1W2BY

Trigger factor ribosome binding domain in complex with 50s
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trigger Factor in Complex with the Ribosome Forms a Molecular Cradle for Nascent Proteins
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 11
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1w2bY00
1K9M2 3CD61 3I55Z 1YJW1 1VQ51 3CXCY 3CCUZ 1VQK1 3G6E1 1YJN1 2OTLZ 1VQOZ 3CCJ1 1VQ81 1VQKZ 1Q862 1VQN1 1VQ6Z 3CCRZ 1K731 1YJ9Z 3CC41 2QEX1 3I551 3CCVZ 1KQSY 1YIT1 3CCQ1 1QVGZ 3CCQZ 3CCJZ 3CCV1 2OTL1 3CCSZ 1VQMZ 3CPWY 1N8R1 3CMEZ 3OW2Z 1QVFZ 3CD6Z 1Q811 3I561 1KD11 1M1K1 1VQPZ 3CC21 2QEXZ 1YJ91 2QA41 1VQNZ 1VQ41 1VQ8Z 1VQ9Z 1S72Z 3CXCZ 3CCL1 1Q7Y1 3CCEZ 1VQ91 3CPWZ 1Q812 3CCS1 1VQL1 1N8R2 3G6EZ 2OTJZ 3CCLZ 3CC71 3CMA1 1W2BY 1Q821 3CC2Z 1KQSZ 1Q861 3CMAZ 1VQ61 1YIJZ 3CME1 2QA4Z 1M902 3CCE1 3CCR1 1YJWZ 3G4S1 1VQ7Z 1YHQZ 1YI21 1YJNZ 1W2BZ 1VQ4Z 1KC82 1K8A2 2OTJ1 3OW2Y 1M1K2 1QVGY 1KD12 3CC4Z 1KC81 1K8A1 1JJ2Y 1JJ2Z 1VQM1 1M901 1YIJ1 1YHQ1 1YI2Z 1VQP1 1QVFY 3CCU1 1Q822 1K732 1NJI2 1NJI1 1VQO1 1VQ71 3I56Z 3G4SZ 3CCMZ 1S721 1Q7Y2 3CCM1 1YITZ 1VQLZ 3G711 3CC7Z 1K9M1 1VQ5Z 3G71Z
chains in the Genus database with same CATH superfamily
2VPXA 1K9M2 3CD61 4NFRA 4AYBA 2OTLZ 3HOYI 1Y1VS 4RVFA 3J81f 1VQ81 4A3DI 4A3FI 1VQ6Z 1LQLA 3CCRZ 2JS4A 3CC41 1YJ9Z 2QEX1 3CCVZ 3CCQ1 5AN9F 2R93I 4RVDA 3J7A4 3FKII 3JAMb 1RO4A 3CCJZ 4NBDA 3S17I 3CCSZ 2YU9I 4EWCA 2W04A 1N8R1 2VUMI 1FDOA 2E2HI 1Y1VI 1Q811 1M1K1 3H0GI 1VQPZ 3GTJI 4A3KI 3S1RI 4E2WA 3GTMS 1AA6A 2QA41 1VQNZ 2IZ4A 4HH4A 4BBRI 2R6MA 1K83I 1VQ9Z 1WZNA 1WJ2A 2QRDB 2V8JA 5C3EI 3CCS1 3NFZA 3D2LA 3IX0A 2RIQA 1W2BY 3BG1B 1Q821 3CC2Z 1USPA 3PO2I 1KQSZ 1Q861 2KPIA 2VPYA 1TWFI 1VQ61 3CME1 1M902 2QREB 2OOXB 3S1NI 3CCE1 3CCR1 2RHBA 1VQ7Z 1N2FA 2AYDA 4NBHA 1FDIA 1TWHI 3NH4A 1QVGY 4MXUA 1KC81 3S15I 1NP6A 2RBLA 3VB9A 2JIQA 3GTKI 2E9HA 1Q16A 3HOZI 2GTHA 2W03A 2J6AA 4E2ZA 4MRIA 4BXXI 5IP7I 3S1QI 2DE6A 1K732 3GTLI 3I4NI 2IV2X 1NJI1 2E2JI 2JIMA 3I56Z 2HF1A 3S2HI 2V8IA 2Q4ZA 1I3QI 1ZB8A 2DE7A 2HU9A 1SFOI 4S1TA 3G71Z 1TFIA 1RO0A 2O4HA 2PM9A 3GCFA 3I55Z 1YJN1 1RNIA 1VQOZ 3CCJ1 2JMOA 1VQKZ 2JA8I 2M48A 4CL1A 1K731 1QYPA 1I50I 3I551 2JR6A 3BG0B 4NBCA 2I3CA 2OTL1 1VQMZ 3TE5B 2LEXA 2Y0SA 2R92I 3CD6Z 1Z01A 3I561 3H3VJ 3CC21 4RVHA 1VQ41 3VMGA 4E33A 3TDHB 3CCL1 2K5RA 1Q7Y1 2E7ZA 3GTGI 2JIRA 4NOZA 5T67A 4A3MI 4DQYB 3CCLZ 2VPZA 3CMA1 1I6HI 2V3VA 3F3FC 2NVYI 5A2Qf 2E2II 1X0TA 4NH1C 4BY1I 4A3BI 2LFUA 3IR7A 1TWAI 3G4S1 4A3LI 5IP9I 1RLYA 1SIWA 2VUGA 2V8KA 1K8A2 1M1K2 1L1OC 3CC4Z 4Y52I 1R9TI 1K8A1 2K3RA 2IZ3A 1ML8A 2OZKA 2AKLA 5LL6f 3MZLB 4TNUA 1WCMI 3J80f 1YIJ1 4NB8A 5D1OA 4E2XA 3EEDA 2P28A 4RS4A 1NJI2 3RZOI 1VQ71 3G4SZ 3CCMZ 3K7AI 1S721 2NVXI 1Q7Y2 1YUAA 2OOYB 1VQLZ 1K9M1 1VQ5Z 5C4XI 3VMIA 1YJW1 3NDIA 1VQK1 2LIYA 1P9NA 1Q862 1VQN1 2JUBA 2QKDA 4NBGA 4DK1A 2PMZA 1X3ZA 1ZH1A 3MONA 1USPB 3LUSA 4NBAA 3CCQZ 3D9XA 3CCV1 4MD9A 3CPWY 4RVGA 3CMEZ 1Z02A 1KD11 4NB9A 4MONA 3GKQA 2ZAEB 1VQ8Z 5FLXf 2P3YA 2R7ZI 3CXCZ 1TWCI 4HGZA 1VQ91 1Q812 3CQZI 1YUKA 1VQL1 1N8R2 2V45A 1QF8A 3RZDI 2NVQI 1VLAA 1YIJZ 3QWUA 2QA4Z 1TWGI 3I4MI 2YADA 1DL6A 1YJWZ 1JWHC 2M6NA 2WB1A 2JIOA 3MZKB 1YHQZ 1W2BZ 1KC82 2QR1B 3J81b 3Q87A 4E31A 3S14I 3HOVI 4A3CI 4NBFA 3KIHA 3HOWI 2JNYA 1VQM1 4DGLA 3HOXI 3S2DI 3S16I 3PO3I 3D6WA 4E2YA 1M901 1Y8CA 1YI2Z 1VQP1 2DE5A 3FQMA 1Q822 4BY7I 5C4JI 5CM2M 2JA5I 4QTUA 3CC7Z 2F4OA 3U50C 1RO2A 3GTQI 3NDJA 4MD7A 1VQ51 3CXCY 3CCUZ 4QTTA 2F4MA 5D1OB 3HKZA 4HGYA 3JAMf 3G6E1 1RQFA 2RT9A 3NH5A 3P5JB 3VMHA 4A93I 3GTPI 5FLXb 1X3WA 2KI7B 2NAPA 2JA6I 2QLVB 5C44I 5T6BA 1Y1WI 1KQSY 1YIT1 5D1PA 3S1MI 5T64A 2H85A 5FLMI 3FQQA 1QVGZ 3T4NB 1WW9A 4MD8A 1WIIA 2GU2A 4MH4A 3OW2Z 1QVFZ 2VF1A 1S7MA 2QRCB 2BJOA 2JIPA 2B63I 2QEXZ 4X6AI 5IT9b 1YJ91 3J80b 3IFUA 3PO3S 1S72Z 2WAQA 2PK7A 2VPWA 3IF8A 3CCEZ 3I07A 3CPWZ 3GTMI 3KIFA 4E30A 3G6EZ 2OTJZ 2G2KA 3CC71 2NVTI 2O53A 1QXFA 3CMAZ 4XX2A 4A3JI 2RPRA 3NH8A 3HOUI 4NBEA 1YI21 1YJNZ 1VQ4Z 2EGTA 4RV9A 2OTJ1 1NUIA 3OW2Y 2JA7I 1KD12 2GTIA 3M3YI 4E32A 3ESWA 1JJ2Y 1JJ2Z 1KRLA 3F3PC 4A3II 2Q51A 1YHQ1 4BBSI 4A3EI 1QVFY 3CCU1 3EERA 1Z03A 1VQO1 3M4OI 3GTOI 4A3GI 3CCM1 1YITZ 5IT9f 5A2Qb 3VTNA 3G711 4Y7NI 1ZB9A 1PFTA 4NBBA
chains in the Genus database with same CATH topology
1K9M2 3CD61 4NFRA 4AYBA 2OTLZ 3HOYI 1Y1VS 4RVFA 3J81f 1VQ81 4A3DI 4A3FI 1VQ6Z 1LQLA 3CCRZ 2JS4A 3CC41 1YJ9Z 2QEX1 3CCVZ 3CCQ1 5AN9F 2R93I 4RVDA 3J7A4 3FKII 3JAMb 1RO4A 3CCJZ 4NBDA 3S17I 3CCSZ 2YU9I 4EWCA 2W04A 1N8R1 2VUMI 2E2HI 1Y1VI 1Q811 1M1K1 3H0GI 1VQPZ 3GTJI 4A3KI 3S1RI 4E2WA 3GTMS 2QA41 1VQNZ 2IZ4A 4HH4A 4BBRI 2R6MA 1K83I 1VQ9Z 2QRDB 2V8JA 5C3EI 3CCS1 3NFZA 3IX0A 2RIQA 1W2BY 3BG1B 1Q821 3CC2Z 1USPA 3PO2I 1KQSZ 1Q861 2KPIA 1TWFI 1VQ61 3CME1 1M902 2QREB 2OOXB 3S1NI 3CCE1 3CCR1 2RHBA 1VQ7Z 1N2FA 4NBHA 1TWHI 3NH4A 1QVGY 4MXUA 1KC81 3S15I 1NP6A 2RBLA 3VB9A 3GTKI 2E9HA 3HOZI 2GTHA 2W03A 2J6AA 4E2ZA 4MRIA 4BXXI 5IP7I 3S1QI 2DE6A 1K732 3GTLI 3I4NI 1NJI1 2E2JI 3I56Z 2HF1A 3S2HI 2V8IA 2Q4ZA 1I3QI 1ZB8A 2DE7A 2HU9A 1SFOI 4S1TA 3G71Z 1TFIA 1RO0A 2O4HA 2PM9A 3GCFA 3I55Z 1YJN1 1RNIA 1VQOZ 3CCJ1 2JMOA 1VQKZ 2JA8I 2M48A 4CL1A 1K731 1QYPA 1I50I 3I551 2JR6A 3BG0B 4NBCA 2I3CA 2OTL1 1VQMZ 3TE5B 2Y0SA 2R92I 3CD6Z 1Z01A 3I561 3H3VJ 3CC21 4RVHA 1VQ41 3VMGA 4E33A 3TDHB 3CCL1 2K5RA 1Q7Y1 3GTGI 5T67A 4NOZA 4A3MI 4DQYB 3CCLZ 3CMA1 1I6HI 3F3FC 2NVYI 5A2Qf 2E2II 1X0TA 4NH1C 4BY1I 4A3BI 2LFUA 1TWAI 3G4S1 4A3LI 5IP9I 1RLYA 2VUGA 2V8KA 1K8A2 1M1K2 1L1OC 3CC4Z 4Y52I 1R9TI 1K8A1 2K3RA 2IZ3A 1ML8A 2OZKA 2AKLA 5LL6f 3MZLB 4TNUA 1WCMI 3J80f 1YIJ1 4NB8A 5D1OA 4E2XA 3EEDA 2P28A 4RS4A 1NJI2 3RZOI 1VQ71 3G4SZ 3CCMZ 3K7AI 1S721 2NVXI 1Q7Y2 1YUAA 2OOYB 1VQLZ 1K9M1 1VQ5Z 5C4XI 3VMIA 1YJW1 3NDIA 1VQK1 2LIYA 1P9NA 1Q862 1VQN1 2JUBA 2QKDA 4NBGA 4DK1A 2PMZA 1X3ZA 1ZH1A 3MONA 1USPB 3LUSA 4NBAA 3CCQZ 3D9XA 3CCV1 4MD9A 3CPWY 4RVGA 3CMEZ 1Z02A 1KD11 4NB9A 4MONA 3GKQA 2ZAEB 1VQ8Z 5FLXf 2P3YA 2R7ZI 3CXCZ 1TWCI 4HGZA 1VQ91 1Q812 3CQZI 1YUKA 1VQL1 1N8R2 1QF8A 3RZDI 2NVQI 1VLAA 1YIJZ 3QWUA 2QA4Z 1TWGI 3I4MI 2YADA 1DL6A 1YJWZ 1JWHC 2M6NA 2WB1A 3MZKB 1YHQZ 1W2BZ 1KC82 2QR1B 3J81b 3Q87A 4E31A 3S14I 3HOVI 4A3CI 4NBFA 3KIHA 3HOWI 2JNYA 1VQM1 4DGLA 3HOXI 3S2DI 3S16I 3PO3I 3D6WA 4E2YA 1M901 1YI2Z 1VQP1 2DE5A 3FQMA 1Q822 4BY7I 5C4JI 5CM2M 2JA5I 4QTUA 3CC7Z 2F4OA 3U50C 1RO2A 3GTQI 3NDJA 4MD7A 1VQ51 3CXCY 3CCUZ 4QTTA 2F4MA 5D1OB 3HKZA 4HGYA 3JAMf 3G6E1 1RQFA 2RT9A 3NH5A 3P5JB 3VMHA 4A93I 3GTPI 5FLXb 1X3WA 2KI7B 2JA6I 2QLVB 5C44I 5T6BA 1Y1WI 1KQSY 1YIT1 5D1PA 3S1MI 5T64A 2H85A 5FLMI 3FQQA 1QVGZ 3T4NB 1WW9A 4MD8A 1WIIA 2GU2A 4MH4A 3OW2Z 1QVFZ 2VF1A 1S7MA 2QRCB 2BJOA 2B63I 2QEXZ 4X6AI 5IT9b 1YJ91 3J80b 3IFUA 3PO3S 1S72Z 2WAQA 2PK7A 3IF8A 3CCEZ 3I07A 3CPWZ 3GTMI 3KIFA 4E30A 3G6EZ 2OTJZ 2G2KA 3CC71 2NVTI 2O53A 3CMAZ 4XX2A 4A3JI 2RPRA 3NH8A 3HOUI 4NBEA 1YI21 1YJNZ 1VQ4Z 2EGTA 4RV9A 2OTJ1 1NUIA 3OW2Y 2JA7I 1KD12 2GTIA 3M3YI 4E32A 3ESWA 1JJ2Y 1JJ2Z 1KRLA 3F3PC 4A3II 2Q51A 1YHQ1 4BBSI 4A3EI 1QVFY 3CCU1 3EERA 1Z03A 1VQO1 3M4OI 3GTOI 4A3GI 3CCM1 1YITZ 5IT9f 5A2Qb 3VTNA 3G711 4Y7NI 1ZB9A 1PFTA 4NBBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9M 2;  3CD6 1;  3I55 Z;  1YJW 1;  1VQ5 1;  3CXC Y;  3CCU Z;  1VQK 1;  3G6E 1;  1YJN 1;  2OTL Z;  1VQO Z;  3CCJ 1;  1VQ8 1;  1VQK Z;  1Q86 2;  1VQN 1;  1VQ6 Z;  3CCR Z;  1K73 1;  1YJ9 Z;  3CC4 1;  2QEX 1;  3I55 1;  3CCV Z;  1KQS Y;  1YIT 1;  3CCQ 1;  1QVG Z;  3CCQ Z;  3CCJ Z;  3CCV 1;  2OTL 1;  3CCS Z;  1VQM Z;  3CPW Y;  1N8R 1;  3CME Z;  3OW2 Z;  1QVF Z;  3CD6 Z;  1Q81 1;  3I56 1;  1KD1 1;  1M1K 1;  1VQP Z;  3CC2 1;  2QEX Z;  1YJ9 1;  2QA4 1;  1VQN Z;  1VQ4 1;  1VQ8 Z;  1VQ9 Z;  1S72 Z;  3CXC Z;  3CCL 1;  1Q7Y 1;  3CCE Z;  1VQ9 1;  3CPW Z;  1Q81 2;  3CCS 1;  1VQL 1;  1N8R 2;  3G6E Z;  2OTJ Z;  3CCL Z;  3CC7 1;  3CMA 1;  1W2B Y;  1Q82 1;  3CC2 Z;  1KQS Z;  1Q86 1;  3CMA Z;  1VQ6 1;  1YIJ Z;  3CME 1;  2QA4 Z;  1M90 2;  3CCE 1;  3CCR 1;  1YJW Z;  3G4S 1;  1VQ7 Z;  1YHQ Z;  1YI2 1;  1YJN Z;  1W2B Z;  1VQ4 Z;  1KC8 2;  1K8A 2;  2OTJ 1;  3OW2 Y;  1M1K 2;  1QVG Y;  1KD1 2;  3CC4 Z;  1KC8 1;  1K8A 1;  1JJ2 Y;  1JJ2 Z;  1VQM 1;  1M90 1;  1YIJ 1;  1YHQ 1;  1YI2 Z;  1VQP 1;  1QVF Y;  3CCU 1;  1Q82 2;  1K73 2;  1NJI 2;  1NJI 1;  1VQO 1;  1VQ7 1;  3I56 Z;  3G4S Z;  3CCM Z;  1S72 1;  1Q7Y 2;  3CCM 1;  1YIT Z;  1VQL Z;  3G71 1;  3CC7 Z;  1K9M 1;  1VQ5 Z;  3G71 Z; 
#chains in the Genus database with same CATH topology
 2VPX A;  1K9M 2;  3CD6 1;  4NFR A;  4AYB A;  2OTL Z;  3HOY I;  1Y1V S;  4RVF A;  3J81 f;  1VQ8 1;  4A3D I;  4A3F I;  1VQ6 Z;  1LQL A;  3CCR Z;  2JS4 A;  3CC4 1;  1YJ9 Z;  2QEX 1;  3CCV Z;  3CCQ 1;  5AN9 F;  2R93 I;  4RVD A;  3J7A 4;  3FKI I;  3JAM b;  1RO4 A;  3CCJ Z;  4NBD A;  3S17 I;  3CCS Z;  2YU9 I;  4EWC A;  2W04 A;  1N8R 1;  2VUM I;  1FDO A;  2E2H I;  1Y1V I;  1Q81 1;  1M1K 1;  3H0G I;  1VQP Z;  3GTJ I;  4A3K I;  3S1R I;  4E2W A;  3GTM S;  1AA6 A;  2QA4 1;  1VQN Z;  2IZ4 A;  4HH4 A;  4BBR I;  2R6M A;  1K83 I;  1VQ9 Z;  1WZN A;  1WJ2 A;  2QRD B;  2V8J A;  5C3E I;  3CCS 1;  3NFZ A;  3D2L A;  3IX0 A;  2RIQ A;  1W2B Y;  3BG1 B;  1Q82 1;  3CC2 Z;  1USP A;  3PO2 I;  1KQS Z;  1Q86 1;  2KPI A;  2VPY A;  1TWF I;  1VQ6 1;  3CME 1;  1M90 2;  2QRE B;  2OOX B;  3S1N I;  3CCE 1;  3CCR 1;  2RHB A;  1VQ7 Z;  1N2F A;  2AYD A;  4NBH A;  1FDI A;  1TWH I;  3NH4 A;  1QVG Y;  4MXU A;  1KC8 1;  3S15 I;  1NP6 A;  2RBL A;  3VB9 A;  2JIQ A;  3GTK I;  2E9H A;  1Q16 A;  3HOZ I;  2GTH A;  2W03 A;  2J6A A;  4E2Z A;  4MRI A;  4BXX I;  5IP7 I;  3S1Q I;  2DE6 A;  1K73 2;  3GTL I;  3I4N I;  2IV2 X;  1NJI 1;  2E2J I;  2JIM A;  3I56 Z;  2HF1 A;  3S2H I;  2V8I A;  2Q4Z A;  1I3Q I;  1ZB8 A;  2DE7 A;  2HU9 A;  1SFO I;  4S1T A;  3G71 Z;  1TFI A;  1RO0 A;  2O4H A;  2PM9 A;  3GCF A;  3I55 Z;  1YJN 1;  1RNI A;  1VQO Z;  3CCJ 1;  2JMO A;  1VQK Z;  2JA8 I;  2M48 A;  4CL1 A;  1K73 1;  1QYP A;  1I50 I;  3I55 1;  2JR6 A;  3BG0 B;  4NBC A;  2I3C A;  2OTL 1;  1VQM Z;  3TE5 B;  2LEX A;  2Y0S A;  2R92 I;  3CD6 Z;  1Z01 A;  3I56 1;  3H3V J;  3CC2 1;  4RVH A;  1VQ4 1;  3VMG A;  4E33 A;  3TDH B;  3CCL 1;  2K5R A;  1Q7Y 1;  2E7Z A;  3GTG I;  2JIR A;  4NOZ A;  5T67 A;  4A3M I;  4DQY B;  3CCL Z;  2VPZ A;  3CMA 1;  1I6H I;  2V3V A;  3F3F C;  2NVY I;  5A2Q f;  2E2I I;  1X0T A;  4NH1 C;  4BY1 I;  4A3B I;  2LFU A;  3IR7 A;  1TWA I;  3G4S 1;  4A3L I;  5IP9 I;  1RLY A;  1SIW A;  2VUG A;  2V8K A;  1K8A 2;  1M1K 2;  1L1O C;  3CC4 Z;  4Y52 I;  1R9T I;  1K8A 1;  2K3R A;  2IZ3 A;  1ML8 A;  2OZK A;  2AKL A;  5LL6 f;  3MZL B;  4TNU A;  1WCM I;  3J80 f;  1YIJ 1;  4NB8 A;  5D1O A;  4E2X A;  3EED A;  2P28 A;  4RS4 A;  1NJI 2;  3RZO I;  1VQ7 1;  3G4S Z;  3CCM Z;  3K7A I;  1S72 1;  2NVX I;  1Q7Y 2;  1YUA A;  2OOY B;  1VQL Z;  1K9M 1;  1VQ5 Z;  5C4X I;  3VMI A;  1YJW 1;  3NDI A;  1VQK 1;  2LIY A;  1P9N A;  1Q86 2;  1VQN 1;  2JUB A;  2QKD A;  4NBG A;  4DK1 A;  2PMZ A;  1X3Z A;  1ZH1 A;  3MON A;  1USP B;  3LUS A;  4NBA A;  3CCQ Z;  3D9X A;  3CCV 1;  4MD9 A;  3CPW Y;  4RVG A;  3CME Z;  1Z02 A;  1KD1 1;  4NB9 A;  4MON A;  3GKQ A;  2ZAE B;  1VQ8 Z;  5FLX f;  2P3Y A;  2R7Z I;  3CXC Z;  1TWC I;  4HGZ A;  1VQ9 1;  1Q81 2;  3CQZ I;  1YUK A;  1VQL 1;  1N8R 2;  2V45 A;  1QF8 A;  3RZD I;  2NVQ I;  1VLA A;  1YIJ Z;  3QWU A;  2QA4 Z;  1TWG I;  3I4M I;  2YAD A;  1DL6 A;  1YJW Z;  1JWH C;  2M6N A;  2WB1 A;  2JIO A;  3MZK B;  1YHQ Z;  1W2B Z;  1KC8 2;  2QR1 B;  3J81 b;  3Q87 A;  4E31 A;  3S14 I;  3HOV I;  4A3C I;  4NBF A;  3KIH A;  3HOW I;  2JNY A;  1VQM 1;  4DGL A;  3HOX I;  3S2D I;  3S16 I;  3PO3 I;  3D6W A;  4E2Y A;  1M90 1;  1Y8C A;  1YI2 Z;  1VQP 1;  2DE5 A;  3FQM A;  1Q82 2;  4BY7 I;  5C4J I;  5CM2 M;  2JA5 I;  4QTU A;  3CC7 Z;  2F4O A;  3U50 C;  1RO2 A;  3GTQ I;  3NDJ A;  4MD7 A;  1VQ5 1;  3CXC Y;  3CCU Z;  4QTT A;  2F4M A;  5D1O B;  3HKZ A;  4HGY A;  3JAM f;  3G6E 1;  1RQF A;  2RT9 A;  3NH5 A;  3P5J B;  3VMH A;  4A93 I;  3GTP I;  5FLX b;  1X3W A;  2KI7 B;  2NAP A;  2JA6 I;  2QLV B;  5C44 I;  5T6B A;  1Y1W I;  1KQS Y;  1YIT 1;  5D1P A;  3S1M I;  5T64 A;  2H85 A;  5FLM I;  3FQQ A;  1QVG Z;  3T4N B;  1WW9 A;  4MD8 A;  1WII A;  2GU2 A;  4MH4 A;  3OW2 Z;  1QVF Z;  2VF1 A;  1S7M A;  2QRC B;  2BJO A;  2JIP A;  2B63 I;  2QEX Z;  4X6A I;  5IT9 b;  1YJ9 1;  3J80 b;  3IFU A;  3PO3 S;  1S72 Z;  2WAQ A;  2PK7 A;  2VPW A;  3IF8 A;  3CCE Z;  3I07 A;  3CPW Z;  3GTM I;  3KIF A;  4E30 A;  3G6E Z;  2OTJ Z;  2G2K A;  3CC7 1;  2NVT I;  2O53 A;  1QXF A;  3CMA Z;  4XX2 A;  4A3J I;  2RPR A;  3NH8 A;  3HOU I;  4NBE A;  1YI2 1;  1YJN Z;  1VQ4 Z;  2EGT A;  4RV9 A;  2OTJ 1;  1NUI A;  3OW2 Y;  2JA7 I;  1KD1 2;  2GTI A;  3M3Y I;  4E32 A;  3ESW A;  1JJ2 Y;  1JJ2 Z;  1KRL A;  3F3P C;  4A3I I;  2Q51 A;  1YHQ 1;  4BBS I;  4A3E I;  1QVF Y;  3CCU 1;  3EER A;  1Z03 A;  1VQO 1;  3M4O I;  3GTO I;  4A3G I;  3CCM 1;  1YIT Z;  5IT9 f;  5A2Q b;  3VTN A;  3G71 1;  4Y7N I;  1ZB9 A;  1PFT A;  4NBB A; 
#chains in the Genus database with same CATH homology
 1K9M 2;  3CD6 1;  4NFR A;  4AYB A;  2OTL Z;  3HOY I;  1Y1V S;  4RVF A;  3J81 f;  1VQ8 1;  4A3D I;  4A3F I;  1VQ6 Z;  1LQL A;  3CCR Z;  2JS4 A;  3CC4 1;  1YJ9 Z;  2QEX 1;  3CCV Z;  3CCQ 1;  5AN9 F;  2R93 I;  4RVD A;  3J7A 4;  3FKI I;  3JAM b;  1RO4 A;  3CCJ Z;  4NBD A;  3S17 I;  3CCS Z;  2YU9 I;  4EWC A;  2W04 A;  1N8R 1;  2VUM I;  2E2H I;  1Y1V I;  1Q81 1;  1M1K 1;  3H0G I;  1VQP Z;  3GTJ I;  4A3K I;  3S1R I;  4E2W A;  3GTM S;  2QA4 1;  1VQN Z;  2IZ4 A;  4HH4 A;  4BBR I;  2R6M A;  1K83 I;  1VQ9 Z;  2QRD B;  2V8J A;  5C3E I;  3CCS 1;  3NFZ A;  3IX0 A;  2RIQ A;  1W2B Y;  3BG1 B;  1Q82 1;  3CC2 Z;  1USP A;  3PO2 I;  1KQS Z;  1Q86 1;  2KPI A;  1TWF I;  1VQ6 1;  3CME 1;  1M90 2;  2QRE B;  2OOX B;  3S1N I;  3CCE 1;  3CCR 1;  2RHB A;  1VQ7 Z;  1N2F A;  4NBH A;  1TWH I;  3NH4 A;  1QVG Y;  4MXU A;  1KC8 1;  3S15 I;  1NP6 A;  2RBL A;  3VB9 A;  3GTK I;  2E9H A;  3HOZ I;  2GTH A;  2W03 A;  2J6A A;  4E2Z A;  4MRI A;  4BXX I;  5IP7 I;  3S1Q I;  2DE6 A;  1K73 2;  3GTL I;  3I4N I;  1NJI 1;  2E2J I;  3I56 Z;  2HF1 A;  3S2H I;  2V8I A;  2Q4Z A;  1I3Q I;  1ZB8 A;  2DE7 A;  2HU9 A;  1SFO I;  4S1T A;  3G71 Z;  1TFI A;  1RO0 A;  2O4H A;  2PM9 A;  3GCF A;  3I55 Z;  1YJN 1;  1RNI A;  1VQO Z;  3CCJ 1;  2JMO A;  1VQK Z;  2JA8 I;  2M48 A;  4CL1 A;  1K73 1;  1QYP A;  1I50 I;  3I55 1;  2JR6 A;  3BG0 B;  4NBC A;  2I3C A;  2OTL 1;  1VQM Z;  3TE5 B;  2Y0S A;  2R92 I;  3CD6 Z;  1Z01 A;  3I56 1;  3H3V J;  3CC2 1;  4RVH A;  1VQ4 1;  3VMG A;  4E33 A;  3TDH B;  3CCL 1;  2K5R A;  1Q7Y 1;  3GTG I;  5T67 A;  4NOZ A;  4A3M I;  4DQY B;  3CCL Z;  3CMA 1;  1I6H I;  3F3F C;  2NVY I;  5A2Q f;  2E2I I;  1X0T A;  4NH1 C;  4BY1 I;  4A3B I;  2LFU A;  1TWA I;  3G4S 1;  4A3L I;  5IP9 I;  1RLY A;  2VUG A;  2V8K A;  1K8A 2;  1M1K 2;  1L1O C;  3CC4 Z;  4Y52 I;  1R9T I;  1K8A 1;  2K3R A;  2IZ3 A;  1ML8 A;  2OZK A;  2AKL A;  5LL6 f;  3MZL B;  4TNU A;  1WCM I;  3J80 f;  1YIJ 1;  4NB8 A;  5D1O A;  4E2X A;  3EED A;  2P28 A;  4RS4 A;  1NJI 2;  3RZO I;  1VQ7 1;  3G4S Z;  3CCM Z;  3K7A I;  1S72 1;  2NVX I;  1Q7Y 2;  1YUA A;  2OOY B;  1VQL Z;  1K9M 1;  1VQ5 Z;  5C4X I;  3VMI A;  1YJW 1;  3NDI A;  1VQK 1;  2LIY A;  1P9N A;  1Q86 2;  1VQN 1;  2JUB A;  2QKD A;  4NBG A;  4DK1 A;  2PMZ A;  1X3Z A;  1ZH1 A;  3MON A;  1USP B;  3LUS A;  4NBA A;  3CCQ Z;  3D9X A;  3CCV 1;  4MD9 A;  3CPW Y;  4RVG A;  3CME Z;  1Z02 A;  1KD1 1;  4NB9 A;  4MON A;  3GKQ A;  2ZAE B;  1VQ8 Z;  5FLX f;  2P3Y A;  2R7Z I;  3CXC Z;  1TWC I;  4HGZ A;  1VQ9 1;  1Q81 2;  3CQZ I;  1YUK A;  1VQL 1;  1N8R 2;  1QF8 A;  3RZD I;  2NVQ I;  1VLA A;  1YIJ Z;  3QWU A;  2QA4 Z;  1TWG I;  3I4M I;  2YAD A;  1DL6 A;  1YJW Z;  1JWH C;  2M6N A;  2WB1 A;  3MZK B;  1YHQ Z;  1W2B Z;  1KC8 2;  2QR1 B;  3J81 b;  3Q87 A;  4E31 A;  3S14 I;  3HOV I;  4A3C I;  4NBF A;  3KIH A;  3HOW I;  2JNY A;  1VQM 1;  4DGL A;  3HOX I;  3S2D I;  3S16 I;  3PO3 I;  3D6W A;  4E2Y A;  1M90 1;  1YI2 Z;  1VQP 1;  2DE5 A;  3FQM A;  1Q82 2;  4BY7 I;  5C4J I;  5CM2 M;  2JA5 I;  4QTU A;  3CC7 Z;  2F4O A;  3U50 C;  1RO2 A;  3GTQ I;  3NDJ A;  4MD7 A;  1VQ5 1;  3CXC Y;  3CCU Z;  4QTT A;  2F4M A;  5D1O B;  3HKZ A;  4HGY A;  3JAM f;  3G6E 1;  1RQF A;  2RT9 A;  3NH5 A;  3P5J B;  3VMH A;  4A93 I;  3GTP I;  5FLX b;  1X3W A;  2KI7 B;  2JA6 I;  2QLV B;  5C44 I;  5T6B A;  1Y1W I;  1KQS Y;  1YIT 1;  5D1P A;  3S1M I;  5T64 A;  2H85 A;  5FLM I;  3FQQ A;  1QVG Z;  3T4N B;  1WW9 A;  4MD8 A;  1WII A;  2GU2 A;  4MH4 A;  3OW2 Z;  1QVF Z;  2VF1 A;  1S7M A;  2QRC B;  2BJO A;  2B63 I;  2QEX Z;  4X6A I;  5IT9 b;  1YJ9 1;  3J80 b;  3IFU A;  3PO3 S;  1S72 Z;  2WAQ A;  2PK7 A;  3IF8 A;  3CCE Z;  3I07 A;  3CPW Z;  3GTM I;  3KIF A;  4E30 A;  3G6E Z;  2OTJ Z;  2G2K A;  3CC7 1;  2NVT I;  2O53 A;  3CMA Z;  4XX2 A;  4A3J I;  2RPR A;  3NH8 A;  3HOU I;  4NBE A;  1YI2 1;  1YJN Z;  1VQ4 Z;  2EGT A;  4RV9 A;  2OTJ 1;  1NUI A;  3OW2 Y;  2JA7 I;  1KD1 2;  2GTI A;  3M3Y I;  4E32 A;  3ESW A;  1JJ2 Y;  1JJ2 Z;  1KRL A;  3F3P C;  4A3I I;  2Q51 A;  1YHQ 1;  4BBS I;  4A3E I;  1QVF Y;  3CCU 1;  3EER A;  1Z03 A;  1VQO 1;  3M4O I;  3GTO I;  4A3G I;  3CCM 1;  1YIT Z;  5IT9 f;  5A2Q b;  3VTN A;  3G71 1;  4Y7N I;  1ZB9 A;  1PFT A;  4NBB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...