1KD11

Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
total genus 13
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2001-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1kd1100
2OTLZ 1VQMZ 1Q7Y1 1VQM1 1KQSY 1VQ4Z 1Q812 1VQ41 3CPWZ 1N8R2 3I55Z 3I551 1VQPZ 1VQ6Z 1VQP1 1VQ61 1M1K1 3CCLZ 1QVGZ 3I561 3CCL1 3CCQZ 1Q861 3CMEZ 3CCQ1 1K9M1 3CME1 1KD11 3CCJZ 1Q821 1NJI1 3CCJ1 3CXCZ 1Q7Y2 1JJ2Z 3CCSZ 1KC81 1VQNZ 3CCS1 1VQN1 1W2BZ 1M901 1YJWZ 2OTL1 3G4SZ 1VQ9Z 1QVFY 1YJ9Z 3G4S1 1VQ91 1K8A1 1YJ91 3OW2Y 1YITZ 1YIT1 1YHQZ 1YHQ1 1YJNZ 1YJN1 1VQOZ 1VQLZ 3CCEZ 1VQ7Z 1VQO1 3CCMZ 1VQL1 3CCE1 3CCM1 1K8A2 1QVGY 3CC2Z 1K731 3CMAZ 3CC21 1YI2Z 1YJW1 3CCUZ 1YI21 3CCRZ 3CCU1 2QA4Z 1YIJZ 3CCR1 2QA41 1YIJ1 3CC4Z 3CC7Z 3CC41 1M1K2 1W2BY 1VQ5Z 1Q862 1N8R1 1VQ51 1K9M2 1KD12 1Q822 1NJI2 2QEXZ 2QEX1 1KC82 1QVFZ 1KQSZ 3CCVZ 3CPWY 3CCV1 1M902 3G71Z 3G6EZ 3G711 1VQ71 3G6E1 3CMA1 2OTJZ 3CXCY 2OTJ1 1JJ2Y 3CC71 1VQ8Z 1Q811 3I56Z 1VQ81 1VQKZ 1VQK1 1S72Z 1S721 3CD6Z 1K732 3CD61 3OW2Z
chains in the Genus database with same CATH superfamily
2QREB 1Y8CA 2PM9A 3EEDA 3K7AI 3J80b 1VQM1 3S17I 4MD7A 4A3GI 2VUMI 2JS4A 2OOYB 4HGZA 2VPWA 4A3JI 1TWGI 3VTNA 1VQ61 1QVGZ 3I561 1KRLA 3CCL1 3CCQZ 4BBRI 3NFZA 1X3ZA 1WJ2A 3CCS1 1W2BZ 1YJWZ 5FLMI 3J80f 3T4NB 4BXXI 2QRCB 2RT9A 2OTL1 1JWHC 3G4S1 1VQ91 3U50C 3PO3S 3RZDI 3KIHA 5C4XI 3H3VJ 4BY1I 3OW2Y 4NBDA 2QKDA 2NVQI 1YJN1 3I07A 1RO0A 3M4OI 3PO3I 2GU2A 1VQOZ 2WB1A 5FLXb 1VQ7Z 1VQL1 4NFRA 4NB8A 1K8A2 3S15I 3CC2Z 2JA5I 3CCUZ 1PFTA 5D1OB 2QA41 2J6AA 2OOXB 3J7A4 4EWCA 1FDIA 2PK7A 1R9TI 2QEX1 3KIFA 4MXUA 3CPWY 4A3FI 4S1TA 1X0TA 3IR7A 1L1OC 2QRDB 2RHBA 1S7MA 1YUKA 2HU9A 4DGLA 3PO2I 2PMZA 4BY7I 1YUAA 3IF8A 4RVGA 3TE5B 3CXCY 2OTJ1 3GTGI 2P28A 3S2DI 4XX2A 5C4JI 2RPRA 4MRIA 2JNYA 1I50I 1S72Z 2JIMA 5CM2M 4RVDA 3I4NI 4E30A 1KQSY 1VQ4Z 2K3RA 2QLVB 3CPWZ 1VLAA 3D9XA 2NVXI 2R7ZI 2EGTA 3CCQ1 1K9M1 3J81b 2JIOA 3CCJZ 4QTUA 2DE6A 3CXCZ 1VQNZ 3HOWI 1M901 2ZAEB 3CQZI 1YJ9Z 3P5JB 1K8A1 1Z01A 4A3EI 5T6BA 1YITZ 2VPXA 4MD8A 5D1PA 1YHQZ 3D6WA 1DL6A 3GTOI 4X6AI 3J81f 1Y1VS 2F4OA 2RBLA 3HOXI 1VQO1 3CCMZ 3S14I 1ZB8A 4HH4A 4E33A 1Z02A 1K731 3CC21 1YI2Z 1RO2A 3CCU1 1YIJZ 1Y1VI 4A3KI 2M6NA 1K83I 3BG1B 4NBEA 4DK1A 5T64A 3GTMS 3H0GI 4A3BI 1K9M2 4NH1C 4MD9A 3CCVZ 1M902 2JR6A 3GTMI 1Z03A 3G6EZ 4NBBA 5IP9I 4HGYA 2G2KA 1TWCI 1N2FA 2M48A 1WIIA 3HOUI 3CMA1 2E2II 2R92I 2IZ3A 2H85A 1TFIA 3FQMA 3ESWA 2Y0SA 1X3WA 3CC71 3I56Z 1FDOA 4NBFA 1I3QI 3HKZA 1VQKZ 3GTLI 3NDJA 4E31A 1S721 3CD6Z 1K732 2K5RA 3OW2Z 4NOZA 2OTLZ 3HOYI 1TWAI 4A3LI 1NP6A 2LIYA 2WAQA 1USPA 2AYDA 2VUGA 1VQ41 3F3PC 3EERA 3I55Z 3VB9A 1VQPZ 1RLYA 1Y1WI 2AKLA 3S1MI 1M1K1 4E2XA 1QXFA 2DE5A 1ML8A 3CMEZ 4RS4A 3D2LA 1NJI1 3CCJ1 2YADA 1Q7Y2 1KC81 2JA6I 2NVYI 1VQN1 4Y52I 2JIPA 5IT9b 5T67A 4A3CI 3VMIA 1QVFY 1RO4A 1QF8A 1YJ91 1RQFA 1P9NA 1SFOI 3NDIA 3HOVI 1YIT1 2JA8I 4A93I 2YU9I 1YHQ1 1RNIA 3GCFA 1WW9A 2Q51A 2BJOA 2KI7B 3VMGA 3CCEZ 2P3YA 1LQLA 3CCM1 5IT9f 1WCMI 1QVGY 4MONA 3IFUA 1YJW1 2JIQA 1YI21 3QWUA 2RIQA 3CCRZ 2LEXA 1YIJ1 5LL6f 3CC4Z 1M1K2 1QYPA 1W2BY 1VQ5Z 2GTHA 1USPB 1N8R1 3RZOI 4NBHA 1NJI2 3I4MI 3TDHB 1KC82 1QVFZ 1KQSZ 3GTJI 3CCV1 2JUBA 4E2YA 5AN9F 2KPIA 1SIWA 3MZLB 4NBGA 3G71Z 2O53A 4MH4A 2JIRA 1VQ71 3G6E1 4Y7NI 3MONA 2NAPA 3JAMf 4CL1A 1JJ2Y 3MZKB 2GTIA 2HF1A 3GTPI 4RV9A 1VQ8Z 2DE7A 5A2Qf 1VQK1 2V8KA 1ZB9A 4AYBA 2IV2X 1AA6A 4NBAA 3CD61 3IX0A 2B63I 1VQMZ 1Q7Y1 2VF1A 1NUIA 2E7ZA 2W04A 1Q812 1N8R2 3I551 4NB9A 1VQ6Z 1VQP1 2JA7I 5C44I 3NH4A 2F4MA 5C3EI 3CCLZ 4DQYB 1Q861 3FQQA 3CME1 4E2WA 1KD11 1Q821 2QR1B 1JJ2Z 1WZNA 3CCSZ 2VPZA 4NBCA 1TWHI 4A3II 2W03A 2LFUA 3G4SZ 1VQ9Z 2JMOA 3S1RI 2E2JI 3S2HI 2R93I 2R6MA 1ZH1A 4RVFA 2Q4ZA 1YJNZ 4A3DI 2VPYA 5FLXf 1VQLZ 3CCE1 3Q87A 4A3MI 4TNUA 3CMAZ 2QA4Z 3CCR1 3CC7Z 3FKII 3CC41 2OZKA 2V45A 3GTKI 1Q862 1Q16A 1VQ51 2E2HI 3VMHA 1KD12 1Q822 2QEXZ 4RVHA 2V8JA 3S1NI 2I3CA 4E32A 3G711 2IZ4A 2O4HA 3S1QI 3M3YI 4QTTA 3GTQI 3NH5A 1I6HI 2OTJZ 3JAMb 5IP7I 4E2ZA 2E9HA 2V8IA 1Q811 3LUSA 3F3FC 1VQ81 4BBSI 3GKQA 3S16I 3HOZI 3BG0B 2NVTI 2V3VA 3NH8A 5A2Qb 1TWFI 5D1OA
chains in the Genus database with same CATH topology
2QREB 2PM9A 3EEDA 3K7AI 3J80b 3S17I 1VQM1 4MD7A 4A3GI 2VUMI 2JS4A 2OOYB 4HGZA 4A3JI 1TWGI 3VTNA 1VQ61 1QVGZ 3I561 1KRLA 3CCL1 3CCQZ 4BBRI 3NFZA 1X3ZA 3CCS1 1W2BZ 1YJWZ 5FLMI 3J80f 3T4NB 4BXXI 2QRCB 2RT9A 2OTL1 1JWHC 3G4S1 1VQ91 3U50C 3PO3S 3RZDI 3KIHA 5C4XI 3H3VJ 4BY1I 3OW2Y 4NBDA 2QKDA 2NVQI 1YJN1 3I07A 1RO0A 3M4OI 3PO3I 2GU2A 1VQOZ 2WB1A 5FLXb 1VQ7Z 1VQL1 4NFRA 4NB8A 1K8A2 3S15I 3CC2Z 2JA5I 3CCUZ 1PFTA 5D1OB 2QA41 2J6AA 2OOXB 3J7A4 4EWCA 2PK7A 1R9TI 2QEX1 3KIFA 4MXUA 3CPWY 4A3FI 4S1TA 1X0TA 1L1OC 2QRDB 2RHBA 1S7MA 1YUKA 2HU9A 4DGLA 3PO2I 2PMZA 4BY7I 1YUAA 3IF8A 4RVGA 3TE5B 3CXCY 2OTJ1 3GTGI 2P28A 3S2DI 4XX2A 5C4JI 2RPRA 4MRIA 2JNYA 1I50I 1S72Z 5CM2M 4RVDA 3I4NI 4E30A 1KQSY 1VQ4Z 2K3RA 2QLVB 3CPWZ 1VLAA 3D9XA 2NVXI 2R7ZI 2EGTA 3CCQ1 1K9M1 3J81b 3CCJZ 4QTUA 2DE6A 3CXCZ 1VQNZ 3HOWI 1M901 2ZAEB 3CQZI 1YJ9Z 3P5JB 1K8A1 1Z01A 4A3EI 5T6BA 1YITZ 4MD8A 5D1PA 1YHQZ 3D6WA 1DL6A 3GTOI 4X6AI 3J81f 1Y1VS 2F4OA 2RBLA 3HOXI 1VQO1 3CCMZ 3S14I 1ZB8A 4HH4A 4E33A 1Z02A 1K731 3CC21 1YI2Z 1RO2A 3CCU1 1YIJZ 1Y1VI 4A3KI 2M6NA 1K83I 3BG1B 4NBEA 4DK1A 5T64A 3GTMS 3H0GI 4A3BI 1K9M2 4NH1C 4MD9A 3CCVZ 1M902 2JR6A 3GTMI 1Z03A 3G6EZ 4NBBA 5IP9I 4HGYA 2G2KA 1TWCI 1N2FA 2M48A 1WIIA 3HOUI 3CMA1 2E2II 2R92I 2IZ3A 2H85A 1TFIA 3FQMA 3ESWA 2Y0SA 1X3WA 3CC71 3I56Z 4NBFA 1I3QI 3HKZA 1VQKZ 3GTLI 3NDJA 4E31A 1S721 3CD6Z 1K732 2K5RA 3OW2Z 4NOZA 2OTLZ 3HOYI 1TWAI 4A3LI 1NP6A 2LIYA 2WAQA 1USPA 1VQ41 2VUGA 3F3PC 3EERA 3I55Z 3VB9A 1VQPZ 1RLYA 1Y1WI 2AKLA 3S1MI 1M1K1 4E2XA 2DE5A 1ML8A 3CMEZ 4RS4A 1NJI1 3CCJ1 2YADA 1Q7Y2 1KC81 2JA6I 2NVYI 1VQN1 4Y52I 5IT9b 5T67A 4A3CI 3VMIA 1QVFY 1RO4A 1QF8A 1YJ91 1RQFA 1P9NA 1SFOI 3NDIA 3HOVI 1YIT1 2JA8I 4A93I 2YU9I 1YHQ1 1RNIA 3GCFA 1WW9A 2Q51A 2BJOA 2KI7B 3VMGA 3CCEZ 2P3YA 1LQLA 3CCM1 5IT9f 1WCMI 1QVGY 4MONA 3IFUA 1YJW1 1YI21 3QWUA 2RIQA 3CCRZ 1YIJ1 5LL6f 3CC4Z 1M1K2 1QYPA 1W2BY 1VQ5Z 2GTHA 1USPB 1N8R1 3RZOI 4NBHA 1NJI2 3I4MI 3TDHB 1KC82 1QVFZ 1KQSZ 3GTJI 3CCV1 2JUBA 4E2YA 5AN9F 2KPIA 3MZLB 2O53A 3G71Z 4MH4A 4NBGA 1VQ71 3G6E1 4Y7NI 3MONA 3JAMf 4CL1A 1JJ2Y 3MZKB 2GTIA 2HF1A 3GTPI 4RV9A 1VQ8Z 2DE7A 5A2Qf 1VQK1 2V8KA 1ZB9A 4AYBA 3CD61 4NBAA 3IX0A 2B63I 1VQMZ 1Q7Y1 2VF1A 1NUIA 2W04A 1Q812 1N8R2 3I551 4NB9A 1VQ6Z 1VQP1 2JA7I 5C44I 3NH4A 2F4MA 5C3EI 3CCLZ 4DQYB 1Q861 3FQQA 3CME1 4E2WA 1KD11 1Q821 2QR1B 1JJ2Z 3CCSZ 4NBCA 1TWHI 4A3II 2W03A 2LFUA 3G4SZ 1VQ9Z 2JMOA 3S1RI 2E2JI 3S2HI 2R93I 2R6MA 1ZH1A 4RVFA 2Q4ZA 1YJNZ 4A3DI 5FLXf 1VQLZ 3CCE1 3Q87A 4A3MI 4TNUA 3CMAZ 2QA4Z 3CCR1 3CC7Z 3FKII 3CC41 2OZKA 3GTKI 1Q862 1VQ51 2E2HI 3VMHA 1KD12 1Q822 2QEXZ 4RVHA 2V8JA 3S1NI 2I3CA 4E32A 3G711 2IZ4A 2O4HA 3S1QI 3M3YI 4QTTA 3GTQI 3NH5A 1I6HI 2OTJZ 3JAMb 5IP7I 4E2ZA 2E9HA 2V8IA 1Q811 3LUSA 3F3FC 1VQ81 4BBSI 3GKQA 3S16I 3HOZI 3BG0B 2NVTI 3NH8A 5A2Qb 1TWFI 5D1OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTL Z;  1VQM Z;  1Q7Y 1;  1VQM 1;  1KQS Y;  1VQ4 Z;  1Q81 2;  1VQ4 1;  3CPW Z;  1N8R 2;  3I55 Z;  3I55 1;  1VQP Z;  1VQ6 Z;  1VQP 1;  1VQ6 1;  1M1K 1;  3CCL Z;  1QVG Z;  3I56 1;  3CCL 1;  3CCQ Z;  1Q86 1;  3CME Z;  3CCQ 1;  1K9M 1;  3CME 1;  1KD1 1;  3CCJ Z;  1Q82 1;  1NJI 1;  3CCJ 1;  3CXC Z;  1Q7Y 2;  1JJ2 Z;  3CCS Z;  1KC8 1;  1VQN Z;  3CCS 1;  1VQN 1;  1W2B Z;  1M90 1;  1YJW Z;  2OTL 1;  3G4S Z;  1VQ9 Z;  1QVF Y;  1YJ9 Z;  3G4S 1;  1VQ9 1;  1K8A 1;  1YJ9 1;  3OW2 Y;  1YIT Z;  1YIT 1;  1YHQ Z;  1YHQ 1;  1YJN Z;  1YJN 1;  1VQO Z;  1VQL Z;  3CCE Z;  1VQ7 Z;  1VQO 1;  3CCM Z;  1VQL 1;  3CCE 1;  3CCM 1;  1K8A 2;  1QVG Y;  3CC2 Z;  1K73 1;  3CMA Z;  3CC2 1;  1YI2 Z;  1YJW 1;  3CCU Z;  1YI2 1;  3CCR Z;  3CCU 1;  2QA4 Z;  1YIJ Z;  3CCR 1;  2QA4 1;  1YIJ 1;  3CC4 Z;  3CC7 Z;  3CC4 1;  1M1K 2;  1W2B Y;  1VQ5 Z;  1Q86 2;  1N8R 1;  1VQ5 1;  1K9M 2;  1KD1 2;  1Q82 2;  1NJI 2;  2QEX Z;  2QEX 1;  1KC8 2;  1QVF Z;  1KQS Z;  3CCV Z;  3CPW Y;  3CCV 1;  1M90 2;  3G71 Z;  3G6E Z;  3G71 1;  1VQ7 1;  3G6E 1;  3CMA 1;  2OTJ Z;  3CXC Y;  2OTJ 1;  1JJ2 Y;  3CC7 1;  1VQ8 Z;  1Q81 1;  3I56 Z;  1VQ8 1;  1VQK Z;  1VQK 1;  1S72 Z;  1S72 1;  3CD6 Z;  1K73 2;  3CD6 1;  3OW2 Z; 
#chains in the Genus database with same CATH topology
 2QRE B;  1Y8C A;  2PM9 A;  3EED A;  3K7A I;  3J80 b;  1VQM 1;  3S17 I;  4MD7 A;  4A3G I;  2VUM I;  2JS4 A;  2OOY B;  4HGZ A;  2VPW A;  4A3J I;  1TWG I;  3VTN A;  1VQ6 1;  1QVG Z;  3I56 1;  1KRL A;  3CCL 1;  3CCQ Z;  4BBR I;  3NFZ A;  1X3Z A;  1WJ2 A;  3CCS 1;  1W2B Z;  1YJW Z;  5FLM I;  3J80 f;  3T4N B;  4BXX I;  2QRC B;  2RT9 A;  2OTL 1;  1JWH C;  3G4S 1;  1VQ9 1;  3U50 C;  3PO3 S;  3RZD I;  3KIH A;  5C4X I;  3H3V J;  4BY1 I;  3OW2 Y;  4NBD A;  2QKD A;  2NVQ I;  1YJN 1;  3I07 A;  1RO0 A;  3M4O I;  3PO3 I;  2GU2 A;  1VQO Z;  2WB1 A;  5FLX b;  1VQ7 Z;  1VQL 1;  4NFR A;  4NB8 A;  1K8A 2;  3S15 I;  3CC2 Z;  2JA5 I;  3CCU Z;  1PFT A;  5D1O B;  2QA4 1;  2J6A A;  2OOX B;  3J7A 4;  4EWC A;  1FDI A;  2PK7 A;  1R9T I;  2QEX 1;  3KIF A;  4MXU A;  3CPW Y;  4A3F I;  4S1T A;  1X0T A;  3IR7 A;  1L1O C;  2QRD B;  2RHB A;  1S7M A;  1YUK A;  2HU9 A;  4DGL A;  3PO2 I;  2PMZ A;  4BY7 I;  1YUA A;  3IF8 A;  4RVG A;  3TE5 B;  3CXC Y;  2OTJ 1;  3GTG I;  2P28 A;  3S2D I;  4XX2 A;  5C4J I;  2RPR A;  4MRI A;  2JNY A;  1I50 I;  1S72 Z;  2JIM A;  5CM2 M;  4RVD A;  3I4N I;  4E30 A;  1KQS Y;  1VQ4 Z;  2K3R A;  2QLV B;  3CPW Z;  1VLA A;  3D9X A;  2NVX I;  2R7Z I;  2EGT A;  3CCQ 1;  1K9M 1;  3J81 b;  2JIO A;  3CCJ Z;  4QTU A;  2DE6 A;  3CXC Z;  1VQN Z;  3HOW I;  1M90 1;  2ZAE B;  3CQZ I;  1YJ9 Z;  3P5J B;  1K8A 1;  1Z01 A;  4A3E I;  5T6B A;  1YIT Z;  2VPX A;  4MD8 A;  5D1P A;  1YHQ Z;  3D6W A;  1DL6 A;  3GTO I;  4X6A I;  3J81 f;  1Y1V S;  2F4O A;  2RBL A;  3HOX I;  1VQO 1;  3CCM Z;  3S14 I;  1ZB8 A;  4HH4 A;  4E33 A;  1Z02 A;  1K73 1;  3CC2 1;  1YI2 Z;  1RO2 A;  3CCU 1;  1YIJ Z;  1Y1V I;  4A3K I;  2M6N A;  1K83 I;  3BG1 B;  4NBE A;  4DK1 A;  5T64 A;  3GTM S;  3H0G I;  4A3B I;  1K9M 2;  4NH1 C;  4MD9 A;  3CCV Z;  1M90 2;  2JR6 A;  3GTM I;  1Z03 A;  3G6E Z;  4NBB A;  5IP9 I;  4HGY A;  2G2K A;  1TWC I;  1N2F A;  2M48 A;  1WII A;  3HOU I;  3CMA 1;  2E2I I;  2R92 I;  2IZ3 A;  2H85 A;  1TFI A;  3FQM A;  3ESW A;  2Y0S A;  1X3W A;  3CC7 1;  3I56 Z;  1FDO A;  4NBF A;  1I3Q I;  3HKZ A;  1VQK Z;  3GTL I;  3NDJ A;  4E31 A;  1S72 1;  3CD6 Z;  1K73 2;  2K5R A;  3OW2 Z;  4NOZ A;  2OTL Z;  3HOY I;  1TWA I;  4A3L I;  1NP6 A;  2LIY A;  2WAQ A;  1USP A;  2AYD A;  2VUG A;  1VQ4 1;  3F3P C;  3EER A;  3I55 Z;  3VB9 A;  1VQP Z;  1RLY A;  1Y1W I;  2AKL A;  3S1M I;  1M1K 1;  4E2X A;  1QXF A;  2DE5 A;  1ML8 A;  3CME Z;  4RS4 A;  3D2L A;  1NJI 1;  3CCJ 1;  2YAD A;  1Q7Y 2;  1KC8 1;  2JA6 I;  2NVY I;  1VQN 1;  4Y52 I;  2JIP A;  5IT9 b;  5T67 A;  4A3C I;  3VMI A;  1QVF Y;  1RO4 A;  1QF8 A;  1YJ9 1;  1RQF A;  1P9N A;  1SFO I;  3NDI A;  3HOV I;  1YIT 1;  2JA8 I;  4A93 I;  2YU9 I;  1YHQ 1;  1RNI A;  3GCF A;  1WW9 A;  2Q51 A;  2BJO A;  2KI7 B;  3VMG A;  3CCE Z;  2P3Y A;  1LQL A;  3CCM 1;  5IT9 f;  1WCM I;  1QVG Y;  4MON A;  3IFU A;  1YJW 1;  2JIQ A;  1YI2 1;  3QWU A;  2RIQ A;  3CCR Z;  2LEX A;  1YIJ 1;  5LL6 f;  3CC4 Z;  1M1K 2;  1QYP A;  1W2B Y;  1VQ5 Z;  2GTH A;  1USP B;  1N8R 1;  3RZO I;  4NBH A;  1NJI 2;  3I4M I;  3TDH B;  1KC8 2;  1QVF Z;  1KQS Z;  3GTJ I;  3CCV 1;  2JUB A;  4E2Y A;  5AN9 F;  2KPI A;  1SIW A;  3MZL B;  4NBG A;  3G71 Z;  2O53 A;  4MH4 A;  2JIR A;  1VQ7 1;  3G6E 1;  4Y7N I;  3MON A;  2NAP A;  3JAM f;  4CL1 A;  1JJ2 Y;  3MZK B;  2GTI A;  2HF1 A;  3GTP I;  4RV9 A;  1VQ8 Z;  2DE7 A;  5A2Q f;  1VQK 1;  2V8K A;  1ZB9 A;  4AYB A;  2IV2 X;  1AA6 A;  4NBA A;  3CD6 1;  3IX0 A;  2B63 I;  1VQM Z;  1Q7Y 1;  2VF1 A;  1NUI A;  2E7Z A;  2W04 A;  1Q81 2;  1N8R 2;  3I55 1;  4NB9 A;  1VQ6 Z;  1VQP 1;  2JA7 I;  5C44 I;  3NH4 A;  2F4M A;  5C3E I;  3CCL Z;  4DQY B;  1Q86 1;  3FQQ A;  3CME 1;  4E2W A;  1KD1 1;  1Q82 1;  2QR1 B;  1JJ2 Z;  1WZN A;  3CCS Z;  2VPZ A;  4NBC A;  1TWH I;  4A3I I;  2W03 A;  2LFU A;  3G4S Z;  1VQ9 Z;  2JMO A;  3S1R I;  2E2J I;  3S2H I;  2R93 I;  2R6M A;  1ZH1 A;  4RVF A;  2Q4Z A;  1YJN Z;  4A3D I;  2VPY A;  5FLX f;  1VQL Z;  3CCE 1;  3Q87 A;  4A3M I;  4TNU A;  3CMA Z;  2QA4 Z;  3CCR 1;  3CC7 Z;  3FKI I;  3CC4 1;  2OZK A;  2V45 A;  3GTK I;  1Q86 2;  1Q16 A;  1VQ5 1;  2E2H I;  3VMH A;  1KD1 2;  1Q82 2;  2QEX Z;  4RVH A;  2V8J A;  3S1N I;  2I3C A;  4E32 A;  3G71 1;  2IZ4 A;  2O4H A;  3S1Q I;  3M3Y I;  4QTT A;  3GTQ I;  3NH5 A;  1I6H I;  2OTJ Z;  3JAM b;  5IP7 I;  4E2Z A;  2E9H A;  2V8I A;  1Q81 1;  3LUS A;  3F3F C;  1VQ8 1;  4BBS I;  3GKQ A;  3S16 I;  3HOZ I;  3BG0 B;  2NVT I;  2V3V A;  3NH8 A;  5A2Q b;  1TWF I;  5D1O A; 
#chains in the Genus database with same CATH homology
 2QRE B;  2PM9 A;  3EED A;  3K7A I;  3J80 b;  3S17 I;  1VQM 1;  4MD7 A;  4A3G I;  2VUM I;  2JS4 A;  2OOY B;  4HGZ A;  4A3J I;  1TWG I;  3VTN A;  1VQ6 1;  1QVG Z;  3I56 1;  1KRL A;  3CCL 1;  3CCQ Z;  4BBR I;  3NFZ A;  1X3Z A;  3CCS 1;  1W2B Z;  1YJW Z;  5FLM I;  3J80 f;  3T4N B;  4BXX I;  2QRC B;  2RT9 A;  2OTL 1;  1JWH C;  3G4S 1;  1VQ9 1;  3U50 C;  3PO3 S;  3RZD I;  3KIH A;  5C4X I;  3H3V J;  4BY1 I;  3OW2 Y;  4NBD A;  2QKD A;  2NVQ I;  1YJN 1;  3I07 A;  1RO0 A;  3M4O I;  3PO3 I;  2GU2 A;  1VQO Z;  2WB1 A;  5FLX b;  1VQ7 Z;  1VQL 1;  4NFR A;  4NB8 A;  1K8A 2;  3S15 I;  3CC2 Z;  2JA5 I;  3CCU Z;  1PFT A;  5D1O B;  2QA4 1;  2J6A A;  2OOX B;  3J7A 4;  4EWC A;  2PK7 A;  1R9T I;  2QEX 1;  3KIF A;  4MXU A;  3CPW Y;  4A3F I;  4S1T A;  1X0T A;  1L1O C;  2QRD B;  2RHB A;  1S7M A;  1YUK A;  2HU9 A;  4DGL A;  3PO2 I;  2PMZ A;  4BY7 I;  1YUA A;  3IF8 A;  4RVG A;  3TE5 B;  3CXC Y;  2OTJ 1;  3GTG I;  2P28 A;  3S2D I;  4XX2 A;  5C4J I;  2RPR A;  4MRI A;  2JNY A;  1I50 I;  1S72 Z;  5CM2 M;  4RVD A;  3I4N I;  4E30 A;  1KQS Y;  1VQ4 Z;  2K3R A;  2QLV B;  3CPW Z;  1VLA A;  3D9X A;  2NVX I;  2R7Z I;  2EGT A;  3CCQ 1;  1K9M 1;  3J81 b;  3CCJ Z;  4QTU A;  2DE6 A;  3CXC Z;  1VQN Z;  3HOW I;  1M90 1;  2ZAE B;  3CQZ I;  1YJ9 Z;  3P5J B;  1K8A 1;  1Z01 A;  4A3E I;  5T6B A;  1YIT Z;  4MD8 A;  5D1P A;  1YHQ Z;  3D6W A;  1DL6 A;  3GTO I;  4X6A I;  3J81 f;  1Y1V S;  2F4O A;  2RBL A;  3HOX I;  1VQO 1;  3CCM Z;  3S14 I;  1ZB8 A;  4HH4 A;  4E33 A;  1Z02 A;  1K73 1;  3CC2 1;  1YI2 Z;  1RO2 A;  3CCU 1;  1YIJ Z;  1Y1V I;  4A3K I;  2M6N A;  1K83 I;  3BG1 B;  4NBE A;  4DK1 A;  5T64 A;  3GTM S;  3H0G I;  4A3B I;  1K9M 2;  4NH1 C;  4MD9 A;  3CCV Z;  1M90 2;  2JR6 A;  3GTM I;  1Z03 A;  3G6E Z;  4NBB A;  5IP9 I;  4HGY A;  2G2K A;  1TWC I;  1N2F A;  2M48 A;  1WII A;  3HOU I;  3CMA 1;  2E2I I;  2R92 I;  2IZ3 A;  2H85 A;  1TFI A;  3FQM A;  3ESW A;  2Y0S A;  1X3W A;  3CC7 1;  3I56 Z;  4NBF A;  1I3Q I;  3HKZ A;  1VQK Z;  3GTL I;  3NDJ A;  4E31 A;  1S72 1;  3CD6 Z;  1K73 2;  2K5R A;  3OW2 Z;  4NOZ A;  2OTL Z;  3HOY I;  1TWA I;  4A3L I;  1NP6 A;  2LIY A;  2WAQ A;  1USP A;  1VQ4 1;  2VUG A;  3F3P C;  3EER A;  3I55 Z;  3VB9 A;  1VQP Z;  1RLY A;  1Y1W I;  2AKL A;  3S1M I;  1M1K 1;  4E2X A;  2DE5 A;  1ML8 A;  3CME Z;  4RS4 A;  1NJI 1;  3CCJ 1;  2YAD A;  1Q7Y 2;  1KC8 1;  2JA6 I;  2NVY I;  1VQN 1;  4Y52 I;  5IT9 b;  5T67 A;  4A3C I;  3VMI A;  1QVF Y;  1RO4 A;  1QF8 A;  1YJ9 1;  1RQF A;  1P9N A;  1SFO I;  3NDI A;  3HOV I;  1YIT 1;  2JA8 I;  4A93 I;  2YU9 I;  1YHQ 1;  1RNI A;  3GCF A;  1WW9 A;  2Q51 A;  2BJO A;  2KI7 B;  3VMG A;  3CCE Z;  2P3Y A;  1LQL A;  3CCM 1;  5IT9 f;  1WCM I;  1QVG Y;  4MON A;  3IFU A;  1YJW 1;  1YI2 1;  3QWU A;  2RIQ A;  3CCR Z;  1YIJ 1;  5LL6 f;  3CC4 Z;  1M1K 2;  1QYP A;  1W2B Y;  1VQ5 Z;  2GTH A;  1USP B;  1N8R 1;  3RZO I;  4NBH A;  1NJI 2;  3I4M I;  3TDH B;  1KC8 2;  1QVF Z;  1KQS Z;  3GTJ I;  3CCV 1;  2JUB A;  4E2Y A;  5AN9 F;  2KPI A;  3MZL B;  2O53 A;  3G71 Z;  4MH4 A;  4NBG A;  1VQ7 1;  3G6E 1;  4Y7N I;  3MON A;  3JAM f;  4CL1 A;  1JJ2 Y;  3MZK B;  2GTI A;  2HF1 A;  3GTP I;  4RV9 A;  1VQ8 Z;  2DE7 A;  5A2Q f;  1VQK 1;  2V8K A;  1ZB9 A;  4AYB A;  3CD6 1;  4NBA A;  3IX0 A;  2B63 I;  1VQM Z;  1Q7Y 1;  2VF1 A;  1NUI A;  2W04 A;  1Q81 2;  1N8R 2;  3I55 1;  4NB9 A;  1VQ6 Z;  1VQP 1;  2JA7 I;  5C44 I;  3NH4 A;  2F4M A;  5C3E I;  3CCL Z;  4DQY B;  1Q86 1;  3FQQ A;  3CME 1;  4E2W A;  1KD1 1;  1Q82 1;  2QR1 B;  1JJ2 Z;  3CCS Z;  4NBC A;  1TWH I;  4A3I I;  2W03 A;  2LFU A;  3G4S Z;  1VQ9 Z;  2JMO A;  3S1R I;  2E2J I;  3S2H I;  2R93 I;  2R6M A;  1ZH1 A;  4RVF A;  2Q4Z A;  1YJN Z;  4A3D I;  5FLX f;  1VQL Z;  3CCE 1;  3Q87 A;  4A3M I;  4TNU A;  3CMA Z;  2QA4 Z;  3CCR 1;  3CC7 Z;  3FKI I;  3CC4 1;  2OZK A;  3GTK I;  1Q86 2;  1VQ5 1;  2E2H I;  3VMH A;  1KD1 2;  1Q82 2;  2QEX Z;  4RVH A;  2V8J A;  3S1N I;  2I3C A;  4E32 A;  3G71 1;  2IZ4 A;  2O4H A;  3S1Q I;  3M3Y I;  4QTT A;  3GTQ I;  3NH5 A;  1I6H I;  2OTJ Z;  3JAM b;  5IP7 I;  4E2Z A;  2E9H A;  2V8I A;  1Q81 1;  3LUS A;  3F3F C;  1VQ8 1;  4BBS I;  3GKQ A;  3S16 I;  3HOZ I;  3BG0 B;  2NVT I;  3NH8 A;  5A2Q b;  1TWF I;  5D1O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...