1VQ7Z

The structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 17
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vq7Z00
1YJNZ 1VQ7Z 3CC71 1YHQZ 1YJ9Z 1JJ2Z 1VQNZ 1N8R2 1YJW1 1Q7Y2 1VQ61 2QEXZ 3CCQ1 1VQ5Z 3CPWY 3CCUZ 3CCEZ 3CCR1 1YJ91 3CCSZ 3G6EZ 1VQK1 1NJI1 2OTJ1 1YJWZ 3CMA1 3CCQZ 1N8R1 3CME1 3I551 1YJN1 3CC7Z 1Q821 3CCRZ 3CCS1 1Q861 3G6E1 1Q862 1VQKZ 1YIJZ 3CCJ1 1K731 1VQ81 3CCU1 1M901 1JJ2Y 1M902 1M1K1 3CCVZ 3CCJZ 1YIJ1 1KQSY 3G71Z 3I55Z 3CMEZ 3OW2Y 1Q7Y1 3I561 1YI21 3CD6Z 3CMAZ 1KC82 1VQ8Z 1VQ91 3I56Z 1YI2Z 3CCL1 3CD61 1QVGY 1K8A1 3CCV1 1KD11 1VQP1 1VQ9Z 3CCMZ 3G711 3CCLZ 1W2BZ 1VQM1 1QVGZ 1KC81 1VQ4Z 1S72Z 1K9M1 3CCM1 1VQO1 1VQMZ 1QVFY 1VQLZ 3CXCZ 1NJI2 1S721 3OW2Z 1VQPZ 3CXCY 1QVFZ 3CPWZ 1VQ41 3CC4Z 1K8A2 3CC2Z 1Q812 1Q811 1VQOZ 1M1K2 1VQL1 2QA4Z 2OTLZ 1VQ71 3CC21 1K732 1KD12 3G4SZ 1VQ6Z 2OTL1 1YIT1 2QEX1 1VQ51 3CC41 3CCE1 1K9M2 1YHQ1 2OTJZ 3G4S1 1Q822 1W2BY 2QA41 1YITZ 1VQN1 1KQSZ
chains in the Genus database with same CATH superfamily
1YJNZ 3CC71 4A3LI 4NOZA 1JJ2Z 1TFIA 4NB8A 1WJ2A 1YUKA 5FLMI 1N8R2 3CCQ1 5T67A 2E9HA 1ZH1A 2YU9I 3I4MI 2VUMI 2V8KA 4Y52I 5D1OB 3HOYI 3G6EZ 2OTJ1 2V3VA 1YJWZ 1SIWA 3CMA1 3KIFA 1N8R1 3I551 2VPXA 1I50I 3CC7Z 1L1OC 2O53A 1ZB9A 1YIJZ 3I07A 1DL6A 4MRIA 3CCVZ 1KQSY 4NBFA 4A3MI 3I55Z 1TWCI 3OW2Y 3I561 2VUGA 4NH1C 1YI21 2JA6I 2M48A 3NDJA 2OOXB 2GTIA 1VQ91 2QLVB 1R9TI 3CCL1 2VPYA 4A3BI 5C4XI 3M4OI 1K8A1 3CCV1 5FLXb 4A3EI 2VPWA 3QWUA 2E2JI 3VMGA 4A3II 3S2HI 1W2BZ 1QXFA 1VQM1 3IF8A 4BY7I 4E31A 1K9M1 3GTGI 3CCM1 1QF8A 1VQO1 3F3PC 2R6MA 2E7ZA 1VQLZ 3CXCZ 2J6AA 4MD8A 4HGYA 3Q87A 3D6WA 3CXCY 2QREB 4CL1A 5IP7I 5T6BA 1Z01A 3CPWZ 3CC4Z 1K8A2 2P3YA 4NFRA 5A2Qf 1M1K2 2AKLA 2QA4Z 1VQL1 1VQ71 4E2YA 4NBEA 2NVYI 1KD12 1VQ6Z 2OTL1 1VQ51 4RVFA 3CC41 4RV9A 1X3ZA 3H3VJ 1Q16A 1Q822 2QA41 2F4MA 2K3RA 2PMZA 2NVTI 1KQSZ 1S7MA 2W03A 3S14I 1Y1VI 3EERA 1YHQZ 1WCMI 1X0TA 1LQLA 3NFZA 4NBCA 2W04A 3GTMS 4X6AI 1VQ5Z 1P9NA 3S1MI 5IP9I 2IV2X 2JR6A 2JA8I 2V8JA 4S1TA 3RZDI 2WAQA 4HH4A 2JIOA 1AA6A 1Q821 2RPRA 3CCRZ 3RZOI 2KPIA 1Q862 1VQKZ 3CCJ1 1USPA 2JIRA 4A3KI 1JJ2Y 1M902 3IFUA 3KIHA 3HOVI 2RIQA 2RBLA 3G71Z 3CMEZ 4NBHA 1RO4A 3CD6Z 2PK7A 2R7ZI 3M3YI 3IX0A 1KC82 2G2KA 3I56Z 4RVHA 1YI2Z 4BY1I 2LFUA 4QTTA 1VQP1 3CCMZ 2PM9A 1RO2A 4A3JI 3LUSA 1SFOI 3GTPI 2LIYA 1I6HI 5C4JI 5D1OA 1VQMZ 1QVFY 2R93I 1S721 2B63I 4A93I 3OW2Z 2JIMA 1VQPZ 2I3CA 2QRCB 3S16I 1QVFZ 2LEXA 3S1RI 4AYBA 1FDOA 2Q4ZA 1Z02A 2HF1A 4MXUA 3CC2Z 2AYDA 2JS4A 3MZKB 2Y0SA 2OTLZ 1TWFI 4DQYB 5C44I 2QRDB 3G4SZ 1Y1VS 3FKII 1YIT1 3J80f 2HU9A 2DE5A 3FQQA 1K9M2 1ZB8A 3TDHB 1YHQ1 3NH8A 3H0GI 2JNYA 1WW9A 4DGLA 2P28A 3F3FC 1Y8CA 2RHBA 3PO2I 2YADA 2F4OA 2QEXZ 3D9XA 3CCR1 1YJ91 3CCSZ 1VQK1 4TNUA 3T4NB 1YJN1 5FLXf 4A3FI 4XX2A 2JMOA 3HOWI 1Q861 2JA7I 3J81f 2NVQI 2JIQA 1K83I 1K731 3VMIA 1YUAA 1QYPA 2GU2A 3S1NI 1M901 3NH4A 4BXXI 4A3CI 1RQFA 3CCJZ 5AN9F 3I4NI 2RT9A 3S1QI 4MONA 1NUIA 1ML8A 4E32A 4MD7A 3PO3S 2DE7A 1WIIA 3GKQA 3U50C 3GTMI 3CD61 1QVGY 1TWHI 4E2WA 3GTQI 4A3GI 2DE6A 3VB9A 2QR1B 1N2FA 1KC81 5D1PA 1S72Z 3HOZI 4RVGA 4Y7NI 3J81b 2H85A 2E2II 1NJI2 2IZ4A 3TE5B 2OZKA 3GTOI 1X3WA 2K5RA 3GTKI 3NDIA 4EWCA 4A3DI 3CQZI 5T64A 1Q811 1VQOZ 3MZLB 3CC21 5CM2M 1K732 3HKZA 3BG0B 4E2XA 5C3EI 4MD9A 2WB1A 2GTHA 3CCE1 3S17I 3G4S1 4NBGA 2JA5I 5A2Qb 1W2BY 4DK1A 1YITZ 1VQ7Z 3BG1B 3K7AI 1YJ9Z 1VQNZ 1YJW1 1Q7Y2 4MH4A 1VQ61 3CPWY 3PO3I 5LL6f 3CCUZ 3P5JB 3CCEZ 1NJI1 2M6NA 3MONA 1VLAA 4RVDA 2VF1A 3CCQZ 3CME1 1TWAI 4NBAA 2VPZA 3JAMb 1NP6A 3CCS1 3G6E1 3J7A4 1VQ81 3CCU1 3GTJI 1FDIA 4E30A 4QTUA 5IT9b 1M1K1 1YIJ1 3FQMA 2V8IA 1TWGI 4HGZA 1Q7Y1 3S2DI 2OOYB 1VQ8Z 2Q51A 4NBBA 2BJOA 1RO0A 1KD11 1PFTA 1VQ9Z 3G711 4E2ZA 3CCLZ 1QVGZ 4NB9A 4BBSI 3VTNA 1VQ4Z 3NH5A 3GCFA 3ESWA 3IR7A 2O4HA 1JWHC 3JAMf 3D2LA 1WZNA 3GTLI 2NVXI 2NAPA 4BBRI 2EGTA 1VQ41 2ZAEB 2IZ3A 2QKDA 3HOXI 2JIPA 1KRLA 3EEDA 4NBDA 1Q812 1RNIA 2KI7B 2V45A 1I3QI 1USPB 4RS4A 2QEX1 2E2HI 1Y1WI 2JUBA 4E33A 1RLYA 3VMHA 3HOUI 3S15I 2R92I 2OTJZ 3CMAZ 3J80b 1VQN1 5IT9f 1Z03A
chains in the Genus database with same CATH topology
1YJNZ 3CC71 4A3LI 4NOZA 1JJ2Z 1TFIA 4NB8A 1YUKA 5FLMI 1N8R2 3CCQ1 5T67A 2E9HA 1ZH1A 2YU9I 3I4MI 2VUMI 2V8KA 4Y52I 5D1OB 3HOYI 3G6EZ 2OTJ1 1YJWZ 3CMA1 3KIFA 1N8R1 3I551 1I50I 3CC7Z 1L1OC 2O53A 1ZB9A 1YIJZ 3I07A 1DL6A 4MRIA 3CCVZ 1KQSY 4NBFA 4A3MI 3I55Z 1TWCI 3OW2Y 3I561 2VUGA 4NH1C 1YI21 2JA6I 2M48A 3NDJA 2OOXB 2GTIA 1VQ91 2QLVB 1R9TI 3CCL1 4A3BI 5C4XI 3M4OI 1K8A1 3CCV1 5FLXb 4A3EI 3QWUA 2E2JI 3VMGA 4A3II 3S2HI 1W2BZ 1VQM1 3IF8A 4BY7I 4E31A 1K9M1 3GTGI 3CCM1 1QF8A 1VQO1 3F3PC 2R6MA 1VQLZ 3CXCZ 2J6AA 4MD8A 4HGYA 3Q87A 3D6WA 3CXCY 2QREB 4CL1A 5IP7I 5T6BA 1Z01A 3CPWZ 3CC4Z 1K8A2 2P3YA 4NFRA 5A2Qf 1M1K2 2AKLA 2QA4Z 1VQL1 1VQ71 4E2YA 4NBEA 2NVYI 1KD12 1VQ6Z 2OTL1 1VQ51 4RVFA 3CC41 4RV9A 1X3ZA 3H3VJ 1Q822 2QA41 2F4MA 2K3RA 2PMZA 2NVTI 1KQSZ 1S7MA 2W03A 3S14I 1Y1VI 3EERA 1YHQZ 1WCMI 1X0TA 1LQLA 3NFZA 4NBCA 2W04A 3GTMS 4X6AI 1VQ5Z 1P9NA 3S1MI 5IP9I 2JR6A 2JA8I 2V8JA 4S1TA 3RZDI 2WAQA 4HH4A 1Q821 2RPRA 3CCRZ 3RZOI 2KPIA 1Q862 1VQKZ 3CCJ1 1USPA 4A3KI 1JJ2Y 1M902 3IFUA 3KIHA 3HOVI 2RIQA 2RBLA 3G71Z 3CMEZ 4NBHA 1RO4A 3CD6Z 2PK7A 2R7ZI 3M3YI 3IX0A 1KC82 2G2KA 3I56Z 4RVHA 1YI2Z 4BY1I 2LFUA 4QTTA 1VQP1 3CCMZ 2PM9A 1RO2A 4A3JI 3LUSA 1SFOI 3GTPI 2LIYA 1I6HI 5C4JI 5D1OA 1VQMZ 1QVFY 2R93I 1S721 2B63I 4A93I 3OW2Z 1VQPZ 2I3CA 2QRCB 3S16I 1QVFZ 3S1RI 4AYBA 2Q4ZA 1Z02A 2HF1A 4MXUA 3CC2Z 2JS4A 3MZKB 2Y0SA 2OTLZ 1TWFI 4DQYB 5C44I 2QRDB 3G4SZ 1Y1VS 3FKII 1YIT1 3J80f 2HU9A 2DE5A 3FQQA 1K9M2 1ZB8A 3TDHB 1YHQ1 3NH8A 3H0GI 2JNYA 1WW9A 4DGLA 2P28A 3F3FC 2RHBA 3PO2I 2YADA 2F4OA 2QEXZ 3D9XA 3CCR1 1YJ91 3CCSZ 1VQK1 4TNUA 3T4NB 1YJN1 5FLXf 4A3FI 4XX2A 2JMOA 3HOWI 1Q861 2JA7I 3J81f 2NVQI 1K83I 1K731 3VMIA 1YUAA 1QYPA 2GU2A 3S1NI 1M901 3NH4A 4BXXI 4A3CI 1RQFA 3CCJZ 5AN9F 3I4NI 2RT9A 3S1QI 4MONA 1NUIA 1ML8A 4E32A 4MD7A 3PO3S 2DE7A 1WIIA 3GKQA 3U50C 3GTMI 3CD61 1QVGY 1TWHI 4E2WA 3GTQI 4A3GI 2DE6A 3VB9A 2QR1B 1N2FA 1KC81 5D1PA 1S72Z 3HOZI 4RVGA 4Y7NI 3J81b 2H85A 2E2II 1NJI2 2IZ4A 3TE5B 2OZKA 3GTOI 1X3WA 2K5RA 3GTKI 3NDIA 4EWCA 4A3DI 3CQZI 5T64A 1Q811 1VQOZ 3MZLB 3CC21 5CM2M 1K732 3HKZA 3BG0B 4E2XA 5C3EI 4MD9A 2WB1A 2GTHA 3CCE1 3S17I 3G4S1 4NBGA 2JA5I 5A2Qb 1W2BY 4DK1A 1YITZ 1VQ7Z 3BG1B 3K7AI 1YJ9Z 1VQNZ 1YJW1 1Q7Y2 4MH4A 1VQ61 3CPWY 3PO3I 5LL6f 3CCUZ 3P5JB 3CCEZ 1NJI1 2M6NA 3MONA 1VLAA 4RVDA 2VF1A 3CCQZ 3CME1 1TWAI 4NBAA 3JAMb 1NP6A 3CCS1 3G6E1 3J7A4 1VQ81 3CCU1 3GTJI 4E30A 4QTUA 5IT9b 1M1K1 1YIJ1 3FQMA 2V8IA 1TWGI 4HGZA 1Q7Y1 3S2DI 2OOYB 1VQ8Z 2Q51A 4NBBA 2BJOA 1RO0A 1KD11 1PFTA 1VQ9Z 3G711 4E2ZA 3CCLZ 1QVGZ 4NB9A 4BBSI 3VTNA 1VQ4Z 3NH5A 3GCFA 3ESWA 2O4HA 1JWHC 3JAMf 3GTLI 2NVXI 4BBRI 2EGTA 1VQ41 2ZAEB 2IZ3A 2QKDA 3HOXI 1KRLA 3EEDA 4NBDA 1Q812 1RNIA 2KI7B 1I3QI 1USPB 4RS4A 2QEX1 2E2HI 1Y1WI 2JUBA 4E33A 1RLYA 3VMHA 3HOUI 3S15I 2R92I 2OTJZ 3CMAZ 3J80b 1VQN1 5IT9f 1Z03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJN Z;  1VQ7 Z;  3CC7 1;  1YHQ Z;  1YJ9 Z;  1JJ2 Z;  1VQN Z;  1N8R 2;  1YJW 1;  1Q7Y 2;  1VQ6 1;  2QEX Z;  3CCQ 1;  1VQ5 Z;  3CPW Y;  3CCU Z;  3CCE Z;  3CCR 1;  1YJ9 1;  3CCS Z;  3G6E Z;  1VQK 1;  1NJI 1;  2OTJ 1;  1YJW Z;  3CMA 1;  3CCQ Z;  1N8R 1;  3CME 1;  3I55 1;  1YJN 1;  3CC7 Z;  1Q82 1;  3CCR Z;  3CCS 1;  1Q86 1;  3G6E 1;  1Q86 2;  1VQK Z;  1YIJ Z;  3CCJ 1;  1K73 1;  1VQ8 1;  3CCU 1;  1M90 1;  1JJ2 Y;  1M90 2;  1M1K 1;  3CCV Z;  3CCJ Z;  1YIJ 1;  1KQS Y;  3G71 Z;  3I55 Z;  3CME Z;  3OW2 Y;  1Q7Y 1;  3I56 1;  1YI2 1;  3CD6 Z;  3CMA Z;  1KC8 2;  1VQ8 Z;  1VQ9 1;  3I56 Z;  1YI2 Z;  3CCL 1;  3CD6 1;  1QVG Y;  1K8A 1;  3CCV 1;  1KD1 1;  1VQP 1;  1VQ9 Z;  3CCM Z;  3G71 1;  3CCL Z;  1W2B Z;  1VQM 1;  1QVG Z;  1KC8 1;  1VQ4 Z;  1S72 Z;  1K9M 1;  3CCM 1;  1VQO 1;  1VQM Z;  1QVF Y;  1VQL Z;  3CXC Z;  1NJI 2;  1S72 1;  3OW2 Z;  1VQP Z;  3CXC Y;  1QVF Z;  3CPW Z;  1VQ4 1;  3CC4 Z;  1K8A 2;  3CC2 Z;  1Q81 2;  1Q81 1;  1VQO Z;  1M1K 2;  1VQL 1;  2QA4 Z;  2OTL Z;  1VQ7 1;  3CC2 1;  1K73 2;  1KD1 2;  3G4S Z;  1VQ6 Z;  2OTL 1;  1YIT 1;  2QEX 1;  1VQ5 1;  3CC4 1;  3CCE 1;  1K9M 2;  1YHQ 1;  2OTJ Z;  3G4S 1;  1Q82 2;  1W2B Y;  2QA4 1;  1YIT Z;  1VQN 1;  1KQS Z; 
#chains in the Genus database with same CATH topology
 1YJN Z;  3CC7 1;  4A3L I;  4NOZ A;  1JJ2 Z;  1TFI A;  4NB8 A;  1WJ2 A;  1YUK A;  5FLM I;  1N8R 2;  3CCQ 1;  5T67 A;  2E9H A;  1ZH1 A;  2YU9 I;  3I4M I;  2VUM I;  2V8K A;  4Y52 I;  5D1O B;  3HOY I;  3G6E Z;  2OTJ 1;  2V3V A;  1YJW Z;  1SIW A;  3CMA 1;  3KIF A;  1N8R 1;  3I55 1;  2VPX A;  1I50 I;  3CC7 Z;  1L1O C;  2O53 A;  1ZB9 A;  1YIJ Z;  3I07 A;  1DL6 A;  4MRI A;  3CCV Z;  1KQS Y;  4NBF A;  4A3M I;  3I55 Z;  1TWC I;  3OW2 Y;  3I56 1;  2VUG A;  4NH1 C;  1YI2 1;  2JA6 I;  2M48 A;  3NDJ A;  2OOX B;  2GTI A;  1VQ9 1;  2QLV B;  1R9T I;  3CCL 1;  2VPY A;  4A3B I;  5C4X I;  3M4O I;  1K8A 1;  3CCV 1;  5FLX b;  4A3E I;  2VPW A;  3QWU A;  2E2J I;  3VMG A;  4A3I I;  3S2H I;  1W2B Z;  1QXF A;  1VQM 1;  3IF8 A;  4BY7 I;  4E31 A;  1K9M 1;  3GTG I;  3CCM 1;  1QF8 A;  1VQO 1;  3F3P C;  2R6M A;  2E7Z A;  1VQL Z;  3CXC Z;  2J6A A;  4MD8 A;  4HGY A;  3Q87 A;  3D6W A;  3CXC Y;  2QRE B;  4CL1 A;  5IP7 I;  5T6B A;  1Z01 A;  3CPW Z;  3CC4 Z;  1K8A 2;  2P3Y A;  4NFR A;  5A2Q f;  1M1K 2;  2AKL A;  2QA4 Z;  1VQL 1;  1VQ7 1;  4E2Y A;  4NBE A;  2NVY I;  1KD1 2;  1VQ6 Z;  2OTL 1;  1VQ5 1;  4RVF A;  3CC4 1;  4RV9 A;  1X3Z A;  3H3V J;  1Q16 A;  1Q82 2;  2QA4 1;  2F4M A;  2K3R A;  2PMZ A;  2NVT I;  1KQS Z;  1S7M A;  2W03 A;  3S14 I;  1Y1V I;  3EER A;  1YHQ Z;  1WCM I;  1X0T A;  1LQL A;  3NFZ A;  4NBC A;  2W04 A;  3GTM S;  4X6A I;  1VQ5 Z;  1P9N A;  3S1M I;  5IP9 I;  2IV2 X;  2JR6 A;  2JA8 I;  2V8J A;  4S1T A;  3RZD I;  2WAQ A;  4HH4 A;  2JIO A;  1AA6 A;  1Q82 1;  2RPR A;  3CCR Z;  3RZO I;  2KPI A;  1Q86 2;  1VQK Z;  3CCJ 1;  1USP A;  2JIR A;  4A3K I;  1JJ2 Y;  1M90 2;  3IFU A;  3KIH A;  3HOV I;  2RIQ A;  2RBL A;  3G71 Z;  3CME Z;  4NBH A;  1RO4 A;  3CD6 Z;  2PK7 A;  2R7Z I;  3M3Y I;  3IX0 A;  1KC8 2;  2G2K A;  3I56 Z;  4RVH A;  1YI2 Z;  4BY1 I;  2LFU A;  4QTT A;  1VQP 1;  3CCM Z;  2PM9 A;  1RO2 A;  4A3J I;  3LUS A;  1SFO I;  3GTP I;  2LIY A;  1I6H I;  5C4J I;  5D1O A;  1VQM Z;  1QVF Y;  2R93 I;  1S72 1;  2B63 I;  4A93 I;  3OW2 Z;  2JIM A;  1VQP Z;  2I3C A;  2QRC B;  3S16 I;  1QVF Z;  2LEX A;  3S1R I;  4AYB A;  1FDO A;  2Q4Z A;  1Z02 A;  2HF1 A;  4MXU A;  3CC2 Z;  2AYD A;  2JS4 A;  3MZK B;  2Y0S A;  2OTL Z;  1TWF I;  4DQY B;  5C44 I;  2QRD B;  3G4S Z;  1Y1V S;  3FKI I;  1YIT 1;  3J80 f;  2HU9 A;  2DE5 A;  3FQQ A;  1K9M 2;  1ZB8 A;  3TDH B;  1YHQ 1;  3NH8 A;  3H0G I;  2JNY A;  1WW9 A;  4DGL A;  2P28 A;  3F3F C;  1Y8C A;  2RHB A;  3PO2 I;  2YAD A;  2F4O A;  2QEX Z;  3D9X A;  3CCR 1;  1YJ9 1;  3CCS Z;  1VQK 1;  4TNU A;  3T4N B;  1YJN 1;  5FLX f;  4A3F I;  4XX2 A;  2JMO A;  3HOW I;  1Q86 1;  2JA7 I;  3J81 f;  2NVQ I;  2JIQ A;  1K83 I;  1K73 1;  3VMI A;  1YUA A;  1QYP A;  2GU2 A;  3S1N I;  1M90 1;  3NH4 A;  4BXX I;  4A3C I;  1RQF A;  3CCJ Z;  5AN9 F;  3I4N I;  2RT9 A;  3S1Q I;  4MON A;  1NUI A;  1ML8 A;  4E32 A;  4MD7 A;  3PO3 S;  2DE7 A;  1WII A;  3GKQ A;  3U50 C;  3GTM I;  3CD6 1;  1QVG Y;  1TWH I;  4E2W A;  3GTQ I;  4A3G I;  2DE6 A;  3VB9 A;  2QR1 B;  1N2F A;  1KC8 1;  5D1P A;  1S72 Z;  3HOZ I;  4RVG A;  4Y7N I;  3J81 b;  2H85 A;  2E2I I;  1NJI 2;  2IZ4 A;  3TE5 B;  2OZK A;  3GTO I;  1X3W A;  2K5R A;  3GTK I;  3NDI A;  4EWC A;  4A3D I;  3CQZ I;  5T64 A;  1Q81 1;  1VQO Z;  3MZL B;  3CC2 1;  5CM2 M;  1K73 2;  3HKZ A;  3BG0 B;  4E2X A;  5C3E I;  4MD9 A;  2WB1 A;  2GTH A;  3CCE 1;  3S17 I;  3G4S 1;  4NBG A;  2JA5 I;  5A2Q b;  1W2B Y;  4DK1 A;  1YIT Z;  1VQ7 Z;  3BG1 B;  3K7A I;  1YJ9 Z;  1VQN Z;  1YJW 1;  1Q7Y 2;  4MH4 A;  1VQ6 1;  3CPW Y;  3PO3 I;  5LL6 f;  3CCU Z;  3P5J B;  3CCE Z;  1NJI 1;  2M6N A;  3MON A;  1VLA A;  4RVD A;  2VF1 A;  3CCQ Z;  3CME 1;  1TWA I;  4NBA A;  2VPZ A;  3JAM b;  1NP6 A;  3CCS 1;  3G6E 1;  3J7A 4;  1VQ8 1;  3CCU 1;  3GTJ I;  1FDI A;  4E30 A;  4QTU A;  5IT9 b;  1M1K 1;  1YIJ 1;  3FQM A;  2V8I A;  1TWG I;  4HGZ A;  1Q7Y 1;  3S2D I;  2OOY B;  1VQ8 Z;  2Q51 A;  4NBB A;  2BJO A;  1RO0 A;  1KD1 1;  1PFT A;  1VQ9 Z;  3G71 1;  4E2Z A;  3CCL Z;  1QVG Z;  4NB9 A;  4BBS I;  3VTN A;  1VQ4 Z;  3NH5 A;  3GCF A;  3ESW A;  3IR7 A;  2O4H A;  1JWH C;  3JAM f;  3D2L A;  1WZN A;  3GTL I;  2NVX I;  2NAP A;  4BBR I;  2EGT A;  1VQ4 1;  2ZAE B;  2IZ3 A;  2QKD A;  3HOX I;  2JIP A;  1KRL A;  3EED A;  4NBD A;  1Q81 2;  1RNI A;  2KI7 B;  2V45 A;  1I3Q I;  1USP B;  4RS4 A;  2QEX 1;  2E2H I;  1Y1W I;  2JUB A;  4E33 A;  1RLY A;  3VMH A;  3HOU I;  3S15 I;  2R92 I;  2OTJ Z;  3CMA Z;  3J80 b;  1VQN 1;  5IT9 f;  1Z03 A; 
#chains in the Genus database with same CATH homology
 1YJN Z;  3CC7 1;  4A3L I;  4NOZ A;  1JJ2 Z;  1TFI A;  4NB8 A;  1YUK A;  5FLM I;  1N8R 2;  3CCQ 1;  5T67 A;  2E9H A;  1ZH1 A;  2YU9 I;  3I4M I;  2VUM I;  2V8K A;  4Y52 I;  5D1O B;  3HOY I;  3G6E Z;  2OTJ 1;  1YJW Z;  3CMA 1;  3KIF A;  1N8R 1;  3I55 1;  1I50 I;  3CC7 Z;  1L1O C;  2O53 A;  1ZB9 A;  1YIJ Z;  3I07 A;  1DL6 A;  4MRI A;  3CCV Z;  1KQS Y;  4NBF A;  4A3M I;  3I55 Z;  1TWC I;  3OW2 Y;  3I56 1;  2VUG A;  4NH1 C;  1YI2 1;  2JA6 I;  2M48 A;  3NDJ A;  2OOX B;  2GTI A;  1VQ9 1;  2QLV B;  1R9T I;  3CCL 1;  4A3B I;  5C4X I;  3M4O I;  1K8A 1;  3CCV 1;  5FLX b;  4A3E I;  3QWU A;  2E2J I;  3VMG A;  4A3I I;  3S2H I;  1W2B Z;  1VQM 1;  3IF8 A;  4BY7 I;  4E31 A;  1K9M 1;  3GTG I;  3CCM 1;  1QF8 A;  1VQO 1;  3F3P C;  2R6M A;  1VQL Z;  3CXC Z;  2J6A A;  4MD8 A;  4HGY A;  3Q87 A;  3D6W A;  3CXC Y;  2QRE B;  4CL1 A;  5IP7 I;  5T6B A;  1Z01 A;  3CPW Z;  3CC4 Z;  1K8A 2;  2P3Y A;  4NFR A;  5A2Q f;  1M1K 2;  2AKL A;  2QA4 Z;  1VQL 1;  1VQ7 1;  4E2Y A;  4NBE A;  2NVY I;  1KD1 2;  1VQ6 Z;  2OTL 1;  1VQ5 1;  4RVF A;  3CC4 1;  4RV9 A;  1X3Z A;  3H3V J;  1Q82 2;  2QA4 1;  2F4M A;  2K3R A;  2PMZ A;  2NVT I;  1KQS Z;  1S7M A;  2W03 A;  3S14 I;  1Y1V I;  3EER A;  1YHQ Z;  1WCM I;  1X0T A;  1LQL A;  3NFZ A;  4NBC A;  2W04 A;  3GTM S;  4X6A I;  1VQ5 Z;  1P9N A;  3S1M I;  5IP9 I;  2JR6 A;  2JA8 I;  2V8J A;  4S1T A;  3RZD I;  2WAQ A;  4HH4 A;  1Q82 1;  2RPR A;  3CCR Z;  3RZO I;  2KPI A;  1Q86 2;  1VQK Z;  3CCJ 1;  1USP A;  4A3K I;  1JJ2 Y;  1M90 2;  3IFU A;  3KIH A;  3HOV I;  2RIQ A;  2RBL A;  3G71 Z;  3CME Z;  4NBH A;  1RO4 A;  3CD6 Z;  2PK7 A;  2R7Z I;  3M3Y I;  3IX0 A;  1KC8 2;  2G2K A;  3I56 Z;  4RVH A;  1YI2 Z;  4BY1 I;  2LFU A;  4QTT A;  1VQP 1;  3CCM Z;  2PM9 A;  1RO2 A;  4A3J I;  3LUS A;  1SFO I;  3GTP I;  2LIY A;  1I6H I;  5C4J I;  5D1O A;  1VQM Z;  1QVF Y;  2R93 I;  1S72 1;  2B63 I;  4A93 I;  3OW2 Z;  1VQP Z;  2I3C A;  2QRC B;  3S16 I;  1QVF Z;  3S1R I;  4AYB A;  2Q4Z A;  1Z02 A;  2HF1 A;  4MXU A;  3CC2 Z;  2JS4 A;  3MZK B;  2Y0S A;  2OTL Z;  1TWF I;  4DQY B;  5C44 I;  2QRD B;  3G4S Z;  1Y1V S;  3FKI I;  1YIT 1;  3J80 f;  2HU9 A;  2DE5 A;  3FQQ A;  1K9M 2;  1ZB8 A;  3TDH B;  1YHQ 1;  3NH8 A;  3H0G I;  2JNY A;  1WW9 A;  4DGL A;  2P28 A;  3F3F C;  2RHB A;  3PO2 I;  2YAD A;  2F4O A;  2QEX Z;  3D9X A;  3CCR 1;  1YJ9 1;  3CCS Z;  1VQK 1;  4TNU A;  3T4N B;  1YJN 1;  5FLX f;  4A3F I;  4XX2 A;  2JMO A;  3HOW I;  1Q86 1;  2JA7 I;  3J81 f;  2NVQ I;  1K83 I;  1K73 1;  3VMI A;  1YUA A;  1QYP A;  2GU2 A;  3S1N I;  1M90 1;  3NH4 A;  4BXX I;  4A3C I;  1RQF A;  3CCJ Z;  5AN9 F;  3I4N I;  2RT9 A;  3S1Q I;  4MON A;  1NUI A;  1ML8 A;  4E32 A;  4MD7 A;  3PO3 S;  2DE7 A;  1WII A;  3GKQ A;  3U50 C;  3GTM I;  3CD6 1;  1QVG Y;  1TWH I;  4E2W A;  3GTQ I;  4A3G I;  2DE6 A;  3VB9 A;  2QR1 B;  1N2F A;  1KC8 1;  5D1P A;  1S72 Z;  3HOZ I;  4RVG A;  4Y7N I;  3J81 b;  2H85 A;  2E2I I;  1NJI 2;  2IZ4 A;  3TE5 B;  2OZK A;  3GTO I;  1X3W A;  2K5R A;  3GTK I;  3NDI A;  4EWC A;  4A3D I;  3CQZ I;  5T64 A;  1Q81 1;  1VQO Z;  3MZL B;  3CC2 1;  5CM2 M;  1K73 2;  3HKZ A;  3BG0 B;  4E2X A;  5C3E I;  4MD9 A;  2WB1 A;  2GTH A;  3CCE 1;  3S17 I;  3G4S 1;  4NBG A;  2JA5 I;  5A2Q b;  1W2B Y;  4DK1 A;  1YIT Z;  1VQ7 Z;  3BG1 B;  3K7A I;  1YJ9 Z;  1VQN Z;  1YJW 1;  1Q7Y 2;  4MH4 A;  1VQ6 1;  3CPW Y;  3PO3 I;  5LL6 f;  3CCU Z;  3P5J B;  3CCE Z;  1NJI 1;  2M6N A;  3MON A;  1VLA A;  4RVD A;  2VF1 A;  3CCQ Z;  3CME 1;  1TWA I;  4NBA A;  3JAM b;  1NP6 A;  3CCS 1;  3G6E 1;  3J7A 4;  1VQ8 1;  3CCU 1;  3GTJ I;  4E30 A;  4QTU A;  5IT9 b;  1M1K 1;  1YIJ 1;  3FQM A;  2V8I A;  1TWG I;  4HGZ A;  1Q7Y 1;  3S2D I;  2OOY B;  1VQ8 Z;  2Q51 A;  4NBB A;  2BJO A;  1RO0 A;  1KD1 1;  1PFT A;  1VQ9 Z;  3G71 1;  4E2Z A;  3CCL Z;  1QVG Z;  4NB9 A;  4BBS I;  3VTN A;  1VQ4 Z;  3NH5 A;  3GCF A;  3ESW A;  2O4H A;  1JWH C;  3JAM f;  3GTL I;  2NVX I;  4BBR I;  2EGT A;  1VQ4 1;  2ZAE B;  2IZ3 A;  2QKD A;  3HOX I;  1KRL A;  3EED A;  4NBD A;  1Q81 2;  1RNI A;  2KI7 B;  1I3Q I;  1USP B;  4RS4 A;  2QEX 1;  2E2H I;  1Y1W I;  2JUB A;  4E33 A;  1RLY A;  3VMH A;  3HOU I;  3S15 I;  2R92 I;  2OTJ Z;  3CMA Z;  3J80 b;  1VQN 1;  5IT9 f;  1Z03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...