1VQ7Z

The structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vq7Z00
3CCJ1 1VQ4Z 3OW2Z 1YI21 1Q821 1M1K1 1YHQZ 3I551 3CCQZ 3CMAZ 1JJ2Z 1VQ8Z 1K732 3CCRZ 3CCSZ 1VQLZ 1YIJZ 1VQ7Z 1KC81 1K8A1 1Q811 3G4SZ 1YJNZ 1QVFZ 1W2BY 3G6EZ 3CCL1 1VQOZ 3CME1 1N8R2 1QVGZ 1Q7Y2 1VQKZ 3I561 1VQP1 1VQ91 1VQ6Z 1QVFY 1K9M2 3CCU1 1VQM1 1Q862 1VQN1 1VQ51 1YITZ 1QVGY 1W2BZ 2OTL1 3CPWZ 1YJWZ 1M902 1VQ41 3CCV1 3CC4Z 1YJ91 3CCJZ 1K731 1KD12 1S721 1YI2Z 3CCQ1 3I55Z 3CD61 3CCS1 3CPWY 2QA41 3CCE1 1N8R1 1Q7Y1 3CC71 3CCM1 3CC21 3CXCY 3CCLZ 3CMEZ 1K9M1 2OTJ1 1Q861 2QEX1 3G711 3I56Z 1VQ9Z 1VQPZ 2QEXZ 1KQSY 1YIT1 3CCUZ 1YHQ1 1VQMZ 3CMA1 1M901 1VQNZ 1VQ81 1VQ5Z 1KD11 3CXCZ 3CCR1 2OTLZ 1YIJ1 1VQL1 1Q822 1M1K2 1VQ71 3CCVZ 1YJ9Z 3G4S1 1YJN1 1S72Z 3G6E1 1KQSZ 1VQO1 1KC82 1K8A2 3CD6Z 1Q812 1VQK1 2QA4Z 1VQ61 3OW2Y 3CCEZ 1JJ2Y 3CC7Z 1NJI2 3CCMZ 3CC2Z 1NJI1 2OTJZ 1YJW1 3CC41 3G71Z
chains in the Genus database with same CATH superfamily
2F4OA 1VQ4Z 1YI21 2QRCB 4MXUA 1Q821 1YHQZ 1QF8A 3MZLB 1K732 1WW9A 2G2KA 2E2JI 3GTOI 4A3LI 2GTIA 3PO3I 1K8A1 2JMOA 3G4SZ 1YJNZ 2QR1B 3G6EZ 4E31A 3IX0A 1RQFA 3RZDI 1N8R2 4S1TA 4QTUA 3I561 1TWGI 2V8IA 1VQ6Z 2M48A 4Y7NI 4MD8A 4RVHA 4BBRI 2NVXI 2VPXA 2P28A 2JIPA 3RZOI 1KD12 1YI2Z 3CCQ1 5IT9b 2QLVB 3GTGI 3M4OI 2DE6A 1Z01A 2JR6A 2E9HA 5FLXf 3I4NI 1QYPA 5FLMI 3I56Z 3K7AI 4RS4A 1YIT1 1Z02A 2PMZA 3VTNA 1Y8CA 1M901 3CMA1 1VQ81 2OOYB 3FQQA 3NH5A 2LIYA 5FLXb 3CCR1 4BXXI 1VQL1 4DK1A 2KI7B 2V3VA 4NBFA 2R6MA 1QXFA 3GKQA 3FQMA 2JIRA 3S1MI 3HOXI 4RVGA 1RO2A 3OW2Y 2AYDA 5C44I 1JJ2Y 1SFOI 4NBDA 4MH4A 3GCFA 1YUKA 3GTJI 2VPWA 2R92I 1KRLA 5C4JI 2JIQA 3CCJ1 2IZ4A 5CM2M 3OW2Z 1JJ2Z 3CMAZ 1VQ8Z 2E7ZA 2BJOA 4NB9A 2VUMI 3S16I 3CCRZ 3CCSZ 1VQLZ 3GTKI 3D9XA 1KC81 3GTMS 5A2Qb 3NDIA 1USPB 3CME1 1SIWA 2R7ZI 1QVGZ 2OZKA 2VUGA 2V45A 1Q16A 3CCU1 2WAQA 1VQN1 2W03A 2YADA 4BY7I 3U50C 4HGYA 1I6HI 1N2FA 3CCJZ 4NFRA 1X3ZA 3S14I 3HOUI 2HF1A 4NBGA 1LQLA 3CCE1 1PFTA 3F3FC 1Q7Y1 5IT9f 3CCM1 3EERA 3KIHA 3CMEZ 1K9M1 2VF1A 2OTJ1 1Q861 2QEX1 2JIOA 1I50I 1X3WA 3GTQI 4HGZA 3CCUZ 2DE5A 1RLYA 1VQNZ 1DL6A 2W04A 1WJ2A 1YIJ1 1Q822 2IZ3A 2PM9A 5IP9I 4BY1I 1Y1VS 3J80f 2DE7A 1K8A2 2YU9I 2R93I 1VQK1 2ZAEB 3ESWA 1TFIA 3CCEZ 3HOVI 5T67A 2EGTA 4NOZA 4EWCA 4X6AI 1RO0A 3I07A 3CCMZ 3J80b 5D1OA 2NVQI 2QREB 2OTJZ 2QEXZ 1YJW1 3CC41 2V8KA 4MD7A 3HOZI 2K5RA 3I4MI 1M1K1 2GTHA 3MZKB 3CCQZ 4A3FI 1ZB9A 1YIJZ 1Z03A 3VMIA 1Q811 3S1RI 3CQZI 1QVFZ 3IFUA 1JWHC 4DGLA 2Y0SA 4NBCA 1VQKZ 4NBEA 1VQ91 2RIQA 5A2Qf 1WZNA 3MONA 3NH8A 2F4MA 4A3JI 1VLAA 3GTMI 4XX2A 2I3CA 1VQ51 1YITZ 1QVGY 3P5JB 4A3MI 1NP6A 2OTL1 2HU9A 3J81f 3CPWZ 2K3RA 1YJWZ 1M902 1VQ41 2QRDB 3CCV1 3CC4Z 1K731 2WB1A 3D6WA 1ZB8A 4RV9A 1S721 3HOWI 3PO2I 2P3YA 2Q4ZA 4CL1A 2QA41 1X0TA 3J81b 1N8R1 3J7A4 3VB9A 5C3EI 3CC71 4A93I 4A3DI 3CXCY 2JA8I 2B63I 1K83I 3QWUA 2PK7A 3IF8A 3G711 2H85A 1VQ9Z 1TWAI 1AA6A 4TNUA 2GU2A 3EEDA 3KIFA 4E2YA 4RVDA 5LL6f 1VQ5Z 2O53A 1KD11 4HH4A 2RT9A 3CXCZ 2OTLZ 2E2II 1TWFI 1VQ71 3CCVZ 3S2HI 2NAPA 3S1NI 1S72Z 1VQO1 3NH4A 1KC82 4MONA 3HOYI 2KPIA 2QA4Z 2V8JA 3VMGA 1USPA 3GTPI 1ML8A 2LFUA 4AYBA 2NVYI 3CC7Z 1NJI2 3Q87A 1Y1VI 2RHBA 4BBSI 3PO3S 2O4HA 5D1OB 4A3EI 3G71Z 2NVTI 5T6BA 5T64A 1Y1WI 3BG0B 3I551 2RBLA 3TDHB 4QTTA 1R9TI 4A3BI 4A3KI 4E2XA 5AN9F 2JIMA 1VQ7Z 3H3VJ 1RNIA 1W2BY 3CCL1 1VQOZ 2Q51A 3IR7A 1Q7Y2 4E32A 2AKLA 1VQP1 4E30A 1QVFY 1K9M2 3M3YI 3S17I 4MD9A 1VQM1 1Q862 4A3CI 3NDJA 4E2ZA 1W2BZ 2M6NA 2VPYA 2E2HI 3NFZA 5C4XI 1RO4A 2JS4A 1YJ91 3LUSA 3BG1B 3I55Z 3CD61 3S1QI 3CCS1 3GTLI 3CPWY 1FDIA 3TE5B 1TWCI 1P9NA 2IV2X 4E33A 2RPRA 3CC21 3JAMf 2LEXA 4NBBA 1ZH1A 3CCLZ 1YUAA 1TWHI 3VMHA 4NB8A 4NBHA 4RVFA 1VQPZ 3S15I 1KQSY 2OOXB 5IP7I 1YHQ1 2JA5I 1VQMZ 3S2DI 2J6AA 4E2WA 3JAMb 5D1PA 3T4NB 3D2LA 3H0GI 1WIIA 1M1K2 1NUIA 2JNYA 1YJ9Z 1WCMI 2QKDA 3FKII 3G4S1 1YJN1 4DQYB 2JUBA 3G6E1 1KQSZ 1I3QI 4NBAA 3F3PC 3CD6Z 1Q812 4NH1C 4A3II 1VQ61 4Y52I 3HKZA 2JA6I 2VPZA 4MRIA 3CC2Z 1FDOA 4A3GI 1L1OC 2JA7I 1NJI1 1S7MA
chains in the Genus database with same CATH topology
2F4OA 1VQ4Z 1YI21 2QRCB 4MXUA 1Q821 1YHQZ 1QF8A 3MZLB 1K732 1WW9A 2G2KA 2E2JI 3GTOI 4A3LI 2GTIA 3PO3I 1K8A1 2JMOA 3G4SZ 1YJNZ 2QR1B 3G6EZ 4E31A 3IX0A 1RQFA 3RZDI 1N8R2 4S1TA 4QTUA 3I561 1TWGI 2V8IA 1VQ6Z 2M48A 4Y7NI 4MD8A 4RVHA 4BBRI 2NVXI 2P28A 3RZOI 1KD12 1YI2Z 3CCQ1 5IT9b 2QLVB 3GTGI 3M4OI 2DE6A 1Z01A 2JR6A 2E9HA 5FLXf 3I4NI 1QYPA 5FLMI 3I56Z 3K7AI 4RS4A 1YIT1 1Z02A 2PMZA 3VTNA 3CMA1 1M901 1VQ81 2OOYB 3FQQA 3NH5A 2LIYA 5FLXb 3CCR1 4BXXI 1VQL1 4DK1A 2KI7B 4NBFA 2R6MA 3GKQA 3FQMA 3S1MI 3HOXI 4RVGA 1RO2A 3OW2Y 5C44I 1JJ2Y 1SFOI 4NBDA 4MH4A 3GCFA 1YUKA 3GTJI 2R92I 1KRLA 5C4JI 3CCJ1 2IZ4A 5CM2M 3OW2Z 1JJ2Z 3CMAZ 1VQ8Z 2BJOA 4NB9A 2VUMI 3S16I 3CCRZ 3CCSZ 1VQLZ 3GTKI 3D9XA 1KC81 3GTMS 5A2Qb 3NDIA 1USPB 3CME1 2R7ZI 1QVGZ 2OZKA 2VUGA 3CCU1 2WAQA 1VQN1 2W03A 2YADA 4BY7I 3U50C 4HGYA 1I6HI 1N2FA 3CCJZ 4NFRA 1X3ZA 3S14I 3HOUI 2HF1A 4NBGA 1LQLA 3CCE1 1PFTA 3F3FC 1Q7Y1 5IT9f 3CCM1 3EERA 3KIHA 3CMEZ 1K9M1 2VF1A 2OTJ1 1Q861 2QEX1 1I50I 1X3WA 3GTQI 4HGZA 3CCUZ 2DE5A 1RLYA 1VQNZ 1DL6A 2W04A 1YIJ1 1Q822 2IZ3A 2PM9A 5IP9I 4BY1I 1Y1VS 3J80f 2DE7A 1K8A2 2YU9I 2R93I 1VQK1 2ZAEB 3ESWA 1TFIA 3CCEZ 3HOVI 5T67A 2EGTA 4NOZA 4EWCA 4X6AI 1RO0A 3I07A 3CCMZ 3J80b 5D1OA 2NVQI 2QREB 2OTJZ 2QEXZ 1YJW1 3CC41 2V8KA 4MD7A 3HOZI 2K5RA 3I4MI 1M1K1 2GTHA 3MZKB 3CCQZ 4A3FI 1ZB9A 1YIJZ 1Z03A 3VMIA 1Q811 3S1RI 3CQZI 1QVFZ 3IFUA 1JWHC 4DGLA 2Y0SA 4NBCA 1VQKZ 4NBEA 1VQ91 2RIQA 5A2Qf 3MONA 3NH8A 2F4MA 4A3JI 1VLAA 3GTMI 4XX2A 2I3CA 1VQ51 1YITZ 1QVGY 3P5JB 4A3MI 1NP6A 2OTL1 2HU9A 3J81f 3CPWZ 2K3RA 1YJWZ 1M902 1VQ41 2QRDB 3CCV1 3CC4Z 1K731 2WB1A 3D6WA 1ZB8A 4RV9A 1S721 3HOWI 3PO2I 2P3YA 2Q4ZA 4CL1A 2QA41 1X0TA 3J81b 1N8R1 3J7A4 3VB9A 5C3EI 3CC71 4A93I 4A3DI 3CXCY 2JA8I 2B63I 1K83I 3QWUA 2PK7A 3IF8A 3G711 2H85A 1VQ9Z 1TWAI 4TNUA 2GU2A 3EEDA 3KIFA 4E2YA 4RVDA 5LL6f 1VQ5Z 2O53A 1KD11 4HH4A 2RT9A 3CXCZ 2OTLZ 2E2II 1TWFI 1VQ71 3CCVZ 3S2HI 3S1NI 1S72Z 1VQO1 3NH4A 1KC82 4MONA 3HOYI 2KPIA 2QA4Z 2V8JA 3VMGA 1USPA 3GTPI 1ML8A 2LFUA 4AYBA 2NVYI 3CC7Z 1NJI2 3Q87A 1Y1VI 2RHBA 4BBSI 3PO3S 2O4HA 5D1OB 4A3EI 3G71Z 2NVTI 5T6BA 5T64A 1Y1WI 3BG0B 3I551 2RBLA 3TDHB 4QTTA 1R9TI 4A3BI 4A3KI 4E2XA 5AN9F 1VQ7Z 3H3VJ 1RNIA 1W2BY 3CCL1 1VQOZ 2Q51A 1Q7Y2 4E32A 2AKLA 1VQP1 4E30A 1QVFY 1K9M2 3M3YI 3S17I 4MD9A 1VQM1 1Q862 4A3CI 3NDJA 4E2ZA 1W2BZ 2M6NA 2E2HI 3NFZA 5C4XI 1RO4A 2JS4A 1YJ91 3LUSA 3BG1B 3I55Z 3CD61 3S1QI 3CCS1 3GTLI 3CPWY 3TE5B 1TWCI 1P9NA 4E33A 2RPRA 3CC21 3JAMf 4NBBA 1ZH1A 3CCLZ 1YUAA 1TWHI 3VMHA 4NB8A 4NBHA 4RVFA 1VQPZ 3S15I 1KQSY 2OOXB 5IP7I 1YHQ1 2JA5I 1VQMZ 3S2DI 2J6AA 4E2WA 3JAMb 5D1PA 3T4NB 3H0GI 1WIIA 1M1K2 1NUIA 2JNYA 1YJ9Z 1WCMI 2QKDA 3FKII 3G4S1 1YJN1 4DQYB 2JUBA 3G6E1 1KQSZ 1I3QI 4NBAA 3F3PC 3CD6Z 1Q812 4NH1C 4A3II 1VQ61 4Y52I 3HKZA 2JA6I 4MRIA 3CC2Z 4A3GI 1L1OC 2JA7I 1NJI1 1S7MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCJ 1;  1VQ4 Z;  3OW2 Z;  1YI2 1;  1Q82 1;  1M1K 1;  1YHQ Z;  3I55 1;  3CCQ Z;  3CMA Z;  1JJ2 Z;  1VQ8 Z;  1K73 2;  3CCR Z;  3CCS Z;  1VQL Z;  1YIJ Z;  1VQ7 Z;  1KC8 1;  1K8A 1;  1Q81 1;  3G4S Z;  1YJN Z;  1QVF Z;  1W2B Y;  3G6E Z;  3CCL 1;  1VQO Z;  3CME 1;  1N8R 2;  1QVG Z;  1Q7Y 2;  1VQK Z;  3I56 1;  1VQP 1;  1VQ9 1;  1VQ6 Z;  1QVF Y;  1K9M 2;  3CCU 1;  1VQM 1;  1Q86 2;  1VQN 1;  1VQ5 1;  1YIT Z;  1QVG Y;  1W2B Z;  2OTL 1;  3CPW Z;  1YJW Z;  1M90 2;  1VQ4 1;  3CCV 1;  3CC4 Z;  1YJ9 1;  3CCJ Z;  1K73 1;  1KD1 2;  1S72 1;  1YI2 Z;  3CCQ 1;  3I55 Z;  3CD6 1;  3CCS 1;  3CPW Y;  2QA4 1;  3CCE 1;  1N8R 1;  1Q7Y 1;  3CC7 1;  3CCM 1;  3CC2 1;  3CXC Y;  3CCL Z;  3CME Z;  1K9M 1;  2OTJ 1;  1Q86 1;  2QEX 1;  3G71 1;  3I56 Z;  1VQ9 Z;  1VQP Z;  2QEX Z;  1KQS Y;  1YIT 1;  3CCU Z;  1YHQ 1;  1VQM Z;  3CMA 1;  1M90 1;  1VQN Z;  1VQ8 1;  1VQ5 Z;  1KD1 1;  3CXC Z;  3CCR 1;  2OTL Z;  1YIJ 1;  1VQL 1;  1Q82 2;  1M1K 2;  1VQ7 1;  3CCV Z;  1YJ9 Z;  3G4S 1;  1YJN 1;  1S72 Z;  3G6E 1;  1KQS Z;  1VQO 1;  1KC8 2;  1K8A 2;  3CD6 Z;  1Q81 2;  1VQK 1;  2QA4 Z;  1VQ6 1;  3OW2 Y;  3CCE Z;  1JJ2 Y;  3CC7 Z;  1NJI 2;  3CCM Z;  3CC2 Z;  1NJI 1;  2OTJ Z;  1YJW 1;  3CC4 1;  3G71 Z; 
#chains in the Genus database with same CATH topology
 2F4O A;  1VQ4 Z;  1YI2 1;  2QRC B;  4MXU A;  1Q82 1;  1YHQ Z;  1QF8 A;  3MZL B;  1K73 2;  1WW9 A;  2G2K A;  2E2J I;  3GTO I;  4A3L I;  2GTI A;  3PO3 I;  1K8A 1;  2JMO A;  3G4S Z;  1YJN Z;  2QR1 B;  3G6E Z;  4E31 A;  3IX0 A;  1RQF A;  3RZD I;  1N8R 2;  4S1T A;  4QTU A;  3I56 1;  1TWG I;  2V8I A;  1VQ6 Z;  2M48 A;  4Y7N I;  4MD8 A;  4RVH A;  4BBR I;  2NVX I;  2VPX A;  2P28 A;  2JIP A;  3RZO I;  1KD1 2;  1YI2 Z;  3CCQ 1;  5IT9 b;  2QLV B;  3GTG I;  3M4O I;  2DE6 A;  1Z01 A;  2JR6 A;  2E9H A;  5FLX f;  3I4N I;  1QYP A;  5FLM I;  3I56 Z;  3K7A I;  4RS4 A;  1YIT 1;  1Z02 A;  2PMZ A;  3VTN A;  1Y8C A;  1M90 1;  3CMA 1;  1VQ8 1;  2OOY B;  3FQQ A;  3NH5 A;  2LIY A;  5FLX b;  3CCR 1;  4BXX I;  1VQL 1;  4DK1 A;  2KI7 B;  2V3V A;  4NBF A;  2R6M A;  1QXF A;  3GKQ A;  3FQM A;  2JIR A;  3S1M I;  3HOX I;  4RVG A;  1RO2 A;  3OW2 Y;  2AYD A;  5C44 I;  1JJ2 Y;  1SFO I;  4NBD A;  4MH4 A;  3GCF A;  1YUK A;  3GTJ I;  2VPW A;  2R92 I;  1KRL A;  5C4J I;  2JIQ A;  3CCJ 1;  2IZ4 A;  5CM2 M;  3OW2 Z;  1JJ2 Z;  3CMA Z;  1VQ8 Z;  2E7Z A;  2BJO A;  4NB9 A;  2VUM I;  3S16 I;  3CCR Z;  3CCS Z;  1VQL Z;  3GTK I;  3D9X A;  1KC8 1;  3GTM S;  5A2Q b;  3NDI A;  1USP B;  3CME 1;  1SIW A;  2R7Z I;  1QVG Z;  2OZK A;  2VUG A;  2V45 A;  1Q16 A;  3CCU 1;  2WAQ A;  1VQN 1;  2W03 A;  2YAD A;  4BY7 I;  3U50 C;  4HGY A;  1I6H I;  1N2F A;  3CCJ Z;  4NFR A;  1X3Z A;  3S14 I;  3HOU I;  2HF1 A;  4NBG A;  1LQL A;  3CCE 1;  1PFT A;  3F3F C;  1Q7Y 1;  5IT9 f;  3CCM 1;  3EER A;  3KIH A;  3CME Z;  1K9M 1;  2VF1 A;  2OTJ 1;  1Q86 1;  2QEX 1;  2JIO A;  1I50 I;  1X3W A;  3GTQ I;  4HGZ A;  3CCU Z;  2DE5 A;  1RLY A;  1VQN Z;  1DL6 A;  2W04 A;  1WJ2 A;  1YIJ 1;  1Q82 2;  2IZ3 A;  2PM9 A;  5IP9 I;  4BY1 I;  1Y1V S;  3J80 f;  2DE7 A;  1K8A 2;  2YU9 I;  2R93 I;  1VQK 1;  2ZAE B;  3ESW A;  1TFI A;  3CCE Z;  3HOV I;  5T67 A;  2EGT A;  4NOZ A;  4EWC A;  4X6A I;  1RO0 A;  3I07 A;  3CCM Z;  3J80 b;  5D1O A;  2NVQ I;  2QRE B;  2OTJ Z;  2QEX Z;  1YJW 1;  3CC4 1;  2V8K A;  4MD7 A;  3HOZ I;  2K5R A;  3I4M I;  1M1K 1;  2GTH A;  3MZK B;  3CCQ Z;  4A3F I;  1ZB9 A;  1YIJ Z;  1Z03 A;  3VMI A;  1Q81 1;  3S1R I;  3CQZ I;  1QVF Z;  3IFU A;  1JWH C;  4DGL A;  2Y0S A;  4NBC A;  1VQK Z;  4NBE A;  1VQ9 1;  2RIQ A;  5A2Q f;  1WZN A;  3MON A;  3NH8 A;  2F4M A;  4A3J I;  1VLA A;  3GTM I;  4XX2 A;  2I3C A;  1VQ5 1;  1YIT Z;  1QVG Y;  3P5J B;  4A3M I;  1NP6 A;  2OTL 1;  2HU9 A;  3J81 f;  3CPW Z;  2K3R A;  1YJW Z;  1M90 2;  1VQ4 1;  2QRD B;  3CCV 1;  3CC4 Z;  1K73 1;  2WB1 A;  3D6W A;  1ZB8 A;  4RV9 A;  1S72 1;  3HOW I;  3PO2 I;  2P3Y A;  2Q4Z A;  4CL1 A;  2QA4 1;  1X0T A;  3J81 b;  1N8R 1;  3J7A 4;  3VB9 A;  5C3E I;  3CC7 1;  4A93 I;  4A3D I;  3CXC Y;  2JA8 I;  2B63 I;  1K83 I;  3QWU A;  2PK7 A;  3IF8 A;  3G71 1;  2H85 A;  1VQ9 Z;  1TWA I;  1AA6 A;  4TNU A;  2GU2 A;  3EED A;  3KIF A;  4E2Y A;  4RVD A;  5LL6 f;  1VQ5 Z;  2O53 A;  1KD1 1;  4HH4 A;  2RT9 A;  3CXC Z;  2OTL Z;  2E2I I;  1TWF I;  1VQ7 1;  3CCV Z;  3S2H I;  2NAP A;  3S1N I;  1S72 Z;  1VQO 1;  3NH4 A;  1KC8 2;  4MON A;  3HOY I;  2KPI A;  2QA4 Z;  2V8J A;  3VMG A;  1USP A;  3GTP I;  1ML8 A;  2LFU A;  4AYB A;  2NVY I;  3CC7 Z;  1NJI 2;  3Q87 A;  1Y1V I;  2RHB A;  4BBS I;  3PO3 S;  2O4H A;  5D1O B;  4A3E I;  3G71 Z;  2NVT I;  5T6B A;  5T64 A;  1Y1W I;  3BG0 B;  3I55 1;  2RBL A;  3TDH B;  4QTT A;  1R9T I;  4A3B I;  4A3K I;  4E2X A;  5AN9 F;  2JIM A;  1VQ7 Z;  3H3V J;  1RNI A;  1W2B Y;  3CCL 1;  1VQO Z;  2Q51 A;  3IR7 A;  1Q7Y 2;  4E32 A;  2AKL A;  1VQP 1;  4E30 A;  1QVF Y;  1K9M 2;  3M3Y I;  3S17 I;  4MD9 A;  1VQM 1;  1Q86 2;  4A3C I;  3NDJ A;  4E2Z A;  1W2B Z;  2M6N A;  2VPY A;  2E2H I;  3NFZ A;  5C4X I;  1RO4 A;  2JS4 A;  1YJ9 1;  3LUS A;  3BG1 B;  3I55 Z;  3CD6 1;  3S1Q I;  3CCS 1;  3GTL I;  3CPW Y;  1FDI A;  3TE5 B;  1TWC I;  1P9N A;  2IV2 X;  4E33 A;  2RPR A;  3CC2 1;  3JAM f;  2LEX A;  4NBB A;  1ZH1 A;  3CCL Z;  1YUA A;  1TWH I;  3VMH A;  4NB8 A;  4NBH A;  4RVF A;  1VQP Z;  3S15 I;  1KQS Y;  2OOX B;  5IP7 I;  1YHQ 1;  2JA5 I;  1VQM Z;  3S2D I;  2J6A A;  4E2W A;  3JAM b;  5D1P A;  3T4N B;  3D2L A;  3H0G I;  1WII A;  1M1K 2;  1NUI A;  2JNY A;  1YJ9 Z;  1WCM I;  2QKD A;  3FKI I;  3G4S 1;  1YJN 1;  4DQY B;  2JUB A;  3G6E 1;  1KQS Z;  1I3Q I;  4NBA A;  3F3P C;  3CD6 Z;  1Q81 2;  4NH1 C;  4A3I I;  1VQ6 1;  4Y52 I;  3HKZ A;  2JA6 I;  2VPZ A;  4MRI A;  3CC2 Z;  1FDO A;  4A3G I;  1L1O C;  2JA7 I;  1NJI 1;  1S7M A; 
#chains in the Genus database with same CATH homology
 2F4O A;  1VQ4 Z;  1YI2 1;  2QRC B;  4MXU A;  1Q82 1;  1YHQ Z;  1QF8 A;  3MZL B;  1K73 2;  1WW9 A;  2G2K A;  2E2J I;  3GTO I;  4A3L I;  2GTI A;  3PO3 I;  1K8A 1;  2JMO A;  3G4S Z;  1YJN Z;  2QR1 B;  3G6E Z;  4E31 A;  3IX0 A;  1RQF A;  3RZD I;  1N8R 2;  4S1T A;  4QTU A;  3I56 1;  1TWG I;  2V8I A;  1VQ6 Z;  2M48 A;  4Y7N I;  4MD8 A;  4RVH A;  4BBR I;  2NVX I;  2P28 A;  3RZO I;  1KD1 2;  1YI2 Z;  3CCQ 1;  5IT9 b;  2QLV B;  3GTG I;  3M4O I;  2DE6 A;  1Z01 A;  2JR6 A;  2E9H A;  5FLX f;  3I4N I;  1QYP A;  5FLM I;  3I56 Z;  3K7A I;  4RS4 A;  1YIT 1;  1Z02 A;  2PMZ A;  3VTN A;  3CMA 1;  1M90 1;  1VQ8 1;  2OOY B;  3FQQ A;  3NH5 A;  2LIY A;  5FLX b;  3CCR 1;  4BXX I;  1VQL 1;  4DK1 A;  2KI7 B;  4NBF A;  2R6M A;  3GKQ A;  3FQM A;  3S1M I;  3HOX I;  4RVG A;  1RO2 A;  3OW2 Y;  5C44 I;  1JJ2 Y;  1SFO I;  4NBD A;  4MH4 A;  3GCF A;  1YUK A;  3GTJ I;  2R92 I;  1KRL A;  5C4J I;  3CCJ 1;  2IZ4 A;  5CM2 M;  3OW2 Z;  1JJ2 Z;  3CMA Z;  1VQ8 Z;  2BJO A;  4NB9 A;  2VUM I;  3S16 I;  3CCR Z;  3CCS Z;  1VQL Z;  3GTK I;  3D9X A;  1KC8 1;  3GTM S;  5A2Q b;  3NDI A;  1USP B;  3CME 1;  2R7Z I;  1QVG Z;  2OZK A;  2VUG A;  3CCU 1;  2WAQ A;  1VQN 1;  2W03 A;  2YAD A;  4BY7 I;  3U50 C;  4HGY A;  1I6H I;  1N2F A;  3CCJ Z;  4NFR A;  1X3Z A;  3S14 I;  3HOU I;  2HF1 A;  4NBG A;  1LQL A;  3CCE 1;  1PFT A;  3F3F C;  1Q7Y 1;  5IT9 f;  3CCM 1;  3EER A;  3KIH A;  3CME Z;  1K9M 1;  2VF1 A;  2OTJ 1;  1Q86 1;  2QEX 1;  1I50 I;  1X3W A;  3GTQ I;  4HGZ A;  3CCU Z;  2DE5 A;  1RLY A;  1VQN Z;  1DL6 A;  2W04 A;  1YIJ 1;  1Q82 2;  2IZ3 A;  2PM9 A;  5IP9 I;  4BY1 I;  1Y1V S;  3J80 f;  2DE7 A;  1K8A 2;  2YU9 I;  2R93 I;  1VQK 1;  2ZAE B;  3ESW A;  1TFI A;  3CCE Z;  3HOV I;  5T67 A;  2EGT A;  4NOZ A;  4EWC A;  4X6A I;  1RO0 A;  3I07 A;  3CCM Z;  3J80 b;  5D1O A;  2NVQ I;  2QRE B;  2OTJ Z;  2QEX Z;  1YJW 1;  3CC4 1;  2V8K A;  4MD7 A;  3HOZ I;  2K5R A;  3I4M I;  1M1K 1;  2GTH A;  3MZK B;  3CCQ Z;  4A3F I;  1ZB9 A;  1YIJ Z;  1Z03 A;  3VMI A;  1Q81 1;  3S1R I;  3CQZ I;  1QVF Z;  3IFU A;  1JWH C;  4DGL A;  2Y0S A;  4NBC A;  1VQK Z;  4NBE A;  1VQ9 1;  2RIQ A;  5A2Q f;  3MON A;  3NH8 A;  2F4M A;  4A3J I;  1VLA A;  3GTM I;  4XX2 A;  2I3C A;  1VQ5 1;  1YIT Z;  1QVG Y;  3P5J B;  4A3M I;  1NP6 A;  2OTL 1;  2HU9 A;  3J81 f;  3CPW Z;  2K3R A;  1YJW Z;  1M90 2;  1VQ4 1;  2QRD B;  3CCV 1;  3CC4 Z;  1K73 1;  2WB1 A;  3D6W A;  1ZB8 A;  4RV9 A;  1S72 1;  3HOW I;  3PO2 I;  2P3Y A;  2Q4Z A;  4CL1 A;  2QA4 1;  1X0T A;  3J81 b;  1N8R 1;  3J7A 4;  3VB9 A;  5C3E I;  3CC7 1;  4A93 I;  4A3D I;  3CXC Y;  2JA8 I;  2B63 I;  1K83 I;  3QWU A;  2PK7 A;  3IF8 A;  3G71 1;  2H85 A;  1VQ9 Z;  1TWA I;  4TNU A;  2GU2 A;  3EED A;  3KIF A;  4E2Y A;  4RVD A;  5LL6 f;  1VQ5 Z;  2O53 A;  1KD1 1;  4HH4 A;  2RT9 A;  3CXC Z;  2OTL Z;  2E2I I;  1TWF I;  1VQ7 1;  3CCV Z;  3S2H I;  3S1N I;  1S72 Z;  1VQO 1;  3NH4 A;  1KC8 2;  4MON A;  3HOY I;  2KPI A;  2QA4 Z;  2V8J A;  3VMG A;  1USP A;  3GTP I;  1ML8 A;  2LFU A;  4AYB A;  2NVY I;  3CC7 Z;  1NJI 2;  3Q87 A;  1Y1V I;  2RHB A;  4BBS I;  3PO3 S;  2O4H A;  5D1O B;  4A3E I;  3G71 Z;  2NVT I;  5T6B A;  5T64 A;  1Y1W I;  3BG0 B;  3I55 1;  2RBL A;  3TDH B;  4QTT A;  1R9T I;  4A3B I;  4A3K I;  4E2X A;  5AN9 F;  1VQ7 Z;  3H3V J;  1RNI A;  1W2B Y;  3CCL 1;  1VQO Z;  2Q51 A;  1Q7Y 2;  4E32 A;  2AKL A;  1VQP 1;  4E30 A;  1QVF Y;  1K9M 2;  3M3Y I;  3S17 I;  4MD9 A;  1VQM 1;  1Q86 2;  4A3C I;  3NDJ A;  4E2Z A;  1W2B Z;  2M6N A;  2E2H I;  3NFZ A;  5C4X I;  1RO4 A;  2JS4 A;  1YJ9 1;  3LUS A;  3BG1 B;  3I55 Z;  3CD6 1;  3S1Q I;  3CCS 1;  3GTL I;  3CPW Y;  3TE5 B;  1TWC I;  1P9N A;  4E33 A;  2RPR A;  3CC2 1;  3JAM f;  4NBB A;  1ZH1 A;  3CCL Z;  1YUA A;  1TWH I;  3VMH A;  4NB8 A;  4NBH A;  4RVF A;  1VQP Z;  3S15 I;  1KQS Y;  2OOX B;  5IP7 I;  1YHQ 1;  2JA5 I;  1VQM Z;  3S2D I;  2J6A A;  4E2W A;  3JAM b;  5D1P A;  3T4N B;  3H0G I;  1WII A;  1M1K 2;  1NUI A;  2JNY A;  1YJ9 Z;  1WCM I;  2QKD A;  3FKI I;  3G4S 1;  1YJN 1;  4DQY B;  2JUB A;  3G6E 1;  1KQS Z;  1I3Q I;  4NBA A;  3F3P C;  3CD6 Z;  1Q81 2;  4NH1 C;  4A3I I;  1VQ6 1;  4Y52 I;  3HKZ A;  2JA6 I;  4MRI A;  3CC2 Z;  4A3G I;  1L1O C;  2JA7 I;  1NJI 1;  1S7M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...