1W2BY

Trigger factor ribosome binding domain in complex with 50s
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title Trigger Factor in Complex with the Ribosome Forms a Molecular Cradle for Nascent Proteins
pubmed doi rcsb
source organism Escherichia coli
total genus 11
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1w2bY00
1VQ4Z 1VQK1 1YJ9Z 1YIJZ 3CC7Z 3I55Z 1KD11 1M1K1 3CMEZ 1Q812 3OW2Z 2QEX1 1YJN1 1VQ5Z 1Q7Y1 2OTL1 3G6EZ 3CD61 1W2BZ 1VQPZ 3CCR1 3CC4Z 1YI2Z 3CXCY 3CC21 1YHQZ 2OTJZ 1Q822 1YJW1 1K731 3CCQZ 1KC82 3G4S1 1W2BY 3CCL1 1VQO1 1VQ7Z 1VQ8Z 3CPWZ 1Q811 3G71Z 1VQN1 1VQ41 1K8A2 3CCV1 3CCM1 3CCU1 1QVFZ 1VQKZ 3I561 1VQ61 1VQ51 3OW2Y 1YIT1 3CCJ1 1Q821 3CMA1 1YJNZ 1KC81 1KQSZ 1QVFY 1NJI2 1VQ91 1VQL1 1S721 2OTLZ 3CD6Z 1Q862 1N8R2 3CCS1 1VQM1 2QA41 1K8A1 3CC2Z 3CCE1 1K9M2 1QVGZ 1KQSY 1YJWZ 1YJ91 3G4SZ 1JJ2Z 1YIJ1 3CC71 3CCLZ 3I551 3CPWY 1VQOZ 3CME1 1QVGY 3G6E1 1VQNZ 2QEXZ 1M901 1NJI1 1JJ2Y 1VQP1 1M902 3CC41 1Q861 1N8R1 3CCVZ 1YI21 3CCMZ 3CCUZ 3CXCZ 1YHQ1 2OTJ1 3I56Z 3CCRZ 1KD12 1K9M1 1M1K2 1VQ6Z 3CCQ1 1YITZ 3CCJZ 1Q7Y2 3CMAZ 1VQ71 1VQ81 1VQ9Z 1VQLZ 1S72Z 3G711 3CCSZ 1VQMZ 2QA4Z 3CCEZ 1K732
chains in the Genus database with same CATH superfamily
1VQ4Z 1TWGI 5D1OA 4RVGA 1RO0A 3H0GI 1M1K1 3HOWI 1RLYA 1Q7Y1 1KRLA 3VMGA 1WJ2A 2OOXB 1AA6A 2OTL1 1I6HI 2NVXI 2RPRA 2O53A 4A3FI 1RO2A 3CCQZ 4NBGA 5C4XI 2RIQA 4E31A 2F4MA 4EWCA 1VQO1 3S2DI 1Y8CA 1VQ8Z 1X3WA 3Q87A 1YUAA 2Q4ZA 3D9XA 3IR7A 3VB9A 4A3LI 1K8A2 2DE6A 3HKZA 1QF8A 2R7ZI 1ZB8A 1X3ZA 3NDJA 4NBBA 3EERA 4RV9A 3I561 5FLXb 1TWCI 1VQ51 2WAQA 1RO4A 1YJNZ 3FQMA 2HF1A 4E33A 2BJOA 5C44I 4RVHA 4NFRA 3CC2Z 3HOUI 3GTOI 3RZOI 2JIPA 2JA5I 2JA6I 3I4MI 3G4SZ 1WZNA 3FQQA 1WW9A 1JJ2Z 3I551 3CPWY 4HH4A 3J80f 2WB1A 3RZDI 3G6E1 3S16I 4E2WA 1M901 1I3QI 1JJ2Y 3CC41 3F3FC 3F3PC 1Q861 3CCVZ 2E7ZA 2B63I 2H85A 4QTTA 1VQ6Z 1M1K2 2E2II 5T6BA 4NH1C 4A3DI 2VF1A 4MD8A 1FDOA 3CCJZ 1YITZ 2QRCB 1Q7Y2 5D1OB 2NVYI 2AYDA 1NP6A 1YUKA 1VQ9Z 1VQLZ 5T64A 2IV2X 2W04A 3CCSZ 4E2YA 2QA4Z 3NH5A 4NOZA 2GTIA 2NVQI 5A2Qb 2QKDA 1I50I 3S2HI 4RVDA 1TWAI 2DE7A 1RQFA 3CC7Z 2NAPA 4A3JI 3CMEZ 3OW2Z 1ZH1A 5T67A 1Z03A 3GTMS 1ZB9A 4MONA 3CCR1 1YI2Z 3CXCY 2HU9A 2F4OA 1YHQZ 2R92I 1YJW1 1K731 4CL1A 3NFZA 1Y1WI 3CCL1 3J7A4 1VQ7Z 1RNIA 2VPZA 3GTJI 3EEDA 2I3CA 5IP7I 3G71Z 3KIFA 1VQ41 3S1QI 1Y1VI 2LFUA 3GTGI 5FLXf 3CCM1 4Y52I 3CCU1 2R93I 3S1MI 2RHBA 4E32A 4A3BI 2Y0SA 3HOXI 3I4NI 1Q821 3CMA1 4DGLA 2ZAEB 1KC81 1QYPA 2OTLZ 2PM9A 4TNUA 3JAMb 1Q862 3S14I 3S1RI 3TE5B 4S1TA 3PO2I 1VQM1 3TDHB 3J81b 3NH4A 1QVGZ 4NBFA 2JIQA 1YJ91 2E2JI 4A3II 1YIJ1 2DE5A 1VQOZ 2RT9A 4Y7NI 2QLVB 2V8KA 1QVGY 3S15I 4A3GI 2QEXZ 3M4OI 3GKQA 4NBEA 1VQP1 2Q51A 2K3RA 1N8R1 1Y1VS 3IFUA 2OTJ1 3I56Z 3S1NI 1Z01A 1Q16A 1USPA 3VMHA 1R9TI 5C4JI 2QREB 1PFTA 2KPIA 4NBAA 2R6MA 4NBHA 2LIYA 3K7AI 3BG0B 5A2Qf 3GTMI 1WIIA 2VPXA 3HOVI 5IT9b 1K732 3VMIA 1VQK1 4BY1I 2PMZA 3D6WA 4HGZA 3I55Z 3GTPI 2M6NA 4BY7I 2YU9I 3G6EZ 1L1OC 3CD61 3GTQI 1W2BZ 1NUIA 4XX2A 2JNYA 3CC4Z 4A3KI 2KI7B 3PO3S 1Q822 4A3CI 1KC82 1W2BY 2AKLA 2JUBA 2VUMI 2P28A 1S7MA 1Q811 4QTUA 4BBSI 1VQN1 3GTLI 1P9NA 2JIOA 1SFOI 3OW2Y 1DL6A 4BBRI 4DK1A 3JAMf 4A3EI 1JWHC 3HOZI 3J81f 1S721 1N8R2 1TWFI 5LL6f 1FDIA 1X0TA 3CCE1 1K83I 2NVTI 2V3VA 1YJWZ 3MZLB 3CCLZ 4A93I 2EGTA 2JIRA 5AN9F 4RVFA 2E2HI 2VUGA 1USPB 2JMOA 4E30A 1TFIA 1VLAA 1NJI1 1M902 3CCMZ 3CCUZ 4E2ZA 1K9M1 2VPWA 5D1PA 3CCQ1 2JA7I 3CMAZ 2V8JA 1VQ81 4E2XA 5IT9f 4X6AI 3BG1B 1VQMZ 3P5JB 2RBLA 4MH4A 2QRDB 3KIHA 1YJ9Z 3PO3I 1YIJZ 1KD11 1Q812 2QEX1 1YJN1 3CQZI 1VQ5Z 4RS4A 2QR1B 4NB8A 3IX0A 1VQPZ 3CC21 2P3YA 1QXFA 2OTJZ 2W03A 5CM2M 2IZ4A 2JA8I 2E9HA 3G4S1 3GTKI 2G2KA 1Z02A 4NBDA 2K5RA 3CPWZ 3LUSA 2IZ3A 3NH8A 3U50C 5C3EI 1SIWA 2J6AA 2OOYB 3CCV1 1QVFZ 3HOYI 2O4HA 4NBCA 3NDIA 1VQKZ 4MRIA 1WCMI 1VQ61 2JS4A 1YIT1 3CCJ1 1KQSZ 1QVFY 1NJI2 1VQ91 1VQL1 4DQYB 3CD6Z 4BXXI 3FKII 3IF8A 4MD9A 5FLMI 2PK7A 2YADA 3M3YI 3CCS1 3MZKB 2QA41 2GU2A 1K8A1 1K9M2 3ESWA 1KQSY 2V45A 1TWHI 3GCFA 2V8IA 3CC71 1N2FA 3CME1 4HGYA 4MXUA 2JIMA 3H3VJ 2LEXA 3QWUA 3I07A 1VQNZ 3S17I 1ML8A 3J80b 4NB9A 1YI21 2M48A 2VPYA 2JR6A 3MONA 3CXCZ 1YHQ1 3CCRZ 1KD12 2OZKA 1VQ71 1LQLA 4AYBA 4A3MI 5IP9I 1S72Z 3G711 3VTNA 3T4NB 2GTHA 3D2LA 3CCEZ 4MD7A
chains in the Genus database with same CATH topology
1VQ4Z 1TWGI 5D1OA 4RVGA 1RO0A 3H0GI 1M1K1 3HOWI 1RLYA 1Q7Y1 1KRLA 3VMGA 2OOXB 2OTL1 1I6HI 2NVXI 2RPRA 2O53A 4A3FI 1RO2A 3CCQZ 4NBGA 5C4XI 2RIQA 4E31A 2F4MA 4EWCA 1VQO1 3S2DI 1VQ8Z 1X3WA 3Q87A 1YUAA 2Q4ZA 3D9XA 3VB9A 4A3LI 1K8A2 2DE6A 3HKZA 1QF8A 2R7ZI 1ZB8A 1X3ZA 3NDJA 4NBBA 3EERA 4RV9A 3I561 5FLXb 1TWCI 1VQ51 2WAQA 1RO4A 1YJNZ 3FQMA 2HF1A 4E33A 2BJOA 5C44I 4RVHA 4NFRA 3CC2Z 3HOUI 3GTOI 3RZOI 2JA5I 2JA6I 3I4MI 3G4SZ 3FQQA 1WW9A 1JJ2Z 3I551 3CPWY 4HH4A 3J80f 2WB1A 3RZDI 3G6E1 3S16I 4E2WA 1M901 1I3QI 1JJ2Y 3CC41 3F3FC 3F3PC 1Q861 3CCVZ 2B63I 2H85A 4QTTA 1VQ6Z 1M1K2 2E2II 5T6BA 4NH1C 4A3DI 2VF1A 4MD8A 1YITZ 3CCJZ 2QRCB 1Q7Y2 5D1OB 2NVYI 1NP6A 1YUKA 1VQ9Z 1VQLZ 5T64A 2W04A 3CCSZ 4E2YA 2QA4Z 3NH5A 4NOZA 2GTIA 2NVQI 5A2Qb 2QKDA 1I50I 3S2HI 4RVDA 1TWAI 2DE7A 1RQFA 3CC7Z 4A3JI 3CMEZ 3OW2Z 1ZH1A 5T67A 1Z03A 3GTMS 1ZB9A 4MONA 3CCR1 1YI2Z 3CXCY 2HU9A 2F4OA 1YHQZ 2R92I 1YJW1 1K731 4CL1A 3NFZA 1Y1WI 3CCL1 3J7A4 1VQ7Z 1RNIA 3GTJI 3EEDA 2I3CA 5IP7I 3G71Z 3KIFA 1VQ41 3S1QI 1Y1VI 2LFUA 3GTGI 5FLXf 3CCM1 4Y52I 3CCU1 2R93I 3S1MI 2RHBA 4E32A 4A3BI 2Y0SA 3HOXI 3I4NI 1Q821 3CMA1 4DGLA 2ZAEB 1KC81 1QYPA 2OTLZ 2PM9A 4TNUA 3JAMb 1Q862 3S14I 3S1RI 3TE5B 4S1TA 3PO2I 1VQM1 3TDHB 3J81b 3NH4A 1QVGZ 4NBFA 1YJ91 2E2JI 4A3II 1YIJ1 2DE5A 1VQOZ 2RT9A 4Y7NI 2QLVB 2V8KA 1QVGY 3S15I 4A3GI 2QEXZ 3M4OI 3GKQA 4NBEA 1VQP1 2Q51A 2K3RA 1N8R1 1Y1VS 3IFUA 2OTJ1 3I56Z 3S1NI 1Z01A 1USPA 3VMHA 1R9TI 5C4JI 2QREB 1PFTA 2KPIA 4NBAA 2R6MA 4NBHA 2LIYA 3K7AI 3BG0B 5A2Qf 3GTMI 1WIIA 3HOVI 5IT9b 1K732 3VMIA 1VQK1 4BY1I 2PMZA 3D6WA 4HGZA 3I55Z 3GTPI 2M6NA 4BY7I 2YU9I 3G6EZ 1L1OC 3CD61 3GTQI 1W2BZ 1NUIA 4XX2A 2JNYA 3CC4Z 4A3KI 2KI7B 3PO3S 1Q822 4A3CI 1KC82 1W2BY 2AKLA 2JUBA 2VUMI 2P28A 1S7MA 1Q811 4QTUA 4BBSI 1VQN1 3GTLI 1P9NA 1SFOI 3OW2Y 1DL6A 4BBRI 4DK1A 3JAMf 4A3EI 1JWHC 3HOZI 3J81f 1S721 1N8R2 1TWFI 5LL6f 1X0TA 3CCE1 1K83I 2NVTI 1YJWZ 3MZLB 3CCLZ 4A93I 2EGTA 5AN9F 4RVFA 2E2HI 2VUGA 1USPB 2JMOA 4E30A 1TFIA 1VLAA 1NJI1 1M902 3CCMZ 3CCUZ 4E2ZA 1K9M1 5D1PA 3CCQ1 2JA7I 3CMAZ 2V8JA 1VQ81 4E2XA 5IT9f 4X6AI 3BG1B 1VQMZ 3P5JB 2RBLA 4MH4A 2QRDB 3KIHA 1YJ9Z 3PO3I 1YIJZ 1KD11 1Q812 2QEX1 1YJN1 3CQZI 1VQ5Z 4RS4A 2QR1B 4NB8A 3IX0A 1VQPZ 3CC21 2P3YA 2OTJZ 2W03A 5CM2M 2IZ4A 2JA8I 2E9HA 3G4S1 3GTKI 2G2KA 1Z02A 4NBDA 2K5RA 3CPWZ 3LUSA 2IZ3A 3NH8A 3U50C 5C3EI 2J6AA 2OOYB 3CCV1 1QVFZ 3HOYI 2O4HA 4NBCA 3NDIA 1VQKZ 4MRIA 1WCMI 1VQ61 2JS4A 1YIT1 3CCJ1 1KQSZ 1QVFY 1NJI2 1VQ91 1VQL1 4DQYB 3CD6Z 4BXXI 3FKII 3IF8A 4MD9A 5FLMI 2PK7A 2YADA 3M3YI 3CCS1 3MZKB 2GU2A 2QA41 1K8A1 1K9M2 3ESWA 1KQSY 1TWHI 3GCFA 2V8IA 3CC71 1N2FA 3CME1 4HGYA 4MXUA 3H3VJ 3QWUA 3I07A 1VQNZ 3S17I 1ML8A 3J80b 4NB9A 1YI21 2M48A 2JR6A 3MONA 3CXCZ 1YHQ1 3CCRZ 1KD12 2OZKA 1VQ71 1LQLA 4AYBA 4A3MI 5IP9I 1S72Z 3G711 3VTNA 3T4NB 2GTHA 3CCEZ 4MD7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ4 Z;  1VQK 1;  1YJ9 Z;  1YIJ Z;  3CC7 Z;  3I55 Z;  1KD1 1;  1M1K 1;  3CME Z;  1Q81 2;  3OW2 Z;  2QEX 1;  1YJN 1;  1VQ5 Z;  1Q7Y 1;  2OTL 1;  3G6E Z;  3CD6 1;  1W2B Z;  1VQP Z;  3CCR 1;  3CC4 Z;  1YI2 Z;  3CXC Y;  3CC2 1;  1YHQ Z;  2OTJ Z;  1Q82 2;  1YJW 1;  1K73 1;  3CCQ Z;  1KC8 2;  3G4S 1;  1W2B Y;  3CCL 1;  1VQO 1;  1VQ7 Z;  1VQ8 Z;  3CPW Z;  1Q81 1;  3G71 Z;  1VQN 1;  1VQ4 1;  1K8A 2;  3CCV 1;  3CCM 1;  3CCU 1;  1QVF Z;  1VQK Z;  3I56 1;  1VQ6 1;  1VQ5 1;  3OW2 Y;  1YIT 1;  3CCJ 1;  1Q82 1;  3CMA 1;  1YJN Z;  1KC8 1;  1KQS Z;  1QVF Y;  1NJI 2;  1VQ9 1;  1VQL 1;  1S72 1;  2OTL Z;  3CD6 Z;  1Q86 2;  1N8R 2;  3CCS 1;  1VQM 1;  2QA4 1;  1K8A 1;  3CC2 Z;  3CCE 1;  1K9M 2;  1QVG Z;  1KQS Y;  1YJW Z;  1YJ9 1;  3G4S Z;  1JJ2 Z;  1YIJ 1;  3CC7 1;  3CCL Z;  3I55 1;  3CPW Y;  1VQO Z;  3CME 1;  1QVG Y;  3G6E 1;  1VQN Z;  2QEX Z;  1M90 1;  1NJI 1;  1JJ2 Y;  1VQP 1;  1M90 2;  3CC4 1;  1Q86 1;  1N8R 1;  3CCV Z;  1YI2 1;  3CCM Z;  3CCU Z;  3CXC Z;  1YHQ 1;  2OTJ 1;  3I56 Z;  3CCR Z;  1KD1 2;  1K9M 1;  1M1K 2;  1VQ6 Z;  3CCQ 1;  1YIT Z;  3CCJ Z;  1Q7Y 2;  3CMA Z;  1VQ7 1;  1VQ8 1;  1VQ9 Z;  1VQL Z;  1S72 Z;  3G71 1;  3CCS Z;  1VQM Z;  2QA4 Z;  3CCE Z;  1K73 2; 
#chains in the Genus database with same CATH topology
 1VQ4 Z;  1TWG I;  5D1O A;  4RVG A;  1RO0 A;  3H0G I;  1M1K 1;  3HOW I;  1RLY A;  1Q7Y 1;  1KRL A;  3VMG A;  1WJ2 A;  2OOX B;  1AA6 A;  2OTL 1;  1I6H I;  2NVX I;  2RPR A;  2O53 A;  4A3F I;  1RO2 A;  3CCQ Z;  4NBG A;  5C4X I;  2RIQ A;  4E31 A;  2F4M A;  4EWC A;  1VQO 1;  3S2D I;  1Y8C A;  1VQ8 Z;  1X3W A;  3Q87 A;  1YUA A;  2Q4Z A;  3D9X A;  3IR7 A;  3VB9 A;  4A3L I;  1K8A 2;  2DE6 A;  3HKZ A;  1QF8 A;  2R7Z I;  1ZB8 A;  1X3Z A;  3NDJ A;  4NBB A;  3EER A;  4RV9 A;  3I56 1;  5FLX b;  1TWC I;  1VQ5 1;  2WAQ A;  1RO4 A;  1YJN Z;  3FQM A;  2HF1 A;  4E33 A;  2BJO A;  5C44 I;  4RVH A;  4NFR A;  3CC2 Z;  3HOU I;  3GTO I;  3RZO I;  2JIP A;  2JA5 I;  2JA6 I;  3I4M I;  3G4S Z;  1WZN A;  3FQQ A;  1WW9 A;  1JJ2 Z;  3I55 1;  3CPW Y;  4HH4 A;  3J80 f;  2WB1 A;  3RZD I;  3G6E 1;  3S16 I;  4E2W A;  1M90 1;  1I3Q I;  1JJ2 Y;  3CC4 1;  3F3F C;  3F3P C;  1Q86 1;  3CCV Z;  2E7Z A;  2B63 I;  2H85 A;  4QTT A;  1VQ6 Z;  1M1K 2;  2E2I I;  5T6B A;  4NH1 C;  4A3D I;  2VF1 A;  4MD8 A;  1FDO A;  3CCJ Z;  1YIT Z;  2QRC B;  1Q7Y 2;  5D1O B;  2NVY I;  2AYD A;  1NP6 A;  1YUK A;  1VQ9 Z;  1VQL Z;  5T64 A;  2IV2 X;  2W04 A;  3CCS Z;  4E2Y A;  2QA4 Z;  3NH5 A;  4NOZ A;  2GTI A;  2NVQ I;  5A2Q b;  2QKD A;  1I50 I;  3S2H I;  4RVD A;  1TWA I;  2DE7 A;  1RQF A;  3CC7 Z;  2NAP A;  4A3J I;  3CME Z;  3OW2 Z;  1ZH1 A;  5T67 A;  1Z03 A;  3GTM S;  1ZB9 A;  4MON A;  3CCR 1;  1YI2 Z;  3CXC Y;  2HU9 A;  2F4O A;  1YHQ Z;  2R92 I;  1YJW 1;  1K73 1;  4CL1 A;  3NFZ A;  1Y1W I;  3CCL 1;  3J7A 4;  1VQ7 Z;  1RNI A;  2VPZ A;  3GTJ I;  3EED A;  2I3C A;  5IP7 I;  3G71 Z;  3KIF A;  1VQ4 1;  3S1Q I;  1Y1V I;  2LFU A;  3GTG I;  5FLX f;  3CCM 1;  4Y52 I;  3CCU 1;  2R93 I;  3S1M I;  2RHB A;  4E32 A;  4A3B I;  2Y0S A;  3HOX I;  3I4N I;  1Q82 1;  3CMA 1;  4DGL A;  2ZAE B;  1KC8 1;  1QYP A;  2OTL Z;  2PM9 A;  4TNU A;  3JAM b;  1Q86 2;  3S14 I;  3S1R I;  3TE5 B;  4S1T A;  3PO2 I;  1VQM 1;  3TDH B;  3J81 b;  3NH4 A;  1QVG Z;  4NBF A;  2JIQ A;  1YJ9 1;  2E2J I;  4A3I I;  1YIJ 1;  2DE5 A;  1VQO Z;  2RT9 A;  4Y7N I;  2QLV B;  2V8K A;  1QVG Y;  3S15 I;  4A3G I;  2QEX Z;  3M4O I;  3GKQ A;  4NBE A;  1VQP 1;  2Q51 A;  2K3R A;  1N8R 1;  1Y1V S;  3IFU A;  2OTJ 1;  3I56 Z;  3S1N I;  1Z01 A;  1Q16 A;  1USP A;  3VMH A;  1R9T I;  5C4J I;  2QRE B;  1PFT A;  2KPI A;  4NBA A;  2R6M A;  4NBH A;  2LIY A;  3K7A I;  3BG0 B;  5A2Q f;  3GTM I;  1WII A;  2VPX A;  3HOV I;  5IT9 b;  1K73 2;  3VMI A;  1VQK 1;  4BY1 I;  2PMZ A;  3D6W A;  4HGZ A;  3I55 Z;  3GTP I;  2M6N A;  4BY7 I;  2YU9 I;  3G6E Z;  1L1O C;  3CD6 1;  3GTQ I;  1W2B Z;  1NUI A;  4XX2 A;  2JNY A;  3CC4 Z;  4A3K I;  2KI7 B;  3PO3 S;  1Q82 2;  4A3C I;  1KC8 2;  1W2B Y;  2AKL A;  2JUB A;  2VUM I;  2P28 A;  1S7M A;  1Q81 1;  4QTU A;  4BBS I;  1VQN 1;  3GTL I;  1P9N A;  2JIO A;  1SFO I;  3OW2 Y;  1DL6 A;  4BBR I;  4DK1 A;  3JAM f;  4A3E I;  1JWH C;  3HOZ I;  3J81 f;  1S72 1;  1N8R 2;  1TWF I;  5LL6 f;  1FDI A;  1X0T A;  3CCE 1;  1K83 I;  2NVT I;  2V3V A;  1YJW Z;  3MZL B;  3CCL Z;  4A93 I;  2EGT A;  2JIR A;  5AN9 F;  4RVF A;  2E2H I;  2VUG A;  1USP B;  2JMO A;  4E30 A;  1TFI A;  1VLA A;  1NJI 1;  1M90 2;  3CCM Z;  3CCU Z;  4E2Z A;  1K9M 1;  2VPW A;  5D1P A;  3CCQ 1;  2JA7 I;  3CMA Z;  2V8J A;  1VQ8 1;  4E2X A;  5IT9 f;  4X6A I;  3BG1 B;  1VQM Z;  3P5J B;  2RBL A;  4MH4 A;  2QRD B;  3KIH A;  1YJ9 Z;  3PO3 I;  1YIJ Z;  1KD1 1;  1Q81 2;  2QEX 1;  1YJN 1;  3CQZ I;  1VQ5 Z;  4RS4 A;  2QR1 B;  4NB8 A;  3IX0 A;  1VQP Z;  3CC2 1;  2P3Y A;  1QXF A;  2OTJ Z;  2W03 A;  5CM2 M;  2IZ4 A;  2JA8 I;  2E9H A;  3G4S 1;  3GTK I;  2G2K A;  1Z02 A;  4NBD A;  2K5R A;  3CPW Z;  3LUS A;  2IZ3 A;  3NH8 A;  3U50 C;  5C3E I;  1SIW A;  2J6A A;  2OOY B;  3CCV 1;  1QVF Z;  3HOY I;  2O4H A;  4NBC A;  3NDI A;  1VQK Z;  4MRI A;  1WCM I;  1VQ6 1;  2JS4 A;  1YIT 1;  3CCJ 1;  1KQS Z;  1QVF Y;  1NJI 2;  1VQ9 1;  1VQL 1;  4DQY B;  3CD6 Z;  4BXX I;  3FKI I;  3IF8 A;  4MD9 A;  5FLM I;  2PK7 A;  2YAD A;  3M3Y I;  3CCS 1;  3MZK B;  2QA4 1;  2GU2 A;  1K8A 1;  1K9M 2;  3ESW A;  1KQS Y;  2V45 A;  1TWH I;  3GCF A;  2V8I A;  3CC7 1;  1N2F A;  3CME 1;  4HGY A;  4MXU A;  2JIM A;  3H3V J;  2LEX A;  3QWU A;  3I07 A;  1VQN Z;  3S17 I;  1ML8 A;  3J80 b;  4NB9 A;  1YI2 1;  2M48 A;  2VPY A;  2JR6 A;  3MON A;  3CXC Z;  1YHQ 1;  3CCR Z;  1KD1 2;  2OZK A;  1VQ7 1;  1LQL A;  4AYB A;  4A3M I;  5IP9 I;  1S72 Z;  3G71 1;  3VTN A;  3T4N B;  2GTH A;  3D2L A;  3CCE Z;  4MD7 A; 
#chains in the Genus database with same CATH homology
 1VQ4 Z;  1TWG I;  5D1O A;  4RVG A;  1RO0 A;  3H0G I;  1M1K 1;  3HOW I;  1RLY A;  1Q7Y 1;  1KRL A;  3VMG A;  2OOX B;  2OTL 1;  1I6H I;  2NVX I;  2RPR A;  2O53 A;  4A3F I;  1RO2 A;  3CCQ Z;  4NBG A;  5C4X I;  2RIQ A;  4E31 A;  2F4M A;  4EWC A;  1VQO 1;  3S2D I;  1VQ8 Z;  1X3W A;  3Q87 A;  1YUA A;  2Q4Z A;  3D9X A;  3VB9 A;  4A3L I;  1K8A 2;  2DE6 A;  3HKZ A;  1QF8 A;  2R7Z I;  1ZB8 A;  1X3Z A;  3NDJ A;  4NBB A;  3EER A;  4RV9 A;  3I56 1;  5FLX b;  1TWC I;  1VQ5 1;  2WAQ A;  1RO4 A;  1YJN Z;  3FQM A;  2HF1 A;  4E33 A;  2BJO A;  5C44 I;  4RVH A;  4NFR A;  3CC2 Z;  3HOU I;  3GTO I;  3RZO I;  2JA5 I;  2JA6 I;  3I4M I;  3G4S Z;  3FQQ A;  1WW9 A;  1JJ2 Z;  3I55 1;  3CPW Y;  4HH4 A;  3J80 f;  2WB1 A;  3RZD I;  3G6E 1;  3S16 I;  4E2W A;  1M90 1;  1I3Q I;  1JJ2 Y;  3CC4 1;  3F3F C;  3F3P C;  1Q86 1;  3CCV Z;  2B63 I;  2H85 A;  4QTT A;  1VQ6 Z;  1M1K 2;  2E2I I;  5T6B A;  4NH1 C;  4A3D I;  2VF1 A;  4MD8 A;  1YIT Z;  3CCJ Z;  2QRC B;  1Q7Y 2;  5D1O B;  2NVY I;  1NP6 A;  1YUK A;  1VQ9 Z;  1VQL Z;  5T64 A;  2W04 A;  3CCS Z;  4E2Y A;  2QA4 Z;  3NH5 A;  4NOZ A;  2GTI A;  2NVQ I;  5A2Q b;  2QKD A;  1I50 I;  3S2H I;  4RVD A;  1TWA I;  2DE7 A;  1RQF A;  3CC7 Z;  4A3J I;  3CME Z;  3OW2 Z;  1ZH1 A;  5T67 A;  1Z03 A;  3GTM S;  1ZB9 A;  4MON A;  3CCR 1;  1YI2 Z;  3CXC Y;  2HU9 A;  2F4O A;  1YHQ Z;  2R92 I;  1YJW 1;  1K73 1;  4CL1 A;  3NFZ A;  1Y1W I;  3CCL 1;  3J7A 4;  1VQ7 Z;  1RNI A;  3GTJ I;  3EED A;  2I3C A;  5IP7 I;  3G71 Z;  3KIF A;  1VQ4 1;  3S1Q I;  1Y1V I;  2LFU A;  3GTG I;  5FLX f;  3CCM 1;  4Y52 I;  3CCU 1;  2R93 I;  3S1M I;  2RHB A;  4E32 A;  4A3B I;  2Y0S A;  3HOX I;  3I4N I;  1Q82 1;  3CMA 1;  4DGL A;  2ZAE B;  1KC8 1;  1QYP A;  2OTL Z;  2PM9 A;  4TNU A;  3JAM b;  1Q86 2;  3S14 I;  3S1R I;  3TE5 B;  4S1T A;  3PO2 I;  1VQM 1;  3TDH B;  3J81 b;  3NH4 A;  1QVG Z;  4NBF A;  1YJ9 1;  2E2J I;  4A3I I;  1YIJ 1;  2DE5 A;  1VQO Z;  2RT9 A;  4Y7N I;  2QLV B;  2V8K A;  1QVG Y;  3S15 I;  4A3G I;  2QEX Z;  3M4O I;  3GKQ A;  4NBE A;  1VQP 1;  2Q51 A;  2K3R A;  1N8R 1;  1Y1V S;  3IFU A;  2OTJ 1;  3I56 Z;  3S1N I;  1Z01 A;  1USP A;  3VMH A;  1R9T I;  5C4J I;  2QRE B;  1PFT A;  2KPI A;  4NBA A;  2R6M A;  4NBH A;  2LIY A;  3K7A I;  3BG0 B;  5A2Q f;  3GTM I;  1WII A;  3HOV I;  5IT9 b;  1K73 2;  3VMI A;  1VQK 1;  4BY1 I;  2PMZ A;  3D6W A;  4HGZ A;  3I55 Z;  3GTP I;  2M6N A;  4BY7 I;  2YU9 I;  3G6E Z;  1L1O C;  3CD6 1;  3GTQ I;  1W2B Z;  1NUI A;  4XX2 A;  2JNY A;  3CC4 Z;  4A3K I;  2KI7 B;  3PO3 S;  1Q82 2;  4A3C I;  1KC8 2;  1W2B Y;  2AKL A;  2JUB A;  2VUM I;  2P28 A;  1S7M A;  1Q81 1;  4QTU A;  4BBS I;  1VQN 1;  3GTL I;  1P9N A;  1SFO I;  3OW2 Y;  1DL6 A;  4BBR I;  4DK1 A;  3JAM f;  4A3E I;  1JWH C;  3HOZ I;  3J81 f;  1S72 1;  1N8R 2;  1TWF I;  5LL6 f;  1X0T A;  3CCE 1;  1K83 I;  2NVT I;  1YJW Z;  3MZL B;  3CCL Z;  4A93 I;  2EGT A;  5AN9 F;  4RVF A;  2E2H I;  2VUG A;  1USP B;  2JMO A;  4E30 A;  1TFI A;  1VLA A;  1NJI 1;  1M90 2;  3CCM Z;  3CCU Z;  4E2Z A;  1K9M 1;  5D1P A;  3CCQ 1;  2JA7 I;  3CMA Z;  2V8J A;  1VQ8 1;  4E2X A;  5IT9 f;  4X6A I;  3BG1 B;  1VQM Z;  3P5J B;  2RBL A;  4MH4 A;  2QRD B;  3KIH A;  1YJ9 Z;  3PO3 I;  1YIJ Z;  1KD1 1;  1Q81 2;  2QEX 1;  1YJN 1;  3CQZ I;  1VQ5 Z;  4RS4 A;  2QR1 B;  4NB8 A;  3IX0 A;  1VQP Z;  3CC2 1;  2P3Y A;  2OTJ Z;  2W03 A;  5CM2 M;  2IZ4 A;  2JA8 I;  2E9H A;  3G4S 1;  3GTK I;  2G2K A;  1Z02 A;  4NBD A;  2K5R A;  3CPW Z;  3LUS A;  2IZ3 A;  3NH8 A;  3U50 C;  5C3E I;  2J6A A;  2OOY B;  3CCV 1;  1QVF Z;  3HOY I;  2O4H A;  4NBC A;  3NDI A;  1VQK Z;  4MRI A;  1WCM I;  1VQ6 1;  2JS4 A;  1YIT 1;  3CCJ 1;  1KQS Z;  1QVF Y;  1NJI 2;  1VQ9 1;  1VQL 1;  4DQY B;  3CD6 Z;  4BXX I;  3FKI I;  3IF8 A;  4MD9 A;  5FLM I;  2PK7 A;  2YAD A;  3M3Y I;  3CCS 1;  3MZK B;  2GU2 A;  2QA4 1;  1K8A 1;  1K9M 2;  3ESW A;  1KQS Y;  1TWH I;  3GCF A;  2V8I A;  3CC7 1;  1N2F A;  3CME 1;  4HGY A;  4MXU A;  3H3V J;  3QWU A;  3I07 A;  1VQN Z;  3S17 I;  1ML8 A;  3J80 b;  4NB9 A;  1YI2 1;  2M48 A;  2JR6 A;  3MON A;  3CXC Z;  1YHQ 1;  3CCR Z;  1KD1 2;  2OZK A;  1VQ7 1;  1LQL A;  4AYB A;  4A3M I;  5IP9 I;  1S72 Z;  3G71 1;  3VTN A;  3T4N B;  2GTH A;  3CCE Z;  4MD7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...