1W2BY

Trigger factor ribosome binding domain in complex with 50s
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trigger Factor in Complex with the Ribosome Forms a Molecular Cradle for Nascent Proteins
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 11
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1w2bY00
3CCR1 2QEX1 1VQL1 3I56Z 1VQP1 3CCV1 1W2BZ 1KD11 3CD6Z 3CCQ1 1M902 3CCRZ 1YI2Z 1VQ9Z 1K8A1 3CXCZ 1VQPZ 3CCS1 1VQO1 3OW2Z 1NJI2 3G4SZ 1VQN1 3G711 1JJ2Y 1M1K1 2QA41 1YHQZ 2OTL1 1VQ4Z 3CCE1 1YJW1 1VQ51 3CCMZ 3CCUZ 3G4S1 1K731 3CPWY 1VQM1 3CCVZ 3CC2Z 3CCM1 1Q811 3CCQZ 1K9M2 1VQ7Z 3I551 1YJN1 3CCU1 1K9M1 1NJI1 1KD12 3CC7Z 1VQ6Z 1K8A2 1VQ41 3CCL1 1Q812 3I55Z 1VQKZ 1QVFY 1K732 3CD61 3CCJ1 1QVGZ 1QVFZ 1W2BY 1KQSZ 3CC41 1KC82 2OTJZ 1YI21 3G6EZ 1VQ91 1VQK1 1JJ2Z 1M1K2 3CCSZ 1VQOZ 3CCJZ 3CME1 3G71Z 1YHQ1 1Q7Y2 1Q862 1N8R2 2OTLZ 3CC4Z 2OTJ1 1VQ61 1M901 1VQ5Z 3G6E1 1Q821 3CMEZ 1YIJ1 3CMAZ 1Q7Y1 1VQMZ 1KQSY 3CPWZ 3CC21 1QVGY 1VQ8Z 1YJ91 1YITZ 1VQ71 1S721 3CXCY 1Q861 1N8R1 1YJNZ 1VQNZ 2QEXZ 3I561 3CMA1 1VQLZ 1YIJZ 2QA4Z 3OW2Y 3CCEZ 1YJWZ 3CC71 1YIT1 1YJ9Z 1VQ81 1Q822 3CCLZ 1KC81 1S72Z
chains in the Genus database with same CATH superfamily
4NFRA 3CCR1 5C4JI 2PM9A 1Q16A 2V8JA 2BJOA 4S1TA 2WAQA 1KD11 3CCQ1 3HOUI 3FQQA 5A2Qf 4A3II 2Q4ZA 1YI2Z 1Y1WI 2W03A 1VQ9Z 1VQPZ 4AYBA 3GTJI 3CCS1 1VQO1 3G711 2QA41 1YHQZ 3HOVI 2VPZA 1RNIA 4BXXI 3JAMf 2AYDA 2F4OA 4NH1C 4E30A 1FDOA 3CCVZ 4A3DI 3CCM1 3HOYI 1X3ZA 3I07A 5LL6f 2E2II 1QXFA 4DGLA 4NBDA 4A3KI 3IX0A 1VQ6Z 3GTPI 3Q87A 2M6NA 4RVDA 2RBLA 3MZKB 1VQKZ 3MONA 3CCJ1 1QVGZ 3HOXI 3RZDI 3S17I 1PFTA 4E33A 1QVFZ 2P3YA 4BY7I 1YI21 2JNYA 5IP7I 1VQK1 1JJ2Z 3RZOI 3CCSZ 1VQOZ 3VMIA 3G71Z 1YHQ1 2QR1B 1Q862 1Z01A 5D1OB 2ZAEB 1VQ5Z 4RS4A 1WCMI 4MRIA 2E2JI 2JA6I 3KIHA 2NVQI 1RQFA 3D6WA 1P9NA 2Q51A 4BY1I 3IFUA 1ML8A 3PO3I 3BG0B 3CXCY 1YJNZ 3I561 3MZLB 2IZ3A 2QA4Z 3VB9A 3HOZI 4HGZA 3OW2Y 4NBAA 1YIT1 2NVXI 1Q822 1KC81 1Y1VI 2K3RA 1VQL1 3I56Z 3VMGA 2JA8I 1WZNA 3CCV1 3GTKI 3LUSA 3VMHA 2QLVB 1QF8A 1VLAA 3CCRZ 2PMZA 2LIYA 3NH5A 3CXCZ 5FLXb 4RVHA 3OW2Z 3G4SZ 1JJ2Y 1TWHI 2JA5I 2JIPA 2R93I 2OTL1 1VQ51 4E2XA 3BG1B 3G4S1 5IT9f 4A93I 2F4MA 2Y0SA 4HGYA 1YUKA 1I6HI 1K9M2 1NP6A 3KIFA 1VQ7Z 1RLYA 3GCFA 2R7ZI 1YJN1 1K9M1 3J7A4 2R92I 4A3LI 2OOYB 2W04A 1VQ41 5T64A 3S1RI 2R6MA 2E9HA 3GTLI 2QKDA 1QYPA 4RVFA 1QVFY 3HOWI 2J6AA 3IR7A 4BBSI 3CC41 1KC82 3NH4A 3GTMS 2RT9A 4RV9A 2M48A 3TDHB 3CCJZ 5T67A 3NDIA 2I3CA 1ZB9A 5C3EI 2OOXB 4MD8A 2OTLZ 3CC4Z 3P5JB 1RO4A 3T4NB 2JIRA 2HU9A 3S2DI 1RO2A 4TNUA 1Q821 4Y7NI 1YIJ1 2E2HI 3CMAZ 1VQMZ 1I3QI 3CC21 1QVGY 1VQ71 1Q861 2VPXA 2JS4A 3F3FC 4DK1A 2QEXZ 1YIJZ 4A3MI 4E2ZA 3CC71 2JIOA 1DL6A 2VPWA 3F3PC 4MH4A 3QWUA 4MD9A 2RPRA 1S7MA 2V8KA 5T6BA 2GTHA 1R9TI 5C4XI 1TWCI 3NFZA 3GTGI 1WW9A 4QTTA 1M902 2JA7I 3I4MI 2O53A 4NOZA 3J81f 1VQN1 3PO2I 2O4HA 1VQ4Z 1YJW1 4BBRI 4A3EI 2QRCB 2NVYI 3CCUZ 3CPWY 4XX2A 4QTUA 3TE5B 1VQM1 3GTMI 5IT9b 4Y52I 3CC2Z 1Q811 3S14I 2VUMI 3I551 2H85A 1Y1VS 1KRLA 1Y8CA 4MD7A 1AA6A 5FLXf 3CC7Z 2K5RA 3CCL1 1TWFI 2JMOA 3I55Z 2WB1A 2KI7B 2LEXA 1WJ2A 3S15I 1K732 3IF8A 2PK7A 1KQSZ 2B63I 4RVGA 2OZKA 3G6EZ 2AKLA 4DQYB 2V8IA 4NBHA 1M1K2 3CME1 3J81b 1WIIA 3H0GI 2DE5A 5IP9I 2JIMA 3I4NI 1USPB 5FLMI 4NB9A 3H3VJ 2QREB 3G6E1 3ESWA 3S1QI 4NBGA 1I50I 2V3VA 3D9XA 2G2KA 1KQSY 4A3CI 3CPWZ 2JR6A 4NBFA 5C44I 1VQ8Z 3S16I 1RO0A 1S721 1N8R1 2VF1A 1USPA 1VQNZ 3NDJA 4E32A 3CMA1 2QRDB 1YJWZ 1VQ81 5CM2M 3CCLZ 2RHBA 1ZH1A 1S72Z 2QEX1 2JIQA 1K83I 3JAMb 1VQP1 2EGTA 1W2BZ 3CD6Z 3EEDA 4A3JI 4A3GI 1K8A1 1TWAI 4A3BI 1NJI2 3K7AI 3VTNA 1M1K1 2HF1A 2JUBA 2VPYA 2DE7A 3CCE1 3CCMZ 4A3FI 3CQZI 1JWHC 2IZ4A 1K731 5D1PA 4NBCA 4E2WA 3CCQZ 1SIWA 2YU9I 1NUIA 1Z02A 3CCU1 1Z03A 2V45A 3FQMA 3S2HI 1NJI1 1KD12 2DE6A 3HKZA 1K8A2 3J80b 3S1MI 3J80f 1Q812 2VUGA 2P28A 5A2Qb 2GTIA 4NBBA 4MXUA 5D1OA 1LQLA 3GTOI 4CL1A 3FKII 1N2FA 3CD61 4NBEA 1W2BY 2OTJZ 2GU2A 1TWGI 4E31A 1SFOI 5AN9F 3GTQI 2LFUA 1VQ91 1YUAA 3NH8A 2KPIA 1X0TA 1Q7Y2 1N8R2 2IV2X 3PO3S 2OTJ1 3D2LA 1VQ61 4X6AI 1M901 4EWCA 2NAPA 3EERA 4HH4A 1FDIA 4E2YA 1X3WA 3M4OI 3CMEZ 3U50C 1Q7Y1 2E7ZA 1ZB8A 1YJ91 4NB8A 1YITZ 4MONA 2NVTI 1TFIA 3GKQA 3M3YI 1VQLZ 3S1NI 2YADA 3CCEZ 2RIQA 1YJ9Z 1L1OC
chains in the Genus database with same CATH topology
4NFRA 3CCR1 5C4JI 2PM9A 2V8JA 2BJOA 4S1TA 2WAQA 1KD11 3CCQ1 3HOUI 3FQQA 5A2Qf 4A3II 2Q4ZA 1YI2Z 1Y1WI 2W03A 1VQ9Z 1VQPZ 4AYBA 3GTJI 3CCS1 1VQO1 3G711 2QA41 1YHQZ 3HOVI 1RNIA 4BXXI 3JAMf 2F4OA 4NH1C 4E30A 3CCVZ 4A3DI 3CCM1 3HOYI 1X3ZA 3I07A 5LL6f 2E2II 4DGLA 4NBDA 4A3KI 3IX0A 1VQ6Z 3GTPI 3Q87A 2M6NA 4RVDA 2RBLA 3MZKB 1VQKZ 3MONA 3CCJ1 1QVGZ 3HOXI 3RZDI 3S17I 1PFTA 4E33A 1QVFZ 2P3YA 4BY7I 1YI21 2JNYA 5IP7I 1VQK1 1JJ2Z 3RZOI 3CCSZ 1VQOZ 3VMIA 3G71Z 1YHQ1 2QR1B 1Q862 1Z01A 5D1OB 2ZAEB 1VQ5Z 4RS4A 1WCMI 4MRIA 2E2JI 2JA6I 3KIHA 2NVQI 1RQFA 3D6WA 1P9NA 2Q51A 4BY1I 3IFUA 1ML8A 3PO3I 3BG0B 3CXCY 1YJNZ 3I561 3MZLB 2IZ3A 2QA4Z 3VB9A 3HOZI 4HGZA 3OW2Y 4NBAA 1YIT1 2NVXI 1Q822 1KC81 1Y1VI 2K3RA 1VQL1 3I56Z 3VMGA 2JA8I 3CCV1 3GTKI 3LUSA 3VMHA 2QLVB 1QF8A 1VLAA 3CCRZ 2PMZA 2LIYA 3NH5A 3CXCZ 5FLXb 4RVHA 3OW2Z 3G4SZ 1JJ2Y 1TWHI 2JA5I 2R93I 2OTL1 1VQ51 4E2XA 3BG1B 3G4S1 5IT9f 4A93I 2F4MA 2Y0SA 4HGYA 1YUKA 1I6HI 1K9M2 1NP6A 3KIFA 1VQ7Z 1RLYA 3GCFA 2R7ZI 1YJN1 1K9M1 3J7A4 2R92I 4A3LI 2OOYB 2W04A 1VQ41 5T64A 3S1RI 2R6MA 2E9HA 3GTLI 2QKDA 1QYPA 4RVFA 1QVFY 3HOWI 2J6AA 4BBSI 3CC41 1KC82 3NH4A 3GTMS 2RT9A 4RV9A 2M48A 3TDHB 5T67A 3CCJZ 3NDIA 2I3CA 1ZB9A 5C3EI 2OOXB 4MD8A 2OTLZ 3CC4Z 3P5JB 1RO4A 3T4NB 2HU9A 3S2DI 1RO2A 4TNUA 1Q821 4Y7NI 1YIJ1 2E2HI 3CMAZ 1VQMZ 1I3QI 3CC21 1QVGY 1VQ71 1Q861 2JS4A 3F3FC 4DK1A 2QEXZ 1YIJZ 4A3MI 4E2ZA 3CC71 1DL6A 3F3PC 4MH4A 3QWUA 4MD9A 2RPRA 1S7MA 2V8KA 5T6BA 2GTHA 1R9TI 5C4XI 1TWCI 3NFZA 3GTGI 1WW9A 4QTTA 1M902 2JA7I 3I4MI 2O53A 4NOZA 3J81f 1VQN1 3PO2I 2O4HA 1VQ4Z 1YJW1 4BBRI 4A3EI 2QRCB 2NVYI 3CCUZ 3CPWY 4XX2A 4QTUA 3TE5B 1VQM1 3GTMI 5IT9b 4Y52I 3CC2Z 1Q811 3S14I 2VUMI 3I551 2H85A 1Y1VS 1KRLA 4MD7A 5FLXf 3CC7Z 2K5RA 3CCL1 1TWFI 2JMOA 3I55Z 2WB1A 2KI7B 3S15I 1K732 3IF8A 2PK7A 1KQSZ 2B63I 4RVGA 2OZKA 3G6EZ 2AKLA 4DQYB 2V8IA 4NBHA 1M1K2 3CME1 3J81b 1WIIA 3H0GI 2DE5A 5IP9I 3I4NI 1USPB 5FLMI 4NB9A 3H3VJ 2QREB 3G6E1 3ESWA 3S1QI 4NBGA 1I50I 3D9XA 2G2KA 1KQSY 4A3CI 3CPWZ 2JR6A 4NBFA 5C44I 1VQ8Z 3S16I 1RO0A 1S721 1N8R1 2VF1A 1USPA 1VQNZ 3NDJA 4E32A 3CMA1 2QRDB 1YJWZ 1VQ81 5CM2M 3CCLZ 2RHBA 1ZH1A 1S72Z 2QEX1 1K83I 3JAMb 1VQP1 2EGTA 1W2BZ 3CD6Z 3EEDA 4A3JI 4A3GI 1K8A1 1TWAI 4A3BI 1NJI2 3K7AI 3VTNA 1M1K1 2HF1A 2JUBA 2DE7A 3CCE1 3CCMZ 4A3FI 3CQZI 1JWHC 2IZ4A 1K731 5D1PA 4NBCA 4E2WA 3CCQZ 2YU9I 1NUIA 1Z02A 3CCU1 1Z03A 3FQMA 3S2HI 1NJI1 1KD12 2DE6A 3HKZA 1K8A2 3J80b 3S1MI 3J80f 1Q812 2VUGA 2P28A 5A2Qb 2GTIA 4NBBA 4MXUA 5D1OA 1LQLA 3GTOI 4CL1A 3FKII 1N2FA 3CD61 4NBEA 1W2BY 2OTJZ 2GU2A 1TWGI 4E31A 1SFOI 5AN9F 3GTQI 2LFUA 1VQ91 1YUAA 3NH8A 2KPIA 1X0TA 1Q7Y2 1N8R2 3PO3S 2OTJ1 1VQ61 4X6AI 1M901 4EWCA 3EERA 4HH4A 4E2YA 1X3WA 3M4OI 3CMEZ 3U50C 1Q7Y1 1ZB8A 1YJ91 4NB8A 1YITZ 4MONA 2NVTI 1TFIA 3GKQA 3M3YI 1VQLZ 3S1NI 2YADA 3CCEZ 2RIQA 1YJ9Z 1L1OC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCR 1;  2QEX 1;  1VQL 1;  3I56 Z;  1VQP 1;  3CCV 1;  1W2B Z;  1KD1 1;  3CD6 Z;  3CCQ 1;  1M90 2;  3CCR Z;  1YI2 Z;  1VQ9 Z;  1K8A 1;  3CXC Z;  1VQP Z;  3CCS 1;  1VQO 1;  3OW2 Z;  1NJI 2;  3G4S Z;  1VQN 1;  3G71 1;  1JJ2 Y;  1M1K 1;  2QA4 1;  1YHQ Z;  2OTL 1;  1VQ4 Z;  3CCE 1;  1YJW 1;  1VQ5 1;  3CCM Z;  3CCU Z;  3G4S 1;  1K73 1;  3CPW Y;  1VQM 1;  3CCV Z;  3CC2 Z;  3CCM 1;  1Q81 1;  3CCQ Z;  1K9M 2;  1VQ7 Z;  3I55 1;  1YJN 1;  3CCU 1;  1K9M 1;  1NJI 1;  1KD1 2;  3CC7 Z;  1VQ6 Z;  1K8A 2;  1VQ4 1;  3CCL 1;  1Q81 2;  3I55 Z;  1VQK Z;  1QVF Y;  1K73 2;  3CD6 1;  3CCJ 1;  1QVG Z;  1QVF Z;  1W2B Y;  1KQS Z;  3CC4 1;  1KC8 2;  2OTJ Z;  1YI2 1;  3G6E Z;  1VQ9 1;  1VQK 1;  1JJ2 Z;  1M1K 2;  3CCS Z;  1VQO Z;  3CCJ Z;  3CME 1;  3G71 Z;  1YHQ 1;  1Q7Y 2;  1Q86 2;  1N8R 2;  2OTL Z;  3CC4 Z;  2OTJ 1;  1VQ6 1;  1M90 1;  1VQ5 Z;  3G6E 1;  1Q82 1;  3CME Z;  1YIJ 1;  3CMA Z;  1Q7Y 1;  1VQM Z;  1KQS Y;  3CPW Z;  3CC2 1;  1QVG Y;  1VQ8 Z;  1YJ9 1;  1YIT Z;  1VQ7 1;  1S72 1;  3CXC Y;  1Q86 1;  1N8R 1;  1YJN Z;  1VQN Z;  2QEX Z;  3I56 1;  3CMA 1;  1VQL Z;  1YIJ Z;  2QA4 Z;  3OW2 Y;  3CCE Z;  1YJW Z;  3CC7 1;  1YIT 1;  1YJ9 Z;  1VQ8 1;  1Q82 2;  3CCL Z;  1KC8 1;  1S72 Z; 
#chains in the Genus database with same CATH topology
 4NFR A;  3CCR 1;  5C4J I;  2PM9 A;  1Q16 A;  2V8J A;  2BJO A;  4S1T A;  2WAQ A;  1KD1 1;  3CCQ 1;  3HOU I;  3FQQ A;  5A2Q f;  4A3I I;  2Q4Z A;  1YI2 Z;  1Y1W I;  2W03 A;  1VQ9 Z;  1VQP Z;  4AYB A;  3GTJ I;  3CCS 1;  1VQO 1;  3G71 1;  2QA4 1;  1YHQ Z;  3HOV I;  2VPZ A;  1RNI A;  4BXX I;  3JAM f;  2AYD A;  2F4O A;  4NH1 C;  4E30 A;  1FDO A;  3CCV Z;  4A3D I;  3CCM 1;  3HOY I;  1X3Z A;  3I07 A;  5LL6 f;  2E2I I;  1QXF A;  4DGL A;  4NBD A;  4A3K I;  3IX0 A;  1VQ6 Z;  3GTP I;  3Q87 A;  2M6N A;  4RVD A;  2RBL A;  3MZK B;  1VQK Z;  3MON A;  3CCJ 1;  1QVG Z;  3HOX I;  3RZD I;  3S17 I;  1PFT A;  4E33 A;  1QVF Z;  2P3Y A;  4BY7 I;  1YI2 1;  2JNY A;  5IP7 I;  1VQK 1;  1JJ2 Z;  3RZO I;  3CCS Z;  1VQO Z;  3VMI A;  3G71 Z;  1YHQ 1;  2QR1 B;  1Q86 2;  1Z01 A;  5D1O B;  2ZAE B;  1VQ5 Z;  4RS4 A;  1WCM I;  4MRI A;  2E2J I;  2JA6 I;  3KIH A;  2NVQ I;  1RQF A;  3D6W A;  1P9N A;  2Q51 A;  4BY1 I;  3IFU A;  1ML8 A;  3PO3 I;  3BG0 B;  3CXC Y;  1YJN Z;  3I56 1;  3MZL B;  2IZ3 A;  2QA4 Z;  3VB9 A;  3HOZ I;  4HGZ A;  3OW2 Y;  4NBA A;  1YIT 1;  2NVX I;  1Q82 2;  1KC8 1;  1Y1V I;  2K3R A;  1VQL 1;  3I56 Z;  3VMG A;  2JA8 I;  1WZN A;  3CCV 1;  3GTK I;  3LUS A;  3VMH A;  2QLV B;  1QF8 A;  1VLA A;  3CCR Z;  2PMZ A;  2LIY A;  3NH5 A;  3CXC Z;  5FLX b;  4RVH A;  3OW2 Z;  3G4S Z;  1JJ2 Y;  1TWH I;  2JA5 I;  2JIP A;  2R93 I;  2OTL 1;  1VQ5 1;  4E2X A;  3BG1 B;  3G4S 1;  5IT9 f;  4A93 I;  2F4M A;  2Y0S A;  4HGY A;  1YUK A;  1I6H I;  1K9M 2;  1NP6 A;  3KIF A;  1VQ7 Z;  1RLY A;  3GCF A;  2R7Z I;  1YJN 1;  1K9M 1;  3J7A 4;  2R92 I;  4A3L I;  2OOY B;  2W04 A;  1VQ4 1;  5T64 A;  3S1R I;  2R6M A;  2E9H A;  3GTL I;  2QKD A;  1QYP A;  4RVF A;  1QVF Y;  3HOW I;  2J6A A;  3IR7 A;  4BBS I;  3CC4 1;  1KC8 2;  3NH4 A;  3GTM S;  2RT9 A;  4RV9 A;  2M48 A;  3TDH B;  3CCJ Z;  5T67 A;  3NDI A;  2I3C A;  1ZB9 A;  5C3E I;  2OOX B;  4MD8 A;  2OTL Z;  3CC4 Z;  3P5J B;  1RO4 A;  3T4N B;  2JIR A;  2HU9 A;  3S2D I;  1RO2 A;  4TNU A;  1Q82 1;  4Y7N I;  1YIJ 1;  2E2H I;  3CMA Z;  1VQM Z;  1I3Q I;  3CC2 1;  1QVG Y;  1VQ7 1;  1Q86 1;  2VPX A;  2JS4 A;  3F3F C;  4DK1 A;  2QEX Z;  1YIJ Z;  4A3M I;  4E2Z A;  3CC7 1;  2JIO A;  1DL6 A;  2VPW A;  3F3P C;  4MH4 A;  3QWU A;  4MD9 A;  2RPR A;  1S7M A;  2V8K A;  5T6B A;  2GTH A;  1R9T I;  5C4X I;  1TWC I;  3NFZ A;  3GTG I;  1WW9 A;  4QTT A;  1M90 2;  2JA7 I;  3I4M I;  2O53 A;  4NOZ A;  3J81 f;  1VQN 1;  3PO2 I;  2O4H A;  1VQ4 Z;  1YJW 1;  4BBR I;  4A3E I;  2QRC B;  2NVY I;  3CCU Z;  3CPW Y;  4XX2 A;  4QTU A;  3TE5 B;  1VQM 1;  3GTM I;  5IT9 b;  4Y52 I;  3CC2 Z;  1Q81 1;  3S14 I;  2VUM I;  3I55 1;  2H85 A;  1Y1V S;  1KRL A;  1Y8C A;  4MD7 A;  1AA6 A;  5FLX f;  3CC7 Z;  2K5R A;  3CCL 1;  1TWF I;  2JMO A;  3I55 Z;  2WB1 A;  2KI7 B;  2LEX A;  1WJ2 A;  3S15 I;  1K73 2;  3IF8 A;  2PK7 A;  1KQS Z;  2B63 I;  4RVG A;  2OZK A;  3G6E Z;  2AKL A;  4DQY B;  2V8I A;  4NBH A;  1M1K 2;  3CME 1;  3J81 b;  1WII A;  3H0G I;  2DE5 A;  5IP9 I;  2JIM A;  3I4N I;  1USP B;  5FLM I;  4NB9 A;  3H3V J;  2QRE B;  3G6E 1;  3ESW A;  3S1Q I;  4NBG A;  1I50 I;  2V3V A;  3D9X A;  2G2K A;  1KQS Y;  4A3C I;  3CPW Z;  2JR6 A;  4NBF A;  5C44 I;  1VQ8 Z;  3S16 I;  1RO0 A;  1S72 1;  1N8R 1;  2VF1 A;  1USP A;  1VQN Z;  3NDJ A;  4E32 A;  3CMA 1;  2QRD B;  1YJW Z;  1VQ8 1;  5CM2 M;  3CCL Z;  2RHB A;  1ZH1 A;  1S72 Z;  2QEX 1;  2JIQ A;  1K83 I;  3JAM b;  1VQP 1;  2EGT A;  1W2B Z;  3CD6 Z;  3EED A;  4A3J I;  4A3G I;  1K8A 1;  1TWA I;  4A3B I;  1NJI 2;  3K7A I;  3VTN A;  1M1K 1;  2HF1 A;  2JUB A;  2VPY A;  2DE7 A;  3CCE 1;  3CCM Z;  4A3F I;  3CQZ I;  1JWH C;  2IZ4 A;  1K73 1;  5D1P A;  4NBC A;  4E2W A;  3CCQ Z;  1SIW A;  2YU9 I;  1NUI A;  1Z02 A;  3CCU 1;  1Z03 A;  2V45 A;  3FQM A;  3S2H I;  1NJI 1;  1KD1 2;  2DE6 A;  3HKZ A;  1K8A 2;  3J80 b;  3S1M I;  3J80 f;  1Q81 2;  2VUG A;  2P28 A;  5A2Q b;  2GTI A;  4NBB A;  4MXU A;  5D1O A;  1LQL A;  3GTO I;  4CL1 A;  3FKI I;  1N2F A;  3CD6 1;  4NBE A;  1W2B Y;  2OTJ Z;  2GU2 A;  1TWG I;  4E31 A;  1SFO I;  5AN9 F;  3GTQ I;  2LFU A;  1VQ9 1;  1YUA A;  3NH8 A;  2KPI A;  1X0T A;  1Q7Y 2;  1N8R 2;  2IV2 X;  3PO3 S;  2OTJ 1;  3D2L A;  1VQ6 1;  4X6A I;  1M90 1;  4EWC A;  2NAP A;  3EER A;  4HH4 A;  1FDI A;  4E2Y A;  1X3W A;  3M4O I;  3CME Z;  3U50 C;  1Q7Y 1;  2E7Z A;  1ZB8 A;  1YJ9 1;  4NB8 A;  1YIT Z;  4MON A;  2NVT I;  1TFI A;  3GKQ A;  3M3Y I;  1VQL Z;  3S1N I;  2YAD A;  3CCE Z;  2RIQ A;  1YJ9 Z;  1L1O C; 
#chains in the Genus database with same CATH homology
 4NFR A;  3CCR 1;  5C4J I;  2PM9 A;  2V8J A;  2BJO A;  4S1T A;  2WAQ A;  1KD1 1;  3CCQ 1;  3HOU I;  3FQQ A;  5A2Q f;  4A3I I;  2Q4Z A;  1YI2 Z;  1Y1W I;  2W03 A;  1VQ9 Z;  1VQP Z;  4AYB A;  3GTJ I;  3CCS 1;  1VQO 1;  3G71 1;  2QA4 1;  1YHQ Z;  3HOV I;  1RNI A;  4BXX I;  3JAM f;  2F4O A;  4NH1 C;  4E30 A;  3CCV Z;  4A3D I;  3CCM 1;  3HOY I;  1X3Z A;  3I07 A;  5LL6 f;  2E2I I;  4DGL A;  4NBD A;  4A3K I;  3IX0 A;  1VQ6 Z;  3GTP I;  3Q87 A;  2M6N A;  4RVD A;  2RBL A;  3MZK B;  1VQK Z;  3MON A;  3CCJ 1;  1QVG Z;  3HOX I;  3RZD I;  3S17 I;  1PFT A;  4E33 A;  1QVF Z;  2P3Y A;  4BY7 I;  1YI2 1;  2JNY A;  5IP7 I;  1VQK 1;  1JJ2 Z;  3RZO I;  3CCS Z;  1VQO Z;  3VMI A;  3G71 Z;  1YHQ 1;  2QR1 B;  1Q86 2;  1Z01 A;  5D1O B;  2ZAE B;  1VQ5 Z;  4RS4 A;  1WCM I;  4MRI A;  2E2J I;  2JA6 I;  3KIH A;  2NVQ I;  1RQF A;  3D6W A;  1P9N A;  2Q51 A;  4BY1 I;  3IFU A;  1ML8 A;  3PO3 I;  3BG0 B;  3CXC Y;  1YJN Z;  3I56 1;  3MZL B;  2IZ3 A;  2QA4 Z;  3VB9 A;  3HOZ I;  4HGZ A;  3OW2 Y;  4NBA A;  1YIT 1;  2NVX I;  1Q82 2;  1KC8 1;  1Y1V I;  2K3R A;  1VQL 1;  3I56 Z;  3VMG A;  2JA8 I;  3CCV 1;  3GTK I;  3LUS A;  3VMH A;  2QLV B;  1QF8 A;  1VLA A;  3CCR Z;  2PMZ A;  2LIY A;  3NH5 A;  3CXC Z;  5FLX b;  4RVH A;  3OW2 Z;  3G4S Z;  1JJ2 Y;  1TWH I;  2JA5 I;  2R93 I;  2OTL 1;  1VQ5 1;  4E2X A;  3BG1 B;  3G4S 1;  5IT9 f;  4A93 I;  2F4M A;  2Y0S A;  4HGY A;  1YUK A;  1I6H I;  1K9M 2;  1NP6 A;  3KIF A;  1VQ7 Z;  1RLY A;  3GCF A;  2R7Z I;  1YJN 1;  1K9M 1;  3J7A 4;  2R92 I;  4A3L I;  2OOY B;  2W04 A;  1VQ4 1;  5T64 A;  3S1R I;  2R6M A;  2E9H A;  3GTL I;  2QKD A;  1QYP A;  4RVF A;  1QVF Y;  3HOW I;  2J6A A;  4BBS I;  3CC4 1;  1KC8 2;  3NH4 A;  3GTM S;  2RT9 A;  4RV9 A;  2M48 A;  3TDH B;  5T67 A;  3CCJ Z;  3NDI A;  2I3C A;  1ZB9 A;  5C3E I;  2OOX B;  4MD8 A;  2OTL Z;  3CC4 Z;  3P5J B;  1RO4 A;  3T4N B;  2HU9 A;  3S2D I;  1RO2 A;  4TNU A;  1Q82 1;  4Y7N I;  1YIJ 1;  2E2H I;  3CMA Z;  1VQM Z;  1I3Q I;  3CC2 1;  1QVG Y;  1VQ7 1;  1Q86 1;  2JS4 A;  3F3F C;  4DK1 A;  2QEX Z;  1YIJ Z;  4A3M I;  4E2Z A;  3CC7 1;  1DL6 A;  3F3P C;  4MH4 A;  3QWU A;  4MD9 A;  2RPR A;  1S7M A;  2V8K A;  5T6B A;  2GTH A;  1R9T I;  5C4X I;  1TWC I;  3NFZ A;  3GTG I;  1WW9 A;  4QTT A;  1M90 2;  2JA7 I;  3I4M I;  2O53 A;  4NOZ A;  3J81 f;  1VQN 1;  3PO2 I;  2O4H A;  1VQ4 Z;  1YJW 1;  4BBR I;  4A3E I;  2QRC B;  2NVY I;  3CCU Z;  3CPW Y;  4XX2 A;  4QTU A;  3TE5 B;  1VQM 1;  3GTM I;  5IT9 b;  4Y52 I;  3CC2 Z;  1Q81 1;  3S14 I;  2VUM I;  3I55 1;  2H85 A;  1Y1V S;  1KRL A;  4MD7 A;  5FLX f;  3CC7 Z;  2K5R A;  3CCL 1;  1TWF I;  2JMO A;  3I55 Z;  2WB1 A;  2KI7 B;  3S15 I;  1K73 2;  3IF8 A;  2PK7 A;  1KQS Z;  2B63 I;  4RVG A;  2OZK A;  3G6E Z;  2AKL A;  4DQY B;  2V8I A;  4NBH A;  1M1K 2;  3CME 1;  3J81 b;  1WII A;  3H0G I;  2DE5 A;  5IP9 I;  3I4N I;  1USP B;  5FLM I;  4NB9 A;  3H3V J;  2QRE B;  3G6E 1;  3ESW A;  3S1Q I;  4NBG A;  1I50 I;  3D9X A;  2G2K A;  1KQS Y;  4A3C I;  3CPW Z;  2JR6 A;  4NBF A;  5C44 I;  1VQ8 Z;  3S16 I;  1RO0 A;  1S72 1;  1N8R 1;  2VF1 A;  1USP A;  1VQN Z;  3NDJ A;  4E32 A;  3CMA 1;  2QRD B;  1YJW Z;  1VQ8 1;  5CM2 M;  3CCL Z;  2RHB A;  1ZH1 A;  1S72 Z;  2QEX 1;  1K83 I;  3JAM b;  1VQP 1;  2EGT A;  1W2B Z;  3CD6 Z;  3EED A;  4A3J I;  4A3G I;  1K8A 1;  1TWA I;  4A3B I;  1NJI 2;  3K7A I;  3VTN A;  1M1K 1;  2HF1 A;  2JUB A;  2DE7 A;  3CCE 1;  3CCM Z;  4A3F I;  3CQZ I;  1JWH C;  2IZ4 A;  1K73 1;  5D1P A;  4NBC A;  4E2W A;  3CCQ Z;  2YU9 I;  1NUI A;  1Z02 A;  3CCU 1;  1Z03 A;  3FQM A;  3S2H I;  1NJI 1;  1KD1 2;  2DE6 A;  3HKZ A;  1K8A 2;  3J80 b;  3S1M I;  3J80 f;  1Q81 2;  2VUG A;  2P28 A;  5A2Q b;  2GTI A;  4NBB A;  4MXU A;  5D1O A;  1LQL A;  3GTO I;  4CL1 A;  3FKI I;  1N2F A;  3CD6 1;  4NBE A;  1W2B Y;  2OTJ Z;  2GU2 A;  1TWG I;  4E31 A;  1SFO I;  5AN9 F;  3GTQ I;  2LFU A;  1VQ9 1;  1YUA A;  3NH8 A;  2KPI A;  1X0T A;  1Q7Y 2;  1N8R 2;  3PO3 S;  2OTJ 1;  1VQ6 1;  4X6A I;  1M90 1;  4EWC A;  3EER A;  4HH4 A;  4E2Y A;  1X3W A;  3M4O I;  3CME Z;  3U50 C;  1Q7Y 1;  1ZB8 A;  1YJ9 1;  4NB8 A;  1YIT Z;  4MON A;  2NVT I;  1TFI A;  3GKQ A;  3M3Y I;  1VQL Z;  3S1N I;  2YAD A;  3CCE Z;  2RIQ A;  1YJ9 Z;  1L1O C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...