I;  1Y1W I;  1N8R 2;  1NP6 A;  4A3J I;  1Q82 1;  2P3Y A;  3CC4 Z;  4NBG A;  2Q51 A;  1X3Z A;  1K8A 2;  3MZL B;  1RLY A;  3JAM b;  3GTM S;  1TWH I;  3GKQ A;  2RPR A;  1Q16 A;  3CCU 1;  1M1K 2;  1W2B Y;  1QVG Z;  1Q81 1;  5C4J I;  3CC4 1;  3I4N I;  4A3D I;  3F3P C;  5D1O B;  3QWU A;  1VQM Z;  2W03 A;  3IFU A;  1Q7Y 2;  1Z01 A;  5IP7 I;  3I55 Z;  3CCE Z;  1YJW 1;  3G6E Z;  1QXF A;  3NFZ A;  4NBA A;  1S72 Z;  3I56 Z;  3G71 1;  2M6N A;  2QRC B;  2YU9 I;  3JAM f;  3CCL Z;  4BBR I;  4DQY B;  1Q86 1;  1YHQ Z;  4A3K I;  1X3W A;  2G2K A;  2RT9 A;  3T4N B;  3I55 1;  3HOZ I;  3CCE 1;  1VQP Z;  3G6E 1;  1ZB9 A;  3FQQ A;  1KQS Z;  1S72 1;  3Q87 A;  3I56 1;  2JA8 I;  1VQ7 Z;  3CCL 1;  4A3E I;  3I07 A;  3J7A 4;  1TWA I;  4E2W A;  3OW2 Y;  3EED A;  3NDI A;  3CPW Y;  2QRE B;  1VQ5 Z;  3VTN A;  2E9H A;  4A3B I;  2ZAE B;  5FLX b;  2R6M A;  3GTO I;  3NH5 A;  5IT9 f;  1QVF Y;  2JIR A;  3H3V J;  2E2H I;  1S7M A;  1VQ5 1;  1TWF I;  2QKD A;  3CCM 1;  5C4X I;  4MD9 A;  4E31 A;  4QTU A;  2E2I I;  3NH8 A;  1KD1 2;  1VQO 1;  1K9M 1;  3CMA Z;  4DGL A;  1Z03 A;  1VQK 1;  3HOV I;  1KC8 2;  1FDI A;  5FLX f;  2AKL A;  2K3R A;  3CME Z;  1DL6 A;  2PK7 A;  1N8R 1;  3HOY I;  3CCV Z;  4TNU A;  5LL6 f;  1W2B Z;  3VMI A;  1WW9 A;  5D1O A;  1I6H I;  2YAD A;  4RVF A;  1M1K 1;  1VQ9 1;  4E2Y A;  1Y8C A;  2QR1 B;  3U50 C;  2LEX A;  3S2H I;  2KI7 B;  2IZ4 A;  3BG0 B;  2GTI A;  1KRL A;  1TWC I;  3IF8 A;  1USP B;  1YJN Z;  3H0G I;  3NH4 A;  1Q7Y 1;  1ZH1 A;  4S1T A;  4E33 A;  2RHB A;  3S15 I;  2JA5 I;  2NAP A;  1N2F A;  1YJN 1;  3VB9 A;  2DE6 A;  2DE7 A;  2F4O A;  1VQ6 Z;  2Q4Z A;  2LFU A;  2EGT A;  3VMH A;  2JR6 A;  3OW2 Z;  1L1O C;  2NVY I;  1VQ6 1;  1VQM 1;  3J80 b;  5D1P A;  3CPW Z;  4NBH A;  2OOX B;  1NJI 2;  1WCM I;  4NBD A;  1WII A;  2V8J A;  1JWH C;  2RBL A;  1X0T A;  4HH4 A;  4MD7 A;  1QVF Z;  5T6B A;  5FLM I;  3CXC Y;  4NBF A;  2BJO A;  1YHQ 1;  1RQF A;  1Q81 2;  2H85 A;  1RO4 A;  1VQ4 Z;  2I3C A;  1VQP 1;  4E30 A;  3TDH B;  3GTJ I;  2AYD A;  2GTH A;  1VQ7 1;  5C44 I;  3J80 f;  5AN9 F;  4EWC A;  2RIQ A;  1KD1 1;  2LIY A;  4AYB A;  1I3Q I;  4E2Z A;  4RVD A;  3S14 I;  3GTK I;  2J6A A;  4A3C I;  3HOX I;  4A93 I;  1FDO A;  3LUS A;  2IZ3 A;  2V8I A;  1JJ2 Y;  3S16 I;  1VQL Z;  2OOY B;  2IV2 X;  3IX0 A;  2V3V A;  3MON A;  1KC8 1;  3TE5 B;  1Z02 A;  3CC7 Z;  3S1M I;  3IR7 A;  1ML8 A;  3KIH A;  4CL1 A;  2QLV B;  2F4M A;  4RVH A;  2R92 I;  4NFR A;  1USP A;  3CC7 1;  2HU9 A;  1YJ9 Z;  3CCR Z;  3PO2 I;  2JA7 I;  3GTG I;  5T67 A;  3CMA 1;  2VPY A;  4NBB A;  2QRD B;  4X6A I;  2QEX Z;  1K73 2;  4E2X A;  3D6W A;  2R7Z I;  4MD8 A;  4RS4 A;  2KPI A;  4A3L I;  1RO0 A;  1QF8 A;  3CCS Z;  3FQM A;  1K8A 1;  2HF1 A;  4BY1 I;  1YJ9 1;  1ZB8 A;  4NH1 C;  4NB9 A;  3G4S Z;  3CME 1;  3S1R I;  2QEX 1;  1P9N A;  3CCV 1;  2JIO A;  4NB8 A;  2OTJ Z;  2OZK A;  1R9T I;  1Y1V I;  1VLA A;  2NVX I;  4NOZ A;  2JNY A;  2VPW A;  3D2L A;  2NVQ I;  4Y52 I;  2B63 I;  2OTJ 1;  2JIP A;  4MON A;  2VPX A;  1VQ8 Z;  2JA6 I;  4A3F I;  1K83 I;  3CCU Z;  1NJI 1;  2QA4 Z;  1M90 2;  3CXC Z;  2NVT I;  3I4M I;  2OTL Z;  1VQ8 1;  4MRI A;  2QA4 1;  1K9M 2;  3M4O I;  3P5J B;  3GTQ I;  1YUA A;  3HKZ A;  3KIF A;  4XX2 A;  1YJW Z;  2OTL 1;  4HGZ A;  4RV9 A;  1Q82 2;  3ESW A;  3HOU I;  3CCQ Z;  3G71 Z;  1RO2 A;  3M3Y I;  5CM2 M;  1JJ2 Z;  3F3F C;  1TFI A;  2GU2 A;  3S1N I;  1VQN Z;  3PO3 I;  2E7Z A;  3CCQ 1;  3BG1 B;  3CCJ Z;  2M48 A;  5IP9 I;  3VMG A;  4BXX I;  1TWG I;  4BBS I;  1QVG Y;  4BY7 I;  1YUK A;  1VQN 1;  4A3M I;  1LQL A;  3J81 b;  3CD6 Z;  5IT9 b;  2JS4 A;  2PMZ A;  5T64 A;  2P28 A;  3K7A I;  1SFO I;  2VUM I;  2VPZ A;  1YI2 Z;  2VUG A;  1PFT A;  2V45 A;  1VQ4 1;  4NBC A;  3CCJ 1;  3RZO I;  2R93 I;  2WB1 A;  4E32 A;  3GTM I;  2WAQ A;  1Q86 2;  2V8K A;  3CD6 1;  1Y1V S;  1YIJ Z;  2K5R A;  1YI2 1;  4A3G I;  3EER A;  5A2Q b;  3CCM Z;  1K73 1;  1VQL 1;  4DK1 A;  3S2D I;  2JUB A;  3HOW I;  3GTP I;  1AA6 A;  1YIJ 1;  3MZK B;  3CQZ I;  1YIT Z;  3RZD I;  3J81 f;  1VQO Z;  2Y0S A;  1KQS Y;  1I50 I;  1WZN A;  1SIW A;  3D9X A;  3S17 I;  2PM9 A;  3GCF A;  1NUI A;  2DE5 A;  1YIT 1;  1VQK Z;  2W04 A;  2JMO A;  2JIM A;  2E2J I;  5A2Q f;  3CCR 1;  4Y7N I;  4QTT A;  4RVG A;  1RNI A;  2O53 A;  1VQ9 Z;  4NBE A;  3CCS 1;  3CC2 Z;  1M90 1;  4MH4 A;  4A3I I;  2JIQ A;  3PO3 S;  5C3E I;  1WJ2 A;  3G4S 1;  4MXU A;  3FKI I;  4HGY A;  1QYP A;  3NDJ A;  3CC2 1;  2O4H A; 
#chains in the Genus database with same CATH homology
 2VF1 A;  3GTL I;  3S1Q I;  1Y1W I;  1N8R 2;  1NP6 A;  4A3J I;  1Q82 1;  2P3Y A;  3CC4 Z;  4NBG A;  2Q51 A;  1X3Z A;  1K8A 2;  3MZL B;  1RLY A;  3JAM b;  3GTM S;  1TWH I;  3GKQ A;  2RPR A;  3CCU 1;  1M1K 2;  1W2B Y;  1QVG Z;  1Q81 1;  5C4J I;  3CC4 1;  3I4N I;  4A3D I;  3F3P C;  5D1O B;  3QWU A;  1VQM Z;  2W03 A;  3IFU A;  1Q7Y 2;  1Z01 A;  5IP7 I;  3I55 Z;  3CCE Z;  1YJW 1;  3G6E Z;  3NFZ A;  4NBA A;  1S72 Z;  3I56 Z;  3G71 1;  2M6N A;  2QRC B;  2YU9 I;  3JAM f;  3CCL Z;  4BBR I;  4DQY B;  1Q86 1;  1YHQ Z;  4A3K I;  1X3W A;  2G2K A;  2RT9 A;  3T4N B;  3I55 1;  3HOZ I;  3CCE 1;  1VQP Z;  3G6E 1;  1ZB9 A;  3FQQ A;  1KQS Z;  1S72 1;  3Q87 A;  3I56 1;  2JA8 I;  1VQ7 Z;  3CCL 1;  4A3E I;  3I07 A;  3J7A 4;  1TWA I;  4E2W A;  3OW2 Y;  3EED A;  3NDI A;  3CPW Y;  2QRE B;  1VQ5 Z;  3VTN A;  2E9H A;  4A3B I;  2ZAE B;  5FLX b;  2R6M A;  3GTO I;  3NH5 A;  5IT9 f;  1QVF Y;  3H3V J;  2E2H I;  1S7M A;  1VQ5 1;  1TWF I;  2QKD A;  3CCM 1;  5C4X I;  4MD9 A;  4E31 A;  4QTU A;  2E2I I;  3NH8 A;  1KD1 2;  1VQO 1;  1K9M 1;  3CMA Z;  4DGL A;  1Z03 A;  1VQK 1;  3HOV I;  1KC8 2;  5FLX f;  2AKL A;  2K3R A;  3CME Z;  1DL6 A;  2PK7 A;  1N8R 1;  3HOY I;  3CCV Z;  4TNU A;  5LL6 f;  1W2B Z;  3VMI A;  1WW9 A;  5D1O A;  1I6H I;  2YAD A;  4RVF A;  1M1K 1;  1VQ9 1;  4E2Y A;  2QR1 B;  3U50 C;  3S2H I;  2KI7 B;  2IZ4 A;  3BG0 B;  2GTI A;  1KRL A;  1TWC I;  3IF8 A;  1USP B;  1YJN Z;  3H0G I;  3NH4 A;  1Q7Y 1;  1ZH1 A;  4S1T A;  4E33 A;  2RHB A;  3S15 I;  2JA5 I;  1N2F A;  1YJN 1;  3VB9 A;  2DE6 A;  2DE7 A;  2F4O A;  1VQ6 Z;  2Q4Z A;  2LFU A;  2EGT A;  3VMH A;  2JR6 A;  3OW2 Z;  1L1O C;  2NVY I;  1VQ6 1;  1VQM 1;  3J80 b;  5D1P A;  3CPW Z;  4NBH A;  2OOX B;  1NJI 2;  1WCM I;  4NBD A;  1WII A;  2V8J A;  1JWH C;  2RBL A;  1X0T A;  4HH4 A;  4MD7 A;  1QVF Z;  5T6B A;  5FLM I;  3CXC Y;  4NBF A;  2BJO A;  1YHQ 1;  1RQF A;  1Q81 2;  2H85 A;  1RO4 A;  1VQ4 Z;  2I3C A;  1VQP 1;  4E30 A;  3TDH B;  3GTJ I;  2GTH A;  1VQ7 1;  5C44 I;  3J80 f;  5AN9 F;  4EWC A;  2RIQ A;  1KD1 1;  2LIY A;  4AYB A;  1I3Q I;  4E2Z A;  4RVD A;  3S14 I;  3GTK I;  2J6A A;  4A3C I;  3HOX I;  4A93 I;  3LUS A;  2IZ3 A;  2V8I A;  1JJ2 Y;  3S16 I;  1VQL Z;  2OOY B;  3IX0 A;  3MON A;  1KC8 1;  3TE5 B;  1Z02 A;  3CC7 Z;  3S1M I;  1ML8 A;  3KIH A;  4CL1 A;  2QLV B;  2F4M A;  4RVH A;  2R92 I;  4NFR A;  1USP A;  3CC7 1;  2HU9 A;  1YJ9 Z;  3CCR Z;  3PO2 I;  2JA7 I;  3GTG I;  5T67 A;  3CMA 1;  4NBB A;  2QRD B;  4X6A I;  2QEX Z;  1K73 2;  4E2X A;  3D6W A;  2R7Z I;  4MD8 A;  4RS4 A;  2KPI A;  4A3L I;  1RO0 A;  1QF8 A;  3CCS Z;  3FQM A;  1K8A 1;  2HF1 A;  4BY1 I;  1YJ9 1;  1ZB8 A;  4NH1 C;  4NB9 A;  3G4S Z;  3CME 1;  3S1R I;  2QEX 1;  1P9N A;  3CCV 1;  4NB8 A;  2OTJ Z;  2OZK A;  1R9T I;  1Y1V I;  1VLA A;  2NVX I;  4NOZ A;  2JNY A;  2NVQ I;  4Y52 I;  2B63 I;  2OTJ 1;  4MON A;  1VQ8 Z;  2JA6 I;  4A3F I;  1K83 I;  3CCU Z;  1NJI 1;  2QA4 Z;  1M90 2;  3CXC Z;  2NVT I;  3I4M I;  2OTL Z;  1VQ8 1;  4MRI A;  2QA4 1;  1K9M 2;  3M4O I;  3P5J B;  3GTQ I;  1YUA A;  3HKZ A;  3KIF A;  4XX2 A;  1YJW Z;  2OTL 1;  4HGZ A;  4RV9 A;  1Q82 2;  3ESW A;  3HOU I;  3CCQ Z;  3G71 Z;  1RO2 A;  3M3Y I;  5CM2 M;  1JJ2 Z;  3F3F C;  1TFI A;  2GU2 A;  3S1N I;  1VQN Z;  3PO3 I;  3CCQ 1;  3BG1 B;  3CCJ Z;  2M48 A;  5IP9 I;  3VMG A;  4BXX I;  1TWG I;  4BBS I;  1QVG Y;  4BY7 I;  1YUK A;  1VQN 1;  4A3M I;  1LQL A;  3J81 b;  3CD6 Z;  5IT9 b;  2JS4 A;  2PMZ A;  5T64 A;  2P28 A;  3K7A I;  1SFO I;  2VUM I;  1YI2 Z;  2VUG A;  1PFT A;  1VQ4 1;  4NBC A;  3CCJ 1;  3RZO I;  2R93 I;  2WB1 A;  4E32 A;  3GTM I;  2WAQ A;  1Q86 2;  2V8K A;  3CD6 1;  1Y1V S;  1YIJ Z;  2K5R A;  1YI2 1;  4A3G I;  3EER A;  5A2Q b;  3CCM Z;  1K73 1;  1VQL 1;  4DK1 A;  3S2D I;  2JUB A;  3HOW I;  3GTP I;  1YIJ 1;  3MZK B;  3CQZ I;  1YIT Z;  3RZD I;  3J81 f;  1VQO Z;  2Y0S A;  1KQS Y;  1I50 I;  3D9X A;  3S17 I;  2PM9 A;  3GCF A;  1NUI A;  2DE5 A;  1YIT 1;  1VQK Z;  2W04 A;  2JMO A;  2E2J I;  5A2Q f;  3CCR 1;  4Y7N I;  4QTT A;  4RVG A;  1RNI A;  2O53 A;  1VQ9 Z;  4NBE A;  3CCS 1;  3CC2 Z;  1M90 1;  4MH4 A;  4A3I I;  3PO3 S;  5C3E I;  3G4S 1;  4MXU A;  3FKI I;  4HGY A;  1QYP A;  3NDJ A;  3CC2 1;  2O4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...