1W2BY

Trigger factor ribosome binding domain in complex with 50s
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Trigger Factor in Complex with the Ribosome Forms a Molecular Cradle for Nascent Proteins
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 11
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1w2bY00
3OW2Y 1JJ2Z 3CCMZ 1VQ9Z 1YI2Z 3CPWY 1KD11 3CCSZ 3CCQ1 3CME1 1YJNZ 1KQSY 3OW2Z 1VQM1 1VQ4Z 3CPWZ 1K732 1S72Z 3CCL1 2QA41 1K8A2 1KD12 1KQSZ 3CCM1 3CCRZ 1Q811 1VQ91 1YI21 3CCS1 3CCVZ 1YJN1 1M901 1YJ91 3G71Z 1Q812 3CXCY 1S721 1VQOZ 1K731 1VQLZ 3CCR1 1K8A1 1VQKZ 3CCV1 1YHQZ 1M902 3CXCZ 2OTJZ 3CCEZ 1QVGY 1VQ5Z 1N8R2 2OTLZ 1Q861 3CD6Z 1VQPZ 1KC82 1VQK1 1QVGZ 1YHQ1 3CC2Z 1K9M1 1VQ6Z 3I55Z 3G4SZ 1M1K2 1QVFY 1YIJZ 2OTJ1 3CCE1 1Q862 1VQ41 3CC4Z 2QEXZ 1VQ51 2OTL1 1Q7Y1 1N8R1 3CD61 1VQP1 1QVFZ 1W2BY 1K9M2 3G6EZ 1KC81 1VQ61 3I56Z 1VQ8Z 3I551 3G4S1 1NJI1 1VQ7Z 1YIJ1 1YJWZ 1Q7Y2 1W2BZ 3G711 2QEX1 1M1K1 1VQO1 1VQL1 1VQNZ 3CMAZ 3CCUZ 1NJI2 3G6E1 3CC7Z 3I561 3CCJZ 1VQ81 1VQ71 1YITZ 1YJW1 1VQN1 3CMA1 3CCU1 1YJ9Z 1Q821 3CC21 3CC71 3CCJ1 3CCQZ 3CC41 1YIT1 3CMEZ 1JJ2Y 1Q822 1VQMZ 3CCLZ 2QA4Z
chains in the Genus database with same CATH superfamily
1N2FA 4A3CI 3CCMZ 1SIWA 1VQ9Z 3CPWY 3GTMS 1KD11 2QLVB 1NUIA 5AN9F 3RZDI 3CPWZ 1S72Z 2RPRA 3CCL1 1I3QI 1KD12 4RVGA 4X6AI 1K83I 3CCRZ 1Q811 4MONA 3CCVZ 2QR1B 2QKDA 2RT9A 1DL6A 2VF1A 3GTKI 4DGLA 1P9NA 5T6BA 4RS4A 3G71Z 1Q812 3FQQA 1WCMI 2K5RA 3NH8A 4NB8A 4A3II 3S16I 2LFUA 4E32A 3S2HI 2BJOA 5T67A 2OTJZ 3PO3I 2M6NA 1VQ5Z 1N8R2 2OTLZ 1Q861 4Y52I 5FLXb 3GTPI 2I3CA 2NVXI 4NBDA 1S7MA 4NBCA 5C4JI 3ESWA 4DQYB 3I4MI 3CCE1 1Q862 5CM2M 1VQ41 3HOUI 1Y8CA 1USPA 1Q7Y1 1VQP1 1YUAA 5T64A 1W2BY 2DE7A 1WW9A 3J80b 1VQ61 3I56Z 4E33A 3I551 1VQ8Z 4HGZA 1YIJ1 2JA5I 1Q7Y2 1W2BZ 2QEX1 4RVFA 1VQO1 3K7AI 4E30A 5C3EI 3GTLI 3GTMI 3G6E1 2JS4A 3VMHA 3U50C 1YITZ 1YJW1 3S1NI 2JA6I 3CMA1 2QRCB 3CCU1 1YJ9Z 4A93I 1Q821 2VUMI 4E2WA 3CCJ1 4RVDA 3CMEZ 2K3RA 1TFIA 5C4XI 3PO3S 1Q822 4A3JI 4A3BI 1LQLA 4A3GI 1Q16A 2E9HA 3OW2Y 5FLMI 1YI2Z 3CCSZ 1YJNZ 2JIQA 1KQSY 3OW2Z 1Z03A 2VPXA 3HOYI 2V8IA 3IX0A 1VQM1 3I07A 5A2Qb 2QA41 2E2II 1KQSZ 3CCM1 1VQ91 4TNUA 3H0GI 4NOZA 4QTTA 1Y1WI 2DE5A 2V3VA 3M4OI 3FQMA 2NVTI 3CXCY 1S721 3I4NI 5D1PA 3CCR1 3JAMf 3PO2I 2Q51A 1QXFA 2HU9A 3CCV1 4Y7NI 3CXCZ 3F3PC 3HOWI 5IT9f 3HOVI 1X0TA 3MZLB 3J81b 3KIHA 2JA7I 3CC2Z 3NFZA 1Y1VS 1M1K2 2J6AA 1RO0A 3EEDA 2R93I 2OTJ1 1VQ51 2OTL1 2W03A 4MD9A 2G2KA 1N8R1 3MZKB 3H3VJ 4CL1A 2R7ZI 1R9TI 1TWAI 2M48A 2PMZA 3NDIA 1ZB8A 3LUSA 2H85A 4NB9A 4HH4A 4NBAA 1VQL1 2B63I 2JIMA 2E2JI 3CC7Z 3I561 1VQ81 3Q87A 5LL6f 2GU2A 2NVYI 3MONA 1RQFA 2F4MA 1ZH1A 2JIPA 4BBRI 1SFOI 3CCQZ 3CC41 1YIT1 2AKLA 2ZAEB 1JJ2Y 3TE5B 1I50I 2LIYA 3GTOI 2DE6A 2PK7A 2VUGA 1I6HI 3S1MI 1JJ2Z 2OZKA 2WB1A 2VPYA 2NAPA 3NDJA 3CME1 1QYPA 3GCFA 1X3WA 1QF8A 2IZ4A 2WAQA 2RBLA 1VQ4Z 1K732 3TDHB 1K8A2 4A3MI 4BY1I 3VMIA 1Y1VI 2JIRA 4MD7A 1YI21 3CCS1 4A3EI 4NBBA 1YJN1 3S15I 4A3LI 1M901 4EWCA 4MH4A 4S1TA 3KIFA 2EGTA 2AYDA 1FDOA 2F4OA 1VQOZ 2VPWA 5C44I 3D9XA 1VQKZ 4NBFA 2O4HA 1YHQZ 1M902 1WZNA 1RO2A 3IR7A 1QVGY 3FKII 2NVQI 3CD6Z 1KC82 2PM9A 1QVGZ 5D1OB 4A3FI 1K9M1 3G4SZ 3S17I 4RV9A 3VB9A 2V8KA 4E2XA 1RO4A 3D2LA 1VLAA 2RHBA 3S2DI 5FLXf 1K9M2 4DK1A 2RIQA 1TWFI 3GTQI 5IP9I 5D1OA 1L1OC 1VQ7Z 4NBGA 1PFTA 2JMOA 3G711 1M1K1 1VQNZ 2IZ3A 4E31A 1ML8A 3CQZI 3J80f 2JNYA 2IV2X 1YUKA 4BY7I 3NH5A 3CC71 3VMGA 2LEXA 1ZB9A 4E2ZA 2HF1A 3IFUA 3QWUA 3GTGI 1X3ZA 3CCLZ 2JUBA 4QTUA 4A3DI 3CCQ1 3IF8A 3F3FC 2V8JA 3NH4A 1KRLA 2E7ZA 4E2YA 1USPB 1FDIA 3GKQA 3JAMb 3S1RI 3RZOI 5IP7I 3J7A4 1AA6A 2P28A 3HOXI 3P5JB 3BG0B 1YJ91 2QRDB 5IT9b 1Z02A 2JIOA 1K731 1VQLZ 1Z01A 2O53A 5A2Qf 2VPZA 1K8A1 3HOZI 2QREB 2KI7B 4NH1C 2Q4ZA 3CCEZ 2GTIA 2E2HI 3VTNA 1VQPZ 2KPIA 3GTJI 3EERA 1VQK1 1YHQ1 4A3KI 1VQ6Z 1WJ2A 3I55Z 2JR6A 1QVFY 1YIJZ 2R92I 1TWGI 2YU9I 3CC4Z 2QEXZ 4AYBA 3T4NB 1TWHI 3CD61 3HKZA 1JWHC 1QVFZ 3J81f 3G6EZ 1KC81 2YADA 3G4S1 1NP6A 1NJI1 2Y0SA 4NFRA 4MD8A 1YJWZ 2V45A 3S14I 4NBEA 2JA8I 3CMAZ 3BG1B 3CCUZ 1RLYA 1NJI2 3M3YI 4NBHA 3D6WA 4RVHA 3CCJZ 1VQ71 2OOYB 2W04A 4BBSI 2R6MA 3S1QI 4HGYA 1VQN1 4BXXI 3CC21 4XX2A 2P3YA 1TWCI 2GTHA 4MXUA 1WIIA 1VQMZ 2OOXB 1RNIA 4MRIA 2QA4Z
chains in the Genus database with same CATH topology
1N2FA 4A3CI 3CCMZ 1VQ9Z 3CPWY 3GTMS 1KD11 2QLVB 1NUIA 5AN9F 3RZDI 3CPWZ 1S72Z 2RPRA 3CCL1 1I3QI 1KD12 4RVGA 4X6AI 1K83I 3CCRZ 1Q811 4MONA 3CCVZ 2QR1B 2QKDA 2RT9A 1DL6A 2VF1A 3GTKI 4DGLA 1P9NA 5T6BA 4RS4A 3G71Z 1Q812 3FQQA 1WCMI 2K5RA 3NH8A 4NB8A 4A3II 3S16I 2LFUA 4E32A 3S2HI 2BJOA 5T67A 2OTJZ 3PO3I 2M6NA 1VQ5Z 1N8R2 2OTLZ 1Q861 4Y52I 5FLXb 3GTPI 2I3CA 2NVXI 4NBDA 1S7MA 4NBCA 5C4JI 3ESWA 4DQYB 3I4MI 3CCE1 1Q862 5CM2M 1VQ41 3HOUI 1USPA 1Q7Y1 1VQP1 1YUAA 5T64A 1W2BY 2DE7A 1WW9A 3J80b 1VQ61 3I56Z 1VQ8Z 3I551 4E33A 4HGZA 1YIJ1 2JA5I 1Q7Y2 1W2BZ 2QEX1 4RVFA 1VQO1 3K7AI 4E30A 5C3EI 3GTLI 3GTMI 3G6E1 2JS4A 3VMHA 3U50C 1YITZ 1YJW1 3S1NI 2JA6I 3CMA1 2QRCB 3CCU1 1YJ9Z 4A93I 1Q821 2VUMI 4E2WA 3CCJ1 4RVDA 3CMEZ 2K3RA 1TFIA 5C4XI 3PO3S 1Q822 4A3JI 4A3BI 1LQLA 4A3GI 2E9HA 3OW2Y 5FLMI 1YI2Z 3CCSZ 1YJNZ 1KQSY 3OW2Z 1Z03A 3HOYI 2V8IA 3IX0A 1VQM1 3I07A 5A2Qb 2QA41 2E2II 1KQSZ 3CCM1 1VQ91 4TNUA 3H0GI 4NOZA 4QTTA 1Y1WI 2DE5A 3M4OI 3FQMA 2NVTI 3CXCY 1S721 3I4NI 5D1PA 3CCR1 3JAMf 3PO2I 2Q51A 2HU9A 3CCV1 4Y7NI 3CXCZ 3F3PC 3HOWI 5IT9f 3HOVI 1X0TA 3MZLB 3J81b 3KIHA 2JA7I 3CC2Z 3NFZA 1Y1VS 1M1K2 2J6AA 1RO0A 3EEDA 2R93I 2OTJ1 1VQ51 2OTL1 2W03A 4MD9A 2G2KA 1N8R1 3MZKB 3H3VJ 4CL1A 2R7ZI 1R9TI 1TWAI 2M48A 2PMZA 3NDIA 1ZB8A 3LUSA 2H85A 4NB9A 4HH4A 4NBAA 1VQL1 2B63I 2E2JI 3CC7Z 3I561 1VQ81 3Q87A 5LL6f 2GU2A 2NVYI 3MONA 1RQFA 2F4MA 1ZH1A 4BBRI 1SFOI 3CCQZ 3CC41 1YIT1 2AKLA 2ZAEB 1JJ2Y 3TE5B 1I50I 2LIYA 3GTOI 2DE6A 2PK7A 2VUGA 1I6HI 3S1MI 1JJ2Z 2OZKA 2WB1A 3NDJA 3CME1 1QYPA 3GCFA 1X3WA 1QF8A 2IZ4A 2WAQA 2RBLA 1VQ4Z 1K732 3TDHB 1K8A2 4A3MI 4BY1I 3VMIA 1Y1VI 4MD7A 1YI21 3CCS1 4A3EI 4NBBA 1YJN1 3S15I 4A3LI 1M901 4EWCA 4MH4A 4S1TA 3KIFA 2EGTA 2F4OA 1VQOZ 5C44I 3D9XA 1VQKZ 4NBFA 2O4HA 1YHQZ 1M902 1RO2A 1QVGY 3FKII 2NVQI 3CD6Z 1KC82 2PM9A 1QVGZ 5D1OB 4A3FI 1K9M1 3G4SZ 3S17I 4RV9A 3VB9A 2V8KA 4E2XA 1RO4A 1VLAA 2RHBA 3S2DI 5FLXf 1K9M2 4DK1A 2RIQA 1TWFI 3GTQI 5IP9I 5D1OA 1L1OC 1VQ7Z 4NBGA 1PFTA 2JMOA 3G711 1M1K1 1VQNZ 2IZ3A 4E31A 1ML8A 3CQZI 3J80f 2JNYA 1YUKA 4BY7I 3NH5A 3CC71 3VMGA 1ZB9A 4E2ZA 2HF1A 3IFUA 3QWUA 3GTGI 1X3ZA 3CCLZ 2JUBA 4QTUA 4A3DI 3CCQ1 3IF8A 3F3FC 2V8JA 3NH4A 1KRLA 4E2YA 1USPB 3GKQA 3JAMb 3S1RI 3RZOI 5IP7I 3J7A4 2P28A 3HOXI 3P5JB 3BG0B 1YJ91 2QRDB 5IT9b 1Z02A 1K731 1VQLZ 1Z01A 2O53A 5A2Qf 1K8A1 3HOZI 2QREB 2KI7B 4NH1C 2Q4ZA 3CCEZ 2GTIA 2E2HI 3VTNA 1VQPZ 2KPIA 3GTJI 3EERA 1VQK1 1YHQ1 4A3KI 1VQ6Z 3I55Z 2JR6A 1QVFY 1YIJZ 2R92I 1TWGI 2YU9I 3CC4Z 2QEXZ 4AYBA 3T4NB 1TWHI 3CD61 3HKZA 1JWHC 1QVFZ 3J81f 3G6EZ 1KC81 2YADA 3G4S1 1NP6A 1NJI1 2Y0SA 4NFRA 4MD8A 1YJWZ 3S14I 4NBEA 2JA8I 3CMAZ 3BG1B 3CCUZ 1RLYA 1NJI2 3M3YI 4NBHA 3D6WA 4RVHA 3CCJZ 1VQ71 2OOYB 2W04A 4BBSI 2R6MA 3S1QI 4HGYA 1VQN1 4BXXI 3CC21 4XX2A 2P3YA 1TWCI 2GTHA 4MXUA 1WIIA 1VQMZ 2OOXB 1RNIA 4MRIA 2QA4Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW2 Y;  1JJ2 Z;  3CCM Z;  1VQ9 Z;  1YI2 Z;  3CPW Y;  1KD1 1;  3CCS Z;  3CCQ 1;  3CME 1;  1YJN Z;  1KQS Y;  3OW2 Z;  1VQM 1;  1VQ4 Z;  3CPW Z;  1K73 2;  1S72 Z;  3CCL 1;  2QA4 1;  1K8A 2;  1KD1 2;  1KQS Z;  3CCM 1;  3CCR Z;  1Q81 1;  1VQ9 1;  1YI2 1;  3CCS 1;  3CCV Z;  1YJN 1;  1M90 1;  1YJ9 1;  3G71 Z;  1Q81 2;  3CXC Y;  1S72 1;  1VQO Z;  1K73 1;  1VQL Z;  3CCR 1;  1K8A 1;  1VQK Z;  3CCV 1;  1YHQ Z;  1M90 2;  3CXC Z;  2OTJ Z;  3CCE Z;  1QVG Y;  1VQ5 Z;  1N8R 2;  2OTL Z;  1Q86 1;  3CD6 Z;  1VQP Z;  1KC8 2;  1VQK 1;  1QVG Z;  1YHQ 1;  3CC2 Z;  1K9M 1;  1VQ6 Z;  3I55 Z;  3G4S Z;  1M1K 2;  1QVF Y;  1YIJ Z;  2OTJ 1;  3CCE 1;  1Q86 2;  1VQ4 1;  3CC4 Z;  2QEX Z;  1VQ5 1;  2OTL 1;  1Q7Y 1;  1N8R 1;  3CD6 1;  1VQP 1;  1QVF Z;  1W2B Y;  1K9M 2;  3G6E Z;  1KC8 1;  1VQ6 1;  3I56 Z;  1VQ8 Z;  3I55 1;  3G4S 1;  1NJI 1;  1VQ7 Z;  1YIJ 1;  1YJW Z;  1Q7Y 2;  1W2B Z;  3G71 1;  2QEX 1;  1M1K 1;  1VQO 1;  1VQL 1;  1VQN Z;  3CMA Z;  3CCU Z;  1NJI 2;  3G6E 1;  3CC7 Z;  3I56 1;  3CCJ Z;  1VQ8 1;  1VQ7 1;  1YIT Z;  1YJW 1;  1VQN 1;  3CMA 1;  3CCU 1;  1YJ9 Z;  1Q82 1;  3CC2 1;  3CC7 1;  3CCJ 1;  3CCQ Z;  3CC4 1;  1YIT 1;  3CME Z;  1JJ2 Y;  1Q82 2;  1VQM Z;  3CCL Z;  2QA4 Z; 
#chains in the Genus database with same CATH topology
 1N2F A;  4A3C I;  3CCM Z;  1SIW A;  1VQ9 Z;  3CPW Y;  3GTM S;  1KD1 1;  2QLV B;  1NUI A;  5AN9 F;  3RZD I;  3CPW Z;  1S72 Z;  2RPR A;  3CCL 1;  1I3Q I;  1KD1 2;  4RVG A;  4X6A I;  1K83 I;  3CCR Z;  1Q81 1;  4MON A;  3CCV Z;  2QR1 B;  2QKD A;  2RT9 A;  1DL6 A;  2VF1 A;  3GTK I;  4DGL A;  1P9N A;  5T6B A;  4RS4 A;  3G71 Z;  1Q81 2;  3FQQ A;  1WCM I;  2K5R A;  3NH8 A;  4NB8 A;  4A3I I;  3S16 I;  2LFU A;  4E32 A;  3S2H I;  2BJO A;  5T67 A;  2OTJ Z;  3PO3 I;  2M6N A;  1VQ5 Z;  1N8R 2;  2OTL Z;  1Q86 1;  4Y52 I;  5FLX b;  3GTP I;  2I3C A;  2NVX I;  4NBD A;  1S7M A;  4NBC A;  5C4J I;  3ESW A;  4DQY B;  3I4M I;  3CCE 1;  1Q86 2;  5CM2 M;  1VQ4 1;  3HOU I;  1Y8C A;  1USP A;  1Q7Y 1;  1VQP 1;  1YUA A;  5T64 A;  1W2B Y;  2DE7 A;  1WW9 A;  3J80 b;  1VQ6 1;  3I56 Z;  4E33 A;  3I55 1;  1VQ8 Z;  4HGZ A;  1YIJ 1;  2JA5 I;  1Q7Y 2;  1W2B Z;  2QEX 1;  4RVF A;  1VQO 1;  3K7A I;  4E30 A;  5C3E I;  3GTL I;  3GTM I;  3G6E 1;  2JS4 A;  3VMH A;  3U50 C;  1YIT Z;  1YJW 1;  3S1N I;  2JA6 I;  3CMA 1;  2QRC B;  3CCU 1;  1YJ9 Z;  4A93 I;  1Q82 1;  2VUM I;  4E2W A;  3CCJ 1;  4RVD A;  3CME Z;  2K3R A;  1TFI A;  5C4X I;  3PO3 S;  1Q82 2;  4A3J I;  4A3B I;  1LQL A;  4A3G I;  1Q16 A;  2E9H A;  3OW2 Y;  5FLM I;  1YI2 Z;  3CCS Z;  1YJN Z;  2JIQ A;  1KQS Y;  3OW2 Z;  1Z03 A;  2VPX A;  3HOY I;  2V8I A;  3IX0 A;  1VQM 1;  3I07 A;  5A2Q b;  2QA4 1;  2E2I I;  1KQS Z;  3CCM 1;  1VQ9 1;  4TNU A;  3H0G I;  4NOZ A;  4QTT A;  1Y1W I;  2DE5 A;  2V3V A;  3M4O I;  3FQM A;  2NVT I;  3CXC Y;  1S72 1;  3I4N I;  5D1P A;  3CCR 1;  3JAM f;  3PO2 I;  2Q51 A;  1QXF A;  2HU9 A;  3CCV 1;  4Y7N I;  3CXC Z;  3F3P C;  3HOW I;  5IT9 f;  3HOV I;  1X0T A;  3MZL B;  3J81 b;  3KIH A;  2JA7 I;  3CC2 Z;  3NFZ A;  1Y1V S;  1M1K 2;  2J6A A;  1RO0 A;  3EED A;  2R93 I;  2OTJ 1;  1VQ5 1;  2OTL 1;  2W03 A;  4MD9 A;  2G2K A;  1N8R 1;  3MZK B;  3H3V J;  4CL1 A;  2R7Z I;  1R9T I;  1TWA I;  2M48 A;  2PMZ A;  3NDI A;  1ZB8 A;  3LUS A;  2H85 A;  4NB9 A;  4HH4 A;  4NBA A;  1VQL 1;  2B63 I;  2JIM A;  2E2J I;  3CC7 Z;  3I56 1;  1VQ8 1;  3Q87 A;  5LL6 f;  2GU2 A;  2NVY I;  3MON A;  1RQF A;  2F4M A;  1ZH1 A;  2JIP A;  4BBR I;  1SFO I;  3CCQ Z;  3CC4 1;  1YIT 1;  2AKL A;  2ZAE B;  1JJ2 Y;  3TE5 B;  1I50 I;  2LIY A;  3GTO I;  2DE6 A;  2PK7 A;  2VUG A;  1I6H I;  3S1M I;  1JJ2 Z;  2OZK A;  2WB1 A;  2VPY A;  2NAP A;  3NDJ A;  3CME 1;  1QYP A;  3GCF A;  1X3W A;  1QF8 A;  2IZ4 A;  2WAQ A;  2RBL A;  1VQ4 Z;  1K73 2;  3TDH B;  1K8A 2;  4A3M I;  4BY1 I;  3VMI A;  1Y1V I;  2JIR A;  4MD7 A;  1YI2 1;  3CCS 1;  4A3E I;  4NBB A;  1YJN 1;  3S15 I;  4A3L I;  1M90 1;  4EWC A;  4MH4 A;  4S1T A;  3KIF A;  2EGT A;  2AYD A;  1FDO A;  2F4O A;  1VQO Z;  2VPW A;  5C44 I;  3D9X A;  1VQK Z;  4NBF A;  2O4H A;  1YHQ Z;  1M90 2;  1WZN A;  1RO2 A;  3IR7 A;  1QVG Y;  3FKI I;  2NVQ I;  3CD6 Z;  1KC8 2;  2PM9 A;  1QVG Z;  5D1O B;  4A3F I;  1K9M 1;  3G4S Z;  3S17 I;  4RV9 A;  3VB9 A;  2V8K A;  4E2X A;  1RO4 A;  3D2L A;  1VLA A;  2RHB A;  3S2D I;  5FLX f;  1K9M 2;  4DK1 A;  2RIQ A;  1TWF I;  3GTQ I;  5IP9 I;  5D1O A;  1L1O C;  1VQ7 Z;  4NBG A;  1PFT A;  2JMO A;  3G71 1;  1M1K 1;  1VQN Z;  2IZ3 A;  4E31 A;  1ML8 A;  3CQZ I;  3J80 f;  2JNY A;  2IV2 X;  1YUK A;  4BY7 I;  3NH5 A;  3CC7 1;  3VMG A;  2LEX A;  1ZB9 A;  4E2Z A;  2HF1 A;  3IFU A;  3QWU A;  3GTG I;  1X3Z A;  3CCL Z;  2JUB A;  4QTU A;  4A3D I;  3CCQ 1;  3IF8 A;  3F3F C;  2V8J A;  3NH4 A;  1KRL A;  2E7Z A;  4E2Y A;  1USP B;  1FDI A;  3GKQ A;  3JAM b;  3S1R I;  3RZO I;  5IP7 I;  3J7A 4;  1AA6 A;  2P28 A;  3HOX I;  3P5J B;  3BG0 B;  1YJ9 1;  2QRD B;  5IT9 b;  1Z02 A;  2JIO A;  1K73 1;  1VQL Z;  1Z01 A;  2O53 A;  5A2Q f;  2VPZ A;  1K8A 1;  3HOZ I;  2QRE B;  2KI7 B;  4NH1 C;  2Q4Z A;  3CCE Z;  2GTI A;  2E2H I;  3VTN A;  1VQP Z;  2KPI A;  3GTJ I;  3EER A;  1VQK 1;  1YHQ 1;  4A3K I;  1VQ6 Z;  1WJ2 A;  3I55 Z;  2JR6 A;  1QVF Y;  1YIJ Z;  2R92 I;  1TWG I;  2YU9 I;  3CC4 Z;  2QEX Z;  4AYB A;  3T4N B;  1TWH I;  3CD6 1;  3HKZ A;  1JWH C;  1QVF Z;  3J81 f;  3G6E Z;  1KC8 1;  2YAD A;  3G4S 1;  1NP6 A;  1NJI 1;  2Y0S A;  4NFR A;  4MD8 A;  1YJW Z;  2V45 A;  3S14 I;  4NBE A;  2JA8 I;  3CMA Z;  3BG1 B;  3CCU Z;  1RLY A;  1NJI 2;  3M3Y I;  4NBH A;  3D6W A;  4RVH A;  3CCJ Z;  1VQ7 1;  2OOY B;  2W04 A;  4BBS I;  2R6M A;  3S1Q I;  4HGY A;  1VQN 1;  4BXX I;  3CC2 1;  4XX2 A;  2P3Y A;  1TWC I;  2GTH A;  4MXU A;  1WII A;  1VQM Z;  2OOX B;  1RNI A;  4MRI A;  2QA4 Z; 
#chains in the Genus database with same CATH homology
 1N2F A;  4A3C I;  3CCM Z;  1VQ9 Z;  3CPW Y;  3GTM S;  1KD1 1;  2QLV B;  1NUI A;  5AN9 F;  3RZD I;  3CPW Z;  1S72 Z;  2RPR A;  3CCL 1;  1I3Q I;  1KD1 2;  4RVG A;  4X6A I;  1K83 I;  3CCR Z;  1Q81 1;  4MON A;  3CCV Z;  2QR1 B;  2QKD A;  2RT9 A;  1DL6 A;  2VF1 A;  3GTK I;  4DGL A;  1P9N A;  5T6B A;  4RS4 A;  3G71 Z;  1Q81 2;  3FQQ A;  1WCM I;  2K5R A;  3NH8 A;  4NB8 A;  4A3I I;  3S16 I;  2LFU A;  4E32 A;  3S2H I;  2BJO A;  5T67 A;  2OTJ Z;  3PO3 I;  2M6N A;  1VQ5 Z;  1N8R 2;  2OTL Z;  1Q86 1;  4Y52 I;  5FLX b;  3GTP I;  2I3C A;  2NVX I;  4NBD A;  1S7M A;  4NBC A;  5C4J I;  3ESW A;  4DQY B;  3I4M I;  3CCE 1;  1Q86 2;  5CM2 M;  1VQ4 1;  3HOU I;  1USP A;  1Q7Y 1;  1VQP 1;  1YUA A;  5T64 A;  1W2B Y;  2DE7 A;  1WW9 A;  3J80 b;  1VQ6 1;  3I56 Z;  1VQ8 Z;  3I55 1;  4E33 A;  4HGZ A;  1YIJ 1;  2JA5 I;  1Q7Y 2;  1W2B Z;  2QEX 1;  4RVF A;  1VQO 1;  3K7A I;  4E30 A;  5C3E I;  3GTL I;  3GTM I;  3G6E 1;  2JS4 A;  3VMH A;  3U50 C;  1YIT Z;  1YJW 1;  3S1N I;  2JA6 I;  3CMA 1;  2QRC B;  3CCU 1;  1YJ9 Z;  4A93 I;  1Q82 1;  2VUM I;  4E2W A;  3CCJ 1;  4RVD A;  3CME Z;  2K3R A;  1TFI A;  5C4X I;  3PO3 S;  1Q82 2;  4A3J I;  4A3B I;  1LQL A;  4A3G I;  2E9H A;  3OW2 Y;  5FLM I;  1YI2 Z;  3CCS Z;  1YJN Z;  1KQS Y;  3OW2 Z;  1Z03 A;  3HOY I;  2V8I A;  3IX0 A;  1VQM 1;  3I07 A;  5A2Q b;  2QA4 1;  2E2I I;  1KQS Z;  3CCM 1;  1VQ9 1;  4TNU A;  3H0G I;  4NOZ A;  4QTT A;  1Y1W I;  2DE5 A;  3M4O I;  3FQM A;  2NVT I;  3CXC Y;  1S72 1;  3I4N I;  5D1P A;  3CCR 1;  3JAM f;  3PO2 I;  2Q51 A;  2HU9 A;  3CCV 1;  4Y7N I;  3CXC Z;  3F3P C;  3HOW I;  5IT9 f;  3HOV I;  1X0T A;  3MZL B;  3J81 b;  3KIH A;  2JA7 I;  3CC2 Z;  3NFZ A;  1Y1V S;  1M1K 2;  2J6A A;  1RO0 A;  3EED A;  2R93 I;  2OTJ 1;  1VQ5 1;  2OTL 1;  2W03 A;  4MD9 A;  2G2K A;  1N8R 1;  3MZK B;  3H3V J;  4CL1 A;  2R7Z I;  1R9T I;  1TWA I;  2M48 A;  2PMZ A;  3NDI A;  1ZB8 A;  3LUS A;  2H85 A;  4NB9 A;  4HH4 A;  4NBA A;  1VQL 1;  2B63 I;  2E2J I;  3CC7 Z;  3I56 1;  1VQ8 1;  3Q87 A;  5LL6 f;  2GU2 A;  2NVY I;  3MON A;  1RQF A;  2F4M A;  1ZH1 A;  4BBR I;  1SFO I;  3CCQ Z;  3CC4 1;  1YIT 1;  2AKL A;  2ZAE B;  1JJ2 Y;  3TE5 B;  1I50 I;  2LIY A;  3GTO I;  2DE6 A;  2PK7 A;  2VUG A;  1I6H I;  3S1M I;  1JJ2 Z;  2OZK A;  2WB1 A;  3NDJ A;  3CME 1;  1QYP A;  3GCF A;  1X3W A;  1QF8 A;  2IZ4 A;  2WAQ A;  2RBL A;  1VQ4 Z;  1K73 2;  3TDH B;  1K8A 2;  4A3M I;  4BY1 I;  3VMI A;  1Y1V I;  4MD7 A;  1YI2 1;  3CCS 1;  4A3E I;  4NBB A;  1YJN 1;  3S15 I;  4A3L I;  1M90 1;  4EWC A;  4MH4 A;  4S1T A;  3KIF A;  2EGT A;  2F4O A;  1VQO Z;  5C44 I;  3D9X A;  1VQK Z;  4NBF A;  2O4H A;  1YHQ Z;  1M90 2;  1RO2 A;  1QVG Y;  3FKI I;  2NVQ I;  3CD6 Z;  1KC8 2;  2PM9 A;  1QVG Z;  5D1O B;  4A3F I;  1K9M 1;  3G4S Z;  3S17 I;  4RV9 A;  3VB9 A;  2V8K A;  4E2X A;  1RO4 A;  1VLA A;  2RHB A;  3S2D I;  5FLX f;  1K9M 2;  4DK1 A;  2RIQ A;  1TWF I;  3GTQ I;  5IP9 I;  5D1O A;  1L1O C;  1VQ7 Z;  4NBG A;  1PFT A;  2JMO A;  3G71 1;  1M1K 1;  1VQN Z;  2IZ3 A;  4E31 A;  1ML8 A;  3CQZ I;  3J80 f;  2JNY A;  1YUK A;  4BY7 I;  3NH5 A;  3CC7 1;  3VMG A;  1ZB9 A;  4E2Z A;  2HF1 A;  3IFU A;  3QWU A;  3GTG I;  1X3Z A;  3CCL Z;  2JUB A;  4QTU A;  4A3D I;  3CCQ 1;  3IF8 A;  3F3F C;  2V8J A;  3NH4 A;  1KRL A;  4E2Y A;  1USP B;  3GKQ A;  3JAM b;  3S1R I;  3RZO I;  5IP7 I;  3J7A 4;  2P28 A;  3HOX I;  3P5J B;  3BG0 B;  1YJ9 1;  2QRD B;  5IT9 b;  1Z02 A;  1K73 1;  1VQL Z;  1Z01 A;  2O53 A;  5A2Q f;  1K8A 1;  3HOZ I;  2QRE B;  2KI7 B;  4NH1 C;  2Q4Z A;  3CCE Z;  2GTI A;  2E2H I;  3VTN A;  1VQP Z;  2KPI A;  3GTJ I;  3EER A;  1VQK 1;  1YHQ 1;  4A3K I;  1VQ6 Z;  3I55 Z;  2JR6 A;  1QVF Y;  1YIJ Z;  2R92 I;  1TWG I;  2YU9 I;  3CC4 Z;  2QEX Z;  4AYB A;  3T4N B;  1TWH I;  3CD6 1;  3HKZ A;  1JWH C;  1QVF Z;  3J81 f;  3G6E Z;  1KC8 1;  2YAD A;  3G4S 1;  1NP6 A;  1NJI 1;  2Y0S A;  4NFR A;  4MD8 A;  1YJW Z;  3S14 I;  4NBE A;  2JA8 I;  3CMA Z;  3BG1 B;  3CCU Z;  1RLY A;  1NJI 2;  3M3Y I;  4NBH A;  3D6W A;  4RVH A;  3CCJ Z;  1VQ7 1;  2OOY B;  2W04 A;  4BBS I;  2R6M A;  3S1Q I;  4HGY A;  1VQN 1;  4BXX I;  3CC2 1;  4XX2 A;  2P3Y A;  1TWC I;  2GTH A;  4MXU A;  1WII A;  1VQM Z;  2OOX B;  1RNI A;  4MRI A;  2QA4 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...