1W2BY

Trigger factor ribosome binding domain in complex with 50s
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
73
structure length
73
Chain Sequence
b'RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Trigger Factor in Complex with the Ribosome Forms a Molecular Cradle for Nascent Proteins
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 11
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1w2bY00
1YJN1 1VQM1 1YI21 1VQ9Z 1VQ51 1Q812 1M1K2 1K9M2 3I551 3CCEZ 3CCQ1 2QA41 1VQPZ 1K731 1Q862 1W2BZ 3CXCY 1YIT1 3CMEZ 1Q811 3CCVZ 1KQSY 3CD61 1QVFY 3CXCZ 1Q861 3CCUZ 3I56Z 1S72Z 1YJWZ 1K732 1VQ91 3G6EZ 1QVGZ 1QVFZ 1VQKZ 1VQP1 1N8R1 3G4SZ 1YJ9Z 2QEXZ 1Q822 2OTLZ 3CC2Z 3CC71 3CCL1 1YIJZ 1KD11 1VQ4Z 3CME1 3CCV1 1VQOZ 1Q821 1N8R2 1S721 1YJW1 3CCJZ 3G6E1 1KC81 3CCRZ 1VQLZ 1YJNZ 1VQMZ 1KQSZ 1VQK1 1VQ7Z 1K8A2 1KD12 1YJ91 3G71Z 2QEX1 3OW2Y 3CCE1 3CCMZ 1Q7Y1 2OTL1 2QA4Z 1VQ8Z 2OTJZ 1YIJ1 1VQ41 3CC4Z 1NJI1 3CPWY 1YHQZ 3OW2Z 1M901 1K8A1 1KC82 1VQ6Z 1VQO1 3CMAZ 3CCJ1 3CPWZ 3CD6Z 3CCU1 3I561 1Q7Y2 1VQNZ 3CCSZ 3CCR1 1VQL1 1JJ2Y 1VQ71 1NJI2 1W2BY 3G711 1YI2Z 1M902 3CCM1 1VQ5Z 3G4S1 1JJ2Z 1VQ81 2OTJ1 3I55Z 3CC41 3CC21 3CCQZ 1YHQ1 3CC7Z 1VQ61 3CCLZ 1M1K1 3CMA1 1YITZ 1K9M1 1QVGY 1VQN1 3CCS1
chains in the Genus database with same CATH superfamily
1QF8A 2VUGA 1P9NA 2OOXB 1VQ51 1ML8A 1Q812 3CQZI 1M1K2 2QLVB 1YUKA 1VQPZ 2W03A 5AN9F 2V8JA 3TE5B 1KRLA 1TWAI 2NVQI 3GTMI 3S14I 3D2LA 1Q811 2QREB 1AA6A 1KQSY 3CD61 3VTNA 3CCUZ 1Z03A 1QVGZ 3F3FC 2Q4ZA 1VQP1 2E9HA 4NBHA 5A2Qb 2QEXZ 1Q822 3GTJI 1TWCI 2OTLZ 3HKZA 3PO2I 3CCL1 3ESWA 1VQ4Z 1RO4A 5IT9f 4RVHA 1USPB 4MXUA 3IF8A 4A3LI 1Q821 2ZAEB 2AYDA 2JUBA 5FLXf 5C4JI 3CCRZ 2R93I 1YJNZ 2DE5A 4NBBA 2P28A 3P5JB 1VQMZ 4MONA 3G71Z 4BBRI 2QEX1 4MH4A 3MZKB 2OTL1 3GTPI 2VPWA 2R6MA 2IZ4A 1VQ8Z 1VQ41 4CL1A 3GTKI 3CPWY 3I4NI 3HOXI 1KC82 3NH5A 2V3VA 3S1NI 1L1OC 2JR6A 5CM2M 3I561 1Q7Y2 1VQNZ 3CCSZ 3CCR1 2V8IA 4NBEA 1NJI2 5C44I 2G2KA 3G711 2B63I 2QRDB 1X3ZA 2IZ3A 3G4S1 1VQ81 2O4HA 2QR1B 3I55Z 3CC21 3CCQZ 3J81b 3S2HI 3PO3I 3T4NB 3CC7Z 1NP6A 1WW9A 3VB9A 3GTLI 1NUIA 1TFIA 3BG0B 5C3EI 1VQN1 3CCS1 4E31A 2QKDA 3NDJA 2JS4A 5C4XI 4A93I 5IT9b 5D1PA 3NDIA 4MRIA 3I551 4A3MI 3CCEZ 3CCQ1 4QTUA 2PK7A 2BJOA 2YADA 1Q862 2WB1A 1W2BZ 1I50I 3CXCY 2YU9I 4Y52I 1Y8CA 2K3RA 2Y0SA 5FLXb 2E2JI 2AKLA 3MZLB 1Q861 5T64A 1WCMI 2I3CA 5D1OA 5T67A 4NB8A 1N8R1 2JA6I 3U50C 3RZDI 2E2II 5T6BA 4E33A 4X6AI 3J7A4 2DE7A 2NVXI 4MD7A 4QTTA 4A3FI 3CCJZ 1RO2A 2R7ZI 3JAMb 2E7ZA 3J80f 1ZH1A 3VMHA 1QXFA 1X3WA 1R9TI 3OW2Y 2OZKA 4NB9A 1RLYA 3S17I 2QA4Z 3HOWI 2OTJZ 2EGTA 2GTHA 3GCFA 1M901 3HOVI 4RVFA 2HF1A 2JIMA 1VQ6Z 4NBDA 3BG1B 4A3DI 5FLMI 2JMOA 3CCJ1 3CPWZ 3CCU1 3GTQI 1ZB8A 2H85A 1SIWA 1JJ2Y 4HH4A 4BY7I 1YI2Z 3VMIA 3EEDA 2NAPA 4NBGA 2K5RA 2OTJ1 3FQMA 3HOUI 3FQQA 3S16I 2E2HI 4RV9A 1PFTA 3Q87A 1VQ61 3GTGI 1K9M1 2WAQA 1QVGY 1Z02A 4A3CI 4HGYA 2J6AA 2LIYA 2M48A 3MONA 1YJN1 1VQM1 1YI21 1VQ9Z 2VPZA 4E32A 2DE6A 1K731 2RPRA 4E2ZA 4NH1C 4Y7NI 3CMEZ 3CCVZ 1TWHI 5LL6f 1QVFY 3CXCZ 4NOZA 3S1RI 2KPIA 2JIQA 1S72Z 1DL6A 1YJWZ 4NBFA 1VQ91 3IFUA 2NVTI 3KIFA 2GU2A 2R92I 3GTMS 4DK1A 4E2WA 1TWGI 1YJ9Z 1I6HI 1FDOA 1WIIA 3I07A 3CC71 3F3PC 3S2DI 2QRCB 1YIJZ 1KD11 2RHBA 3CME1 3RZOI 3CCV1 5A2Qf 1VQOZ 2JA5I 1N8R2 1S721 1YJW1 1KQSZ 1LQLA 1K8A2 3FKII 2M6NA 1YJ91 2KI7B 2HU9A 3CCE1 1YIJ1 3I4MI 3CC4Z 4A3KI 1YHQZ 3OW2Z 4E30A 3M4OI 1K8A1 4EWCA 1VQO1 2RIQA 4NBCA 3CMAZ 3M3YI 4DGLA 2JIOA 2VPXA 3CD6Z 1Y1VS 2JIRA 2NVYI 1USPA 4RVDA 1W2BY 1M902 2F4MA 2GTIA 4BBSI 1I3QI 3NH8A 1JJ2Z 3VMGA 3CC41 4S1TA 1YHQ1 1ZB9A 3D6WA 3CCLZ 3K7AI 3TDHB 1M1K1 3CMA1 1YITZ 3D9XA 4AYBA 3J81f 1VLAA 5D1OB 2P3YA 1N2FA 2LFUA 1JWHC 3IX0A 3PO3S 2VF1A 2V45A 1K9M2 4HGZA 1TWFI 4NFRA 2QA41 2JIPA 2PMZA 4RVGA 1YIT1 4A3JI 4XX2A 1Q16A 3I56Z 1YUAA 2W04A 1K732 3G6EZ 1QVFZ 1S7MA 3HOZI 3IR7A 1Y1VI 1VQKZ 4DQYB 3G4SZ 4A3GI 4A3BI 1QYPA 3EERA 3GKQA 1RQFA 3CC2Z 2JNYA 3LUSA 4BY1I 3S15I 4TNUA 4E2XA 3J80b 2JA7I 2OOYB 3G6E1 1KC81 4MD9A 1VQLZ 3KIHA 1VQK1 1VQ7Z 1KD12 2V8KA 1Z01A 3CCMZ 1Q7Y1 2RT9A 2O53A 3S1QI 3JAMf 2VPYA 4MD8A 1X0TA 1NJI1 3H3VJ 4BXXI 3HOYI 1RO0A 2JA8I 1FDIA 3NFZA 2LEXA 3QWUA 3NH4A 2Q51A 1VQL1 1WJ2A 1VQ71 4RS4A 3CCM1 2IV2X 1VQ5Z 2RBLA 2F4OA 4A3II 5IP7I 5IP9I 4NBAA 4A3EI 3GTOI 2VUMI 1Y1WI 1RNIA 1K83I 1WZNA 2PM9A 3H0GI 3S1MI 1SFOI 4E2YA
chains in the Genus database with same CATH topology
1QF8A 2VUGA 1P9NA 2OOXB 1VQ51 1ML8A 1Q812 3CQZI 1M1K2 2QLVB 1YUKA 1VQPZ 2W03A 5AN9F 2V8JA 3TE5B 1KRLA 1TWAI 2NVQI 3GTMI 3S14I 1Q811 2QREB 1KQSY 3CD61 3VTNA 3CCUZ 1Z03A 1QVGZ 3F3FC 2Q4ZA 1VQP1 2E9HA 4NBHA 5A2Qb 2QEXZ 1Q822 3GTJI 1TWCI 2OTLZ 3HKZA 3PO2I 3CCL1 3ESWA 1VQ4Z 1RO4A 5IT9f 4RVHA 1USPB 4MXUA 3IF8A 4A3LI 1Q821 2ZAEB 2JUBA 5FLXf 5C4JI 3CCRZ 2R93I 1YJNZ 2DE5A 4NBBA 2P28A 3P5JB 1VQMZ 4MONA 3G71Z 4BBRI 2QEX1 4MH4A 3MZKB 2OTL1 3GTPI 2R6MA 2IZ4A 1VQ8Z 1VQ41 4CL1A 3GTKI 3CPWY 3I4NI 3HOXI 1KC82 3NH5A 3S1NI 1L1OC 2JR6A 5CM2M 3I561 1Q7Y2 1VQNZ 3CCSZ 3CCR1 2V8IA 4NBEA 1NJI2 5C44I 2G2KA 3G711 2B63I 2QRDB 1X3ZA 2IZ3A 3G4S1 1VQ81 2O4HA 2QR1B 3I55Z 3CC21 3CCQZ 3J81b 3S2HI 3PO3I 3T4NB 3CC7Z 1NP6A 1WW9A 3VB9A 3GTLI 1NUIA 1TFIA 3BG0B 5C3EI 1VQN1 3CCS1 4E31A 2QKDA 3NDJA 2JS4A 5C4XI 4A93I 5IT9b 5D1PA 3NDIA 4MRIA 3I551 4A3MI 3CCEZ 3CCQ1 4QTUA 2PK7A 2BJOA 2YADA 1Q862 2WB1A 1W2BZ 1I50I 3CXCY 2YU9I 4Y52I 2K3RA 2Y0SA 5FLXb 2E2JI 2AKLA 3MZLB 1Q861 5T64A 1WCMI 2I3CA 5D1OA 5T67A 4NB8A 1N8R1 2JA6I 3U50C 3RZDI 2E2II 5T6BA 4E33A 4X6AI 3J7A4 2DE7A 2NVXI 4MD7A 4QTTA 4A3FI 3CCJZ 1RO2A 2R7ZI 3JAMb 3J80f 1ZH1A 3VMHA 1X3WA 1R9TI 3OW2Y 2OZKA 4NB9A 1RLYA 3S17I 2QA4Z 3HOWI 2OTJZ 2EGTA 2GTHA 3GCFA 1M901 3HOVI 4RVFA 2HF1A 1VQ6Z 4NBDA 3BG1B 4A3DI 5FLMI 2JMOA 3CCJ1 3CPWZ 3CCU1 3GTQI 1ZB8A 2H85A 1JJ2Y 4HH4A 4BY7I 1YI2Z 3VMIA 3EEDA 4NBGA 2K5RA 2OTJ1 3FQMA 3HOUI 3FQQA 3S16I 2E2HI 4RV9A 1PFTA 3Q87A 1VQ61 3GTGI 1K9M1 2WAQA 1QVGY 1Z02A 4A3CI 4HGYA 2J6AA 2LIYA 2M48A 3MONA 1YJN1 1VQM1 1YI21 1VQ9Z 4E32A 2DE6A 1K731 2RPRA 4E2ZA 4NH1C 4Y7NI 3CMEZ 3CCVZ 1TWHI 5LL6f 1QVFY 3CXCZ 4NOZA 3S1RI 2KPIA 1S72Z 1DL6A 1YJWZ 4NBFA 1VQ91 3IFUA 2NVTI 3KIFA 2GU2A 2R92I 3GTMS 4DK1A 4E2WA 1TWGI 1YJ9Z 1I6HI 1WIIA 3I07A 3CC71 3F3PC 3S2DI 2QRCB 1YIJZ 1KD11 2RHBA 3CME1 3RZOI 3CCV1 5A2Qf 1VQOZ 2JA5I 1N8R2 1S721 1YJW1 1KQSZ 1LQLA 1K8A2 3FKII 2M6NA 1YJ91 2KI7B 2HU9A 3CCE1 1YIJ1 3I4MI 3CC4Z 4A3KI 1YHQZ 3OW2Z 4E30A 3M4OI 1K8A1 4EWCA 1VQO1 2RIQA 4NBCA 3CMAZ 3M3YI 4DGLA 3CD6Z 1Y1VS 2NVYI 1USPA 4RVDA 1W2BY 1M902 2F4MA 2GTIA 4BBSI 1I3QI 3NH8A 1JJ2Z 3VMGA 3CC41 4S1TA 1YHQ1 1ZB9A 3D6WA 3CCLZ 3K7AI 3TDHB 1M1K1 3CMA1 1YITZ 3D9XA 4AYBA 3J81f 1VLAA 5D1OB 2P3YA 1N2FA 2LFUA 1JWHC 3IX0A 3PO3S 2VF1A 1K9M2 4HGZA 1TWFI 4NFRA 2QA41 2PMZA 4RVGA 1YIT1 4A3JI 4XX2A 3I56Z 1YUAA 2W04A 1K732 3G6EZ 1QVFZ 1S7MA 3HOZI 1Y1VI 1VQKZ 4DQYB 3G4SZ 4A3GI 4A3BI 1QYPA 3EERA 3GKQA 1RQFA 3CC2Z 2JNYA 3LUSA 4BY1I 3S15I 4TNUA 4E2XA 3J80b 2JA7I 2OOYB 3G6E1 1KC81 4MD9A 1VQLZ 3KIHA 1VQK1 1VQ7Z 1KD12 2V8KA 1Z01A 3CCMZ 1Q7Y1 2RT9A 2O53A 3S1QI 3JAMf 4MD8A 1X0TA 1NJI1 3H3VJ 4BXXI 3HOYI 1RO0A 2JA8I 3NFZA 3QWUA 3NH4A 2Q51A 1VQL1 1VQ71 4RS4A 3CCM1 1VQ5Z 2RBLA 2F4OA 4A3II 5IP7I 5IP9I 4NBAA 4A3EI 3GTOI 2VUMI 1Y1WI 1RNIA 1K83I 2PM9A 3H0GI 3S1MI 1SFOI 4E2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJN 1;  1VQM 1;  1YI2 1;  1VQ9 Z;  1VQ5 1;  1Q81 2;  1M1K 2;  1K9M 2;  3I55 1;  3CCE Z;  3CCQ 1;  2QA4 1;  1VQP Z;  1K73 1;  1Q86 2;  1W2B Z;  3CXC Y;  1YIT 1;  3CME Z;  1Q81 1;  3CCV Z;  1KQS Y;  3CD6 1;  1QVF Y;  3CXC Z;  1Q86 1;  3CCU Z;  3I56 Z;  1S72 Z;  1YJW Z;  1K73 2;  1VQ9 1;  3G6E Z;  1QVG Z;  1QVF Z;  1VQK Z;  1VQP 1;  1N8R 1;  3G4S Z;  1YJ9 Z;  2QEX Z;  1Q82 2;  2OTL Z;  3CC2 Z;  3CC7 1;  3CCL 1;  1YIJ Z;  1KD1 1;  1VQ4 Z;  3CME 1;  3CCV 1;  1VQO Z;  1Q82 1;  1N8R 2;  1S72 1;  1YJW 1;  3CCJ Z;  3G6E 1;  1KC8 1;  3CCR Z;  1VQL Z;  1YJN Z;  1VQM Z;  1KQS Z;  1VQK 1;  1VQ7 Z;  1K8A 2;  1KD1 2;  1YJ9 1;  3G71 Z;  2QEX 1;  3OW2 Y;  3CCE 1;  3CCM Z;  1Q7Y 1;  2OTL 1;  2QA4 Z;  1VQ8 Z;  2OTJ Z;  1YIJ 1;  1VQ4 1;  3CC4 Z;  1NJI 1;  3CPW Y;  1YHQ Z;  3OW2 Z;  1M90 1;  1K8A 1;  1KC8 2;  1VQ6 Z;  1VQO 1;  3CMA Z;  3CCJ 1;  3CPW Z;  3CD6 Z;  3CCU 1;  3I56 1;  1Q7Y 2;  1VQN Z;  3CCS Z;  3CCR 1;  1VQL 1;  1JJ2 Y;  1VQ7 1;  1NJI 2;  1W2B Y;  3G71 1;  1YI2 Z;  1M90 2;  3CCM 1;  1VQ5 Z;  3G4S 1;  1JJ2 Z;  1VQ8 1;  2OTJ 1;  3I55 Z;  3CC4 1;  3CC2 1;  3CCQ Z;  1YHQ 1;  3CC7 Z;  1VQ6 1;  3CCL Z;  1M1K 1;  3CMA 1;  1YIT Z;  1K9M 1;  1QVG Y;  1VQN 1;  3CCS 1; 
#chains in the Genus database with same CATH topology
 1QF8 A;  2VUG A;  1P9N A;  2OOX B;  1VQ5 1;  1ML8 A;  1Q81 2;  3CQZ I;  1M1K 2;  2QLV B;  1YUK A;  1VQP Z;  2W03 A;  5AN9 F;  2V8J A;  3TE5 B;  1KRL A;  1TWA I;  2NVQ I;  3GTM I;  3S14 I;  3D2L A;  1Q81 1;  2QRE B;  1AA6 A;  1KQS Y;  3CD6 1;  3VTN A;  3CCU Z;  1Z03 A;  1QVG Z;  3F3F C;  2Q4Z A;  1VQP 1;  2E9H A;  4NBH A;  5A2Q b;  2QEX Z;  1Q82 2;  3GTJ I;  1TWC I;  2OTL Z;  3HKZ A;  3PO2 I;  3CCL 1;  3ESW A;  1VQ4 Z;  1RO4 A;  5IT9 f;  4RVH A;  1USP B;  4MXU A;  3IF8 A;  4A3L I;  1Q82 1;  2ZAE B;  2AYD A;  2JUB A;  5FLX f;  5C4J I;  3CCR Z;  2R93 I;  1YJN Z;  2DE5 A;  4NBB A;  2P28 A;  3P5J B;  1VQM Z;  4MON A;  3G71 Z;  4BBR I;  2QEX 1;  4MH4 A;  3MZK B;  2OTL 1;  3GTP I;  2VPW A;  2R6M A;  2IZ4 A;  1VQ8 Z;  1VQ4 1;  4CL1 A;  3GTK I;  3CPW Y;  3I4N I;  3HOX I;  1KC8 2;  3NH5 A;  2V3V A;  3S1N I;  1L1O C;  2JR6 A;  5CM2 M;  3I56 1;  1Q7Y 2;  1VQN Z;  3CCS Z;  3CCR 1;  2V8I A;  4NBE A;  1NJI 2;  5C44 I;  2G2K A;  3G71 1;  2B63 I;  2QRD B;  1X3Z A;  2IZ3 A;  3G4S 1;  1VQ8 1;  2O4H A;  2QR1 B;  3I55 Z;  3CC2 1;  3CCQ Z;  3J81 b;  3S2H I;  3PO3 I;  3T4N B;  3CC7 Z;  1NP6 A;  1WW9 A;  3VB9 A;  3GTL I;  1NUI A;  1TFI A;  3BG0 B;  5C3E I;  1VQN 1;  3CCS 1;  4E31 A;  2QKD A;  3NDJ A;  2JS4 A;  5C4X I;  4A93 I;  5IT9 b;  5D1P A;  3NDI A;  4MRI A;  3I55 1;  4A3M I;  3CCE Z;  3CCQ 1;  4QTU A;  2PK7 A;  2BJO A;  2YAD A;  1Q86 2;  2WB1 A;  1W2B Z;  1I50 I;  3CXC Y;  2YU9 I;  4Y52 I;  1Y8C A;  2K3R A;  2Y0S A;  5FLX b;  2E2J I;  2AKL A;  3MZL B;  1Q86 1;  5T64 A;  1WCM I;  2I3C A;  5D1O A;  5T67 A;  4NB8 A;  1N8R 1;  2JA6 I;  3U50 C;  3RZD I;  2E2I I;  5T6B A;  4E33 A;  4X6A I;  3J7A 4;  2DE7 A;  2NVX I;  4MD7 A;  4QTT A;  4A3F I;  3CCJ Z;  1RO2 A;  2R7Z I;  3JAM b;  2E7Z A;  3J80 f;  1ZH1 A;  3VMH A;  1QXF A;  1X3W A;  1R9T I;  3OW2 Y;  2OZK A;  4NB9 A;  1RLY A;  3S17 I;  2QA4 Z;  3HOW I;  2OTJ Z;  2EGT A;  2GTH A;  3GCF A;  1M90 1;  3HOV I;  4RVF A;  2HF1 A;  2JIM A;  1VQ6 Z;  4NBD A;  3BG1 B;  4A3D I;  5FLM I;  2JMO A;  3CCJ 1;  3CPW Z;  3CCU 1;  3GTQ I;  1ZB8 A;  2H85 A;  1SIW A;  1JJ2 Y;  4HH4 A;  4BY7 I;  1YI2 Z;  3VMI A;  3EED A;  2NAP A;  4NBG A;  2K5R A;  2OTJ 1;  3FQM A;  3HOU I;  3FQQ A;  3S16 I;  2E2H I;  4RV9 A;  1PFT A;  3Q87 A;  1VQ6 1;  3GTG I;  1K9M 1;  2WAQ A;  1QVG Y;  1Z02 A;  4A3C I;  4HGY A;  2J6A A;  2LIY A;  2M48 A;  3MON A;  1YJN 1;  1VQM 1;  1YI2 1;  1VQ9 Z;  2VPZ A;  4E32 A;  2DE6 A;  1K73 1;  2RPR A;  4E2Z A;  4NH1 C;  4Y7N I;  3CME Z;  3CCV Z;  1TWH I;  5LL6 f;  1QVF Y;  3CXC Z;  4NOZ A;  3S1R I;  2KPI A;  2JIQ A;  1S72 Z;  1DL6 A;  1YJW Z;  4NBF A;  1VQ9 1;  3IFU A;  2NVT I;  3KIF A;  2GU2 A;  2R92 I;  3GTM S;  4DK1 A;  4E2W A;  1TWG I;  1YJ9 Z;  1I6H I;  1FDO A;  1WII A;  3I07 A;  3CC7 1;  3F3P C;  3S2D I;  2QRC B;  1YIJ Z;  1KD1 1;  2RHB A;  3CME 1;  3RZO I;  3CCV 1;  5A2Q f;  1VQO Z;  2JA5 I;  1N8R 2;  1S72 1;  1YJW 1;  1KQS Z;  1LQL A;  1K8A 2;  3FKI I;  2M6N A;  1YJ9 1;  2KI7 B;  2HU9 A;  3CCE 1;  1YIJ 1;  3I4M I;  3CC4 Z;  4A3K I;  1YHQ Z;  3OW2 Z;  4E30 A;  3M4O I;  1K8A 1;  4EWC A;  1VQO 1;  2RIQ A;  4NBC A;  3CMA Z;  3M3Y I;  4DGL A;  2JIO A;  2VPX A;  3CD6 Z;  1Y1V S;  2JIR A;  2NVY I;  1USP A;  4RVD A;  1W2B Y;  1M90 2;  2F4M A;  2GTI A;  4BBS I;  1I3Q I;  3NH8 A;  1JJ2 Z;  3VMG A;  3CC4 1;  4S1T A;  1YHQ 1;  1ZB9 A;  3D6W A;  3CCL Z;  3K7A I;  3TDH B;  1M1K 1;  3CMA 1;  1YIT Z;  3D9X A;  4AYB A;  3J81 f;  1VLA A;  5D1O B;  2P3Y A;  1N2F A;  2LFU A;  1JWH C;  3IX0 A;  3PO3 S;  2VF1 A;  2V45 A;  1K9M 2;  4HGZ A;  1TWF I;  4NFR A;  2QA4 1;  2JIP A;  2PMZ A;  4RVG A;  1YIT 1;  4A3J I;  4XX2 A;  1Q16 A;  3I56 Z;  1YUA A;  2W04 A;  1K73 2;  3G6E Z;  1QVF Z;  1S7M A;  3HOZ I;  3IR7 A;  1Y1V I;  1VQK Z;  4DQY B;  3G4S Z;  4A3G I;  4A3B I;  1QYP A;  3EER A;  3GKQ A;  1RQF A;  3CC2 Z;  2JNY A;  3LUS A;  4BY1 I;  3S15 I;  4TNU A;  4E2X A;  3J80 b;  2JA7 I;  2OOY B;  3G6E 1;  1KC8 1;  4MD9 A;  1VQL Z;  3KIH A;  1VQK 1;  1VQ7 Z;  1KD1 2;  2V8K A;  1Z01 A;  3CCM Z;  1Q7Y 1;  2RT9 A;  2O53 A;  3S1Q I;  3JAM f;  2VPY A;  4MD8 A;  1X0T A;  1NJI 1;  3H3V J;  4BXX I;  3HOY I;  1RO0 A;  2JA8 I;  1FDI A;  3NFZ A;  2LEX A;  3QWU A;  3NH4 A;  2Q51 A;  1VQL 1;  1WJ2 A;  1VQ7 1;  4RS4 A;  3CCM 1;  2IV2 X;  1VQ5 Z;  2RBL A;  2F4O A;  4A3I I;  5IP7 I;  5IP9 I;  4NBA A;  4A3E I;  3GTO I;  2VUM I;  1Y1W I;  1RNI A;  1K83 I;  1WZN A;  2PM9 A;  3H0G I;  3S1M I;  1SFO I;  4E2Y A; 
#chains in the Genus database with same CATH homology
 1QF8 A;  2VUG A;  1P9N A;  2OOX B;  1VQ5 1;  1ML8 A;  1Q81 2;  3CQZ I;  1M1K 2;  2QLV B;  1YUK A;  1VQP Z;  2W03 A;  5AN9 F;  2V8J A;  3TE5 B;  1KRL A;  1TWA I;  2NVQ I;  3GTM I;  3S14 I;  1Q81 1;  2QRE B;  1KQS Y;  3CD6 1;  3VTN A;  3CCU Z;  1Z03 A;  1QVG Z;  3F3F C;  2Q4Z A;  1VQP 1;  2E9H A;  4NBH A;  5A2Q b;  2QEX Z;  1Q82 2;  3GTJ I;  1TWC I;  2OTL Z;  3HKZ A;  3PO2 I;  3CCL 1;  3ESW A;  1VQ4 Z;  1RO4 A;  5IT9 f;  4RVH A;  1USP B;  4MXU A;  3IF8 A;  4A3L I;  1Q82 1;  2ZAE B;  2JUB A;  5FLX f;  5C4J I;  3CCR Z;  2R93 I;  1YJN Z;  2DE5 A;  4NBB A;  2P28 A;  3P5J B;  1VQM Z;  4MON A;  3G71 Z;  4BBR I;  2QEX 1;  4MH4 A;  3MZK B;  2OTL 1;  3GTP I;  2R6M A;  2IZ4 A;  1VQ8 Z;  1VQ4 1;  4CL1 A;  3GTK I;  3CPW Y;  3I4N I;  3HOX I;  1KC8 2;  3NH5 A;  3S1N I;  1L1O C;  2JR6 A;  5CM2 M;  3I56 1;  1Q7Y 2;  1VQN Z;  3CCS Z;  3CCR 1;  2V8I A;  4NBE A;  1NJI 2;  5C44 I;  2G2K A;  3G71 1;  2B63 I;  2QRD B;  1X3Z A;  2IZ3 A;  3G4S 1;  1VQ8 1;  2O4H A;  2QR1 B;  3I55 Z;  3CC2 1;  3CCQ Z;  3J81 b;  3S2H I;  3PO3 I;  3T4N B;  3CC7 Z;  1NP6 A;  1WW9 A;  3VB9 A;  3GTL I;  1NUI A;  1TFI A;  3BG0 B;  5C3E I;  1VQN 1;  3CCS 1;  4E31 A;  2QKD A;  3NDJ A;  2JS4 A;  5C4X I;  4A93 I;  5IT9 b;  5D1P A;  3NDI A;  4MRI A;  3I55 1;  4A3M I;  3CCE Z;  3CCQ 1;  4QTU A;  2PK7 A;  2BJO A;  2YAD A;  1Q86 2;  2WB1 A;  1W2B Z;  1I50 I;  3CXC Y;  2YU9 I;  4Y52 I;  2K3R A;  2Y0S A;  5FLX b;  2E2J I;  2AKL A;  3MZL B;  1Q86 1;  5T64 A;  1WCM I;  2I3C A;  5D1O A;  5T67 A;  4NB8 A;  1N8R 1;  2JA6 I;  3U50 C;  3RZD I;  2E2I I;  5T6B A;  4E33 A;  4X6A I;  3J7A 4;  2DE7 A;  2NVX I;  4MD7 A;  4QTT A;  4A3F I;  3CCJ Z;  1RO2 A;  2R7Z I;  3JAM b;  3J80 f;  1ZH1 A;  3VMH A;  1X3W A;  1R9T I;  3OW2 Y;  2OZK A;  4NB9 A;  1RLY A;  3S17 I;  2QA4 Z;  3HOW I;  2OTJ Z;  2EGT A;  2GTH A;  3GCF A;  1M90 1;  3HOV I;  4RVF A;  2HF1 A;  1VQ6 Z;  4NBD A;  3BG1 B;  4A3D I;  5FLM I;  2JMO A;  3CCJ 1;  3CPW Z;  3CCU 1;  3GTQ I;  1ZB8 A;  2H85 A;  1JJ2 Y;  4HH4 A;  4BY7 I;  1YI2 Z;  3VMI A;  3EED A;  4NBG A;  2K5R A;  2OTJ 1;  3FQM A;  3HOU I;  3FQQ A;  3S16 I;  2E2H I;  4RV9 A;  1PFT A;  3Q87 A;  1VQ6 1;  3GTG I;  1K9M 1;  2WAQ A;  1QVG Y;  1Z02 A;  4A3C I;  4HGY A;  2J6A A;  2LIY A;  2M48 A;  3MON A;  1YJN 1;  1VQM 1;  1YI2 1;  1VQ9 Z;  4E32 A;  2DE6 A;  1K73 1;  2RPR A;  4E2Z A;  4NH1 C;  4Y7N I;  3CME Z;  3CCV Z;  1TWH I;  5LL6 f;  1QVF Y;  3CXC Z;  4NOZ A;  3S1R I;  2KPI A;  1S72 Z;  1DL6 A;  1YJW Z;  4NBF A;  1VQ9 1;  3IFU A;  2NVT I;  3KIF A;  2GU2 A;  2R92 I;  3GTM S;  4DK1 A;  4E2W A;  1TWG I;  1YJ9 Z;  1I6H I;  1WII A;  3I07 A;  3CC7 1;  3F3P C;  3S2D I;  2QRC B;  1YIJ Z;  1KD1 1;  2RHB A;  3CME 1;  3RZO I;  3CCV 1;  5A2Q f;  1VQO Z;  2JA5 I;  1N8R 2;  1S72 1;  1YJW 1;  1KQS Z;  1LQL A;  1K8A 2;  3FKI I;  2M6N A;  1YJ9 1;  2KI7 B;  2HU9 A;  3CCE 1;  1YIJ 1;  3I4M I;  3CC4 Z;  4A3K I;  1YHQ Z;  3OW2 Z;  4E30 A;  3M4O I;  1K8A 1;  4EWC A;  1VQO 1;  2RIQ A;  4NBC A;  3CMA Z;  3M3Y I;  4DGL A;  3CD6 Z;  1Y1V S;  2NVY I;  1USP A;  4RVD A;  1W2B Y;  1M90 2;  2F4M A;  2GTI A;  4BBS I;  1I3Q I;  3NH8 A;  1JJ2 Z;  3VMG A;  3CC4 1;  4S1T A;  1YHQ 1;  1ZB9 A;  3D6W A;  3CCL Z;  3K7A I;  3TDH B;  1M1K 1;  3CMA 1;  1YIT Z;  3D9X A;  4AYB A;  3J81 f;  1VLA A;  5D1O B;  2P3Y A;  1N2F A;  2LFU A;  1JWH C;  3IX0 A;  3PO3 S;  2VF1 A;  1K9M 2;  4HGZ A;  1TWF I;  4NFR A;  2QA4 1;  2PMZ A;  4RVG A;  1YIT 1;  4A3J I;  4XX2 A;  3I56 Z;  1YUA A;  2W04 A;  1K73 2;  3G6E Z;  1QVF Z;  1S7M A;  3HOZ I;  1Y1V I;  1VQK Z;  4DQY B;  3G4S Z;  4A3G I;  4A3B I;  1QYP A;  3EER A;  3GKQ A;  1RQF A;  3CC2 Z;  2JNY A;  3LUS A;  4BY1 I;  3S15 I;  4TNU A;  4E2X A;  3J80 b;  2JA7 I;  2OOY B;  3G6E 1;  1KC8 1;  4MD9 A;  1VQL Z;  3KIH A;  1VQK 1;  1VQ7 Z;  1KD1 2;  2V8K A;  1Z01 A;  3CCM Z;  1Q7Y 1;  2RT9 A;  2O53 A;  3S1Q I;  3JAM f;  4MD8 A;  1X0T A;  1NJI 1;  3H3V J;  4BXX I;  3HOY I;  1RO0 A;  2JA8 I;  3NFZ A;  3QWU A;  3NH4 A;  2Q51 A;  1VQL 1;  1VQ7 1;  4RS4 A;  3CCM 1;  1VQ5 Z;  2RBL A;  2F4O A;  4A3I I;  5IP7 I;  5IP9 I;  4NBA A;  4A3E I;  3GTO I;  2VUM I;  1Y1W I;  1RNI A;  1K83 I;  2PM9 A;  3H0G I;  3S1M I;  1SFO I;  4E2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...