1KD11

Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
b'RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2001-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1kd1100
3CCSZ 1NJI1 3CCV1 1K732 3CCR1 3CD61 1YHQZ 1K731 1KQSY 3CC2Z 3OW2Y 1VQ51 3CCL1 3CCEZ 3CPWY 3CCJZ 2QEXZ 1M1K2 1KD12 1M1K1 3CCS1 1S72Z 1QVGZ 3CXCZ 1YHQ1 3G4SZ 3CC21 1VQLZ 3CCE1 1Q7Y2 3CCJ1 2QEX1 1K9M1 1S721 1VQ4Z 1NJI2 3G4S1 1VQL1 1YIT1 1VQ6Z 1VQ7Z 1KC82 3G6EZ 1KC81 1VQ41 3I55Z 1JJ2Z 3CMAZ 1YI2Z 3I56Z 1VQ61 1QVFZ 3CCQ1 1VQ9Z 1VQMZ 1YITZ 1VQ71 3G6E1 1W2BZ 1Q862 3I551 1K8A2 1K9M2 1Q861 1M901 1K8A1 3CC7Z 2OTLZ 3OW2Z 3CMA1 1YI21 3I561 1YIJZ 3CPWZ 3CC4Z 1YJ91 2OTJZ 1VQ91 1VQM1 1N8R1 1VQOZ 3CCQZ 1Q811 1Q821 1QVGY 3CXCY 3CC71 1VQKZ 2OTL1 2QA4Z 1YIJ1 3CCUZ 3CC41 1VQ8Z 2OTJ1 1YJWZ 3G71Z 1VQO1 1YJ9Z 1YJNZ 1W2BY 1M902 3CMEZ 1VQK1 1KQSZ 1VQPZ 1VQNZ 2QA41 3CCMZ 3CCU1 1VQ81 1YJW1 3G711 1YJN1 1N8R2 1KD11 1Q812 1Q822 3CCVZ 3CME1 3CCRZ 1JJ2Y 3CD6Z 1VQP1 1VQN1 3CCM1 1VQ5Z 1Q7Y1 3CCLZ 1QVFY
chains in the Genus database with same CATH superfamily
4RV9A 4MD8A 3CD61 2KPIA 5LL6f 2LIYA 3VMHA 2GTHA 3CCJZ 1QF8A 3KIHA 3F3PC 2IZ4A 5C44I 3JAMf 4A3BI 3CC21 2E2II 4A3GI 1K83I 3CCE1 4A3II 3S1QI 1NJI2 4HH4A 2ZAEB 3G4S1 5D1OB 1YIT1 1YUKA 3J81b 3K7AI 2W03A 3I55Z 2RIQA 1JJ2Z 2QKDA 4EWCA 2V3VA 1WJ2A 2KI7B 3HOUI 3RZOI 2JA6I 2VF1A 3GTGI 4MD9A 3FQQA 1VQ61 2NVTI 1VQMZ 1YITZ 4A3KI 3G6E1 1K8A2 1N2FA 1K9M2 1K8A1 2JIPA 2OOXB 2NVYI 4A3FI 1YI21 2GU2A 3IF8A 4AYBA 3I561 4RVGA 3GTOI 2VUGA 2OTJZ 2DE7A 2JA7I 1N8R1 4E32A 1Q811 1ZB9A 1Q821 4QTTA 1L1OC 2QA4Z 3CCUZ 1YJWZ 4XX2A 1VQO1 1WZNA 3FQMA 2BJOA 4BBSI 3GTJI 4A93I 4BBRI 3CCMZ 2V8JA 4E31A 2JMOA 2LEXA 2V8KA 2R93I 2VPXA 1WW9A 1JJ2Y 2JS4A 3T4NB 1TFIA 3CCLZ 3D6WA 5IP9I 3CCSZ 3CCV1 2AKLA 3VB9A 3I4NI 4RVFA 1VQ51 2J6AA 2HF1A 2K5RA 3GTMI 3KIFA 3Q87A 3MZKB 1KD12 1S72Z 1QVGZ 3CXCZ 3MONA 3LUSA 3S17I 2P3YA 3PO3S 2NAPA 1Q7Y2 3HOWI 1I50I 4DGLA 2PM9A 3CCJ1 3S1MI 4E2ZA 4E2WA 3S1NI 3EEDA 4NBEA 2VPYA 2NVXI 1I3QI 2YADA 1QXFA 4NBAA 1VQ7Z 1KC82 1KC81 2PMZA 3NDJA 4BY1I 4Y7NI 4NB8A 1QVFZ 1WIIA 1VQ9Z 4MXUA 2VUMI 3I551 1M901 3H0GI 1RO2A 3CC7Z 2OTLZ 4NH1C 2RHBA 2HU9A 3U50C 1YIJZ 3D9XA 1VQM1 3HOXI 1TWGI 1PFTA 1QVGY 3CXCY 4TNUA 1VQKZ 4NOZA 4A3LI 1Z01A 3IR7A 2OTJ1 3NH8A 2JNYA 3VMIA 1YJNZ 1W2BY 3I4MI 1VQPZ 2QLVB 3NDIA 1VQNZ 2QA41 3CCU1 3QWUA 2VPWA 1YJW1 4RS4A 2JIQA 1N8R2 1Q812 1Q822 5C4JI 3CCRZ 1KRLA 4NBHA 3IX0A 3CCM1 5AN9F 4X6AI 2E2JI 1FDIA 3TDHB 4E2YA 1QVFY 1USPA 2O53A 3BG1B 2M6NA 1AA6A 1YHQZ 2IZ3A 1RNIA 3CCL1 2V8IA 2Q51A 2QEXZ 1M1K2 3S15I 1M1K1 3CCS1 3P5JB 2PK7A 2JUBA 1VQLZ 2JIMA 2AYDA 5IT9b 2OZKA 1S721 1VQ4Z 3S14I 2P28A 3HOZI 3GKQA 3TE5B 4NBBA 3HOYI 5FLXb 4DQYB 1X0TA 1TWHI 3FKII 3PO3I 2WAQA 3CMAZ 1RQFA 4NBDA 2Y0SA 3CQZI 1Y1VI 3EERA 3S2DI 4A3DI 1VQ71 3HOVI 1Y8CA 1W2BZ 1Q862 5A2Qf 1Q861 1R9TI 2M48A 3OW2Z 3GTQI 2OOYB 3CPWZ 3CC4Z 4A3EI 1VQ91 1I6HI 5IT9f 3CC71 2OTL1 1NP6A 1RO4A 1RO0A 1YIJ1 3HKZA 1VQ8Z 1TWAI 4A3JI 3G71Z 1P9NA 5IP7I 4CL1A 4E30A 2JIOA 3ESWA 1M902 2R6MA 3CMEZ 5FLXf 1VQK1 4HGYA 1X3WA 2H85A 4NB9A 3VMGA 2I3CA 5CM2M 2G2KA 1YJN1 1FDOA 2DE5A 5T6BA 2RBLA 1SIWA 3GCFA 2YU9I 2R92I 3CD6Z 1USPB 4BXXI 1VQP1 1VQN1 4RVDA 2JR6A 4NFRA 1RLYA 3J80f 3IFUA 1Z03A 2EGTA 1NJI1 2K3RA 4NBFA 4QTUA 1K732 3NFZA 3CCR1 1K731 1KQSY 2O4HA 2JA8I 3CC2Z 3OW2Y 2E7ZA 5D1PA 3S16I 3CCEZ 3CPWY 2RT9A 2QRCB 3I07A 4DK1A 1YHQ1 2W04A 5T67A 4MRIA 2Q4ZA 3G4SZ 2DE6A 3H3VJ 2JA5I 3BG0B 4S1TA 4MH4A 3PO2I 2QEX1 1K9M1 3F3FC 2B63I 1DL6A 2E2HI 3GTPI 2QR1B 1VQL1 1VQ6Z 5A2Qb 3G6EZ 1VQ41 1S7MA 2QRDB 3RZDI 1ZH1A 1TWCI 5D1OA 1WCMI 1Z02A 1ML8A 1YI2Z 2F4MA 3I56Z 3CCQ1 3J7A4 1TWFI 2JIRA 3J81f 1ZB8A 4NBCA 1Q16A 3CMA1 3S2HI 1VLAA 2VPZA 3S1RI 1YJ91 5T64A 1LQLA 1VQOZ 2R7ZI 3CCQZ 3GTKI 1QYPA 3M3YI 3GTLI 2F4OA 1X3ZA 2LFUA 5C3EI 1Y1WI 4BY7I 3CC41 2RPRA 1YJ9Z 3JAMb 3M4OI 1NUIA 5FLMI 4A3MI 4MONA 1KQSZ 1SFOI 1VQ81 4E33A 3G711 2NVQI 4E2XA 3J80b 3VTNA 3MZLB 2IV2X 4HGZA 1KD11 3NH5A 5C4XI 2QREB 3CCVZ 2WB1A 4NBGA 3CME1 2GTIA 3GTMS 2V45A 3NH4A 1YUAA 4A3CI 4MD7A 1VQ5Z 1Q7Y1 1Y1VS 1JWHC 4Y52I 2E9HA 4RVHA 3D2LA
chains in the Genus database with same CATH topology
4RV9A 4MD8A 3CD61 2KPIA 5LL6f 2LIYA 3VMHA 2GTHA 3CCJZ 1QF8A 3KIHA 3F3PC 2IZ4A 5C44I 3JAMf 4A3BI 3CC21 2E2II 4A3GI 1K83I 3CCE1 4A3II 3S1QI 1NJI2 4HH4A 2ZAEB 3G4S1 5D1OB 1YIT1 1YUKA 3J81b 3K7AI 2W03A 3I55Z 2RIQA 1JJ2Z 2QKDA 4EWCA 2KI7B 3HOUI 3RZOI 2JA6I 2VF1A 3GTGI 4MD9A 3FQQA 1VQ61 2NVTI 1VQMZ 1YITZ 4A3KI 3G6E1 1K8A2 1N2FA 1K9M2 1K8A1 2OOXB 2NVYI 4A3FI 1YI21 2GU2A 3IF8A 4AYBA 3I561 4RVGA 3GTOI 2VUGA 2OTJZ 2DE7A 2JA7I 1N8R1 4E32A 1Q811 1ZB9A 1Q821 4QTTA 1L1OC 2QA4Z 3CCUZ 1YJWZ 4XX2A 1VQO1 3FQMA 2BJOA 4BBSI 3GTJI 4A93I 4BBRI 3CCMZ 2V8JA 4E31A 2JMOA 2V8KA 2R93I 1WW9A 1JJ2Y 2JS4A 3T4NB 1TFIA 3CCLZ 3D6WA 5IP9I 3CCSZ 3CCV1 2AKLA 3VB9A 3I4NI 4RVFA 1VQ51 2J6AA 2HF1A 2K5RA 3GTMI 3KIFA 3Q87A 3MZKB 1KD12 1S72Z 1QVGZ 3CXCZ 3MONA 3LUSA 3S17I 2P3YA 3PO3S 1Q7Y2 3HOWI 1I50I 4DGLA 2PM9A 3CCJ1 3S1MI 4E2ZA 4E2WA 3S1NI 3EEDA 4NBEA 2NVXI 1I3QI 2YADA 4NBAA 1VQ7Z 1KC82 1KC81 2PMZA 3NDJA 4BY1I 4Y7NI 4NB8A 1QVFZ 1WIIA 1VQ9Z 4MXUA 2VUMI 3I551 1M901 3H0GI 1RO2A 3CC7Z 2OTLZ 4NH1C 2RHBA 2HU9A 3U50C 1YIJZ 3D9XA 1VQM1 3HOXI 1TWGI 1PFTA 1QVGY 3CXCY 4TNUA 1VQKZ 4NOZA 4A3LI 1Z01A 2OTJ1 3NH8A 2JNYA 3VMIA 1YJNZ 1W2BY 3I4MI 1VQPZ 2QLVB 3NDIA 1VQNZ 2QA41 3CCU1 3QWUA 1YJW1 4RS4A 1N8R2 1Q812 1Q822 5C4JI 3CCRZ 1KRLA 4NBHA 3IX0A 3CCM1 5AN9F 4X6AI 2E2JI 3TDHB 4E2YA 1QVFY 1USPA 2O53A 3BG1B 2M6NA 1YHQZ 2IZ3A 1RNIA 3CCL1 2V8IA 2Q51A 2QEXZ 1M1K2 3S15I 1M1K1 3CCS1 3P5JB 2PK7A 2JUBA 1VQLZ 5IT9b 2OZKA 1S721 1VQ4Z 3S14I 2P28A 3HOZI 3GKQA 3TE5B 4NBBA 3HOYI 5FLXb 4DQYB 1X0TA 1TWHI 3FKII 3PO3I 2WAQA 3CMAZ 1RQFA 4NBDA 2Y0SA 3CQZI 1Y1VI 3EERA 3S2DI 4A3DI 1VQ71 3HOVI 1W2BZ 1Q862 5A2Qf 1Q861 1R9TI 2M48A 3OW2Z 3GTQI 2OOYB 3CPWZ 3CC4Z 4A3EI 1VQ91 1I6HI 5IT9f 3CC71 2OTL1 1NP6A 1RO4A 1RO0A 1YIJ1 3HKZA 1VQ8Z 1TWAI 4A3JI 3G71Z 1P9NA 5IP7I 4CL1A 4E30A 3ESWA 1M902 2R6MA 3CMEZ 5FLXf 1VQK1 4HGYA 1X3WA 2H85A 4NB9A 3VMGA 2I3CA 5CM2M 2G2KA 1YJN1 2DE5A 5T6BA 2RBLA 3GCFA 2YU9I 2R92I 3CD6Z 1USPB 4BXXI 1VQP1 1VQN1 4RVDA 2JR6A 4NFRA 1RLYA 3J80f 3IFUA 1Z03A 2EGTA 1NJI1 2K3RA 4NBFA 4QTUA 1K732 3NFZA 3CCR1 1K731 1KQSY 2O4HA 2JA8I 3CC2Z 3OW2Y 5D1PA 3S16I 3CCEZ 3CPWY 2RT9A 2QRCB 3I07A 4DK1A 1YHQ1 2W04A 5T67A 4MRIA 2Q4ZA 3G4SZ 2DE6A 3H3VJ 2JA5I 3BG0B 4S1TA 4MH4A 3PO2I 2QEX1 1K9M1 3F3FC 2B63I 1DL6A 2E2HI 3GTPI 2QR1B 1VQL1 1VQ6Z 5A2Qb 3G6EZ 1VQ41 1S7MA 2QRDB 3RZDI 1ZH1A 1TWCI 5D1OA 1WCMI 1Z02A 1ML8A 1YI2Z 2F4MA 3I56Z 3CCQ1 3J7A4 1TWFI 3J81f 1ZB8A 4NBCA 3CMA1 3S2HI 1VLAA 3S1RI 1YJ91 5T64A 1LQLA 1VQOZ 2R7ZI 3CCQZ 3GTKI 1QYPA 3M3YI 3GTLI 2F4OA 1X3ZA 2LFUA 5C3EI 1Y1WI 4BY7I 3CC41 2RPRA 1YJ9Z 3JAMb 3M4OI 1NUIA 5FLMI 4A3MI 4MONA 1KQSZ 1SFOI 1VQ81 4E33A 3G711 2NVQI 4E2XA 3J80b 3VTNA 3MZLB 4HGZA 1KD11 3NH5A 5C4XI 2QREB 3CCVZ 2WB1A 4NBGA 3CME1 2GTIA 3GTMS 3NH4A 1YUAA 4A3CI 4MD7A 1VQ5Z 1Q7Y1 1Y1VS 1JWHC 4Y52I 2E9HA 4RVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCS Z;  1NJI 1;  3CCV 1;  1K73 2;  3CCR 1;  3CD6 1;  1YHQ Z;  1K73 1;  1KQS Y;  3CC2 Z;  3OW2 Y;  1VQ5 1;  3CCL 1;  3CCE Z;  3CPW Y;  3CCJ Z;  2QEX Z;  1M1K 2;  1KD1 2;  1M1K 1;  3CCS 1;  1S72 Z;  1QVG Z;  3CXC Z;  1YHQ 1;  3G4S Z;  3CC2 1;  1VQL Z;  3CCE 1;  1Q7Y 2;  3CCJ 1;  2QEX 1;  1K9M 1;  1S72 1;  1VQ4 Z;  1NJI 2;  3G4S 1;  1VQL 1;  1YIT 1;  1VQ6 Z;  1VQ7 Z;  1KC8 2;  3G6E Z;  1KC8 1;  1VQ4 1;  3I55 Z;  1JJ2 Z;  3CMA Z;  1YI2 Z;  3I56 Z;  1VQ6 1;  1QVF Z;  3CCQ 1;  1VQ9 Z;  1VQM Z;  1YIT Z;  1VQ7 1;  3G6E 1;  1W2B Z;  1Q86 2;  3I55 1;  1K8A 2;  1K9M 2;  1Q86 1;  1M90 1;  1K8A 1;  3CC7 Z;  2OTL Z;  3OW2 Z;  3CMA 1;  1YI2 1;  3I56 1;  1YIJ Z;  3CPW Z;  3CC4 Z;  1YJ9 1;  2OTJ Z;  1VQ9 1;  1VQM 1;  1N8R 1;  1VQO Z;  3CCQ Z;  1Q81 1;  1Q82 1;  1QVG Y;  3CXC Y;  3CC7 1;  1VQK Z;  2OTL 1;  2QA4 Z;  1YIJ 1;  3CCU Z;  3CC4 1;  1VQ8 Z;  2OTJ 1;  1YJW Z;  3G71 Z;  1VQO 1;  1YJ9 Z;  1YJN Z;  1W2B Y;  1M90 2;  3CME Z;  1VQK 1;  1KQS Z;  1VQP Z;  1VQN Z;  2QA4 1;  3CCM Z;  3CCU 1;  1VQ8 1;  1YJW 1;  3G71 1;  1YJN 1;  1N8R 2;  1KD1 1;  1Q81 2;  1Q82 2;  3CCV Z;  3CME 1;  3CCR Z;  1JJ2 Y;  3CD6 Z;  1VQP 1;  1VQN 1;  3CCM 1;  1VQ5 Z;  1Q7Y 1;  3CCL Z;  1QVF Y; 
#chains in the Genus database with same CATH topology
 4RV9 A;  4MD8 A;  3CD6 1;  2KPI A;  5LL6 f;  2LIY A;  3VMH A;  2GTH A;  3CCJ Z;  1QF8 A;  3KIH A;  3F3P C;  2IZ4 A;  5C44 I;  3JAM f;  4A3B I;  3CC2 1;  2E2I I;  4A3G I;  1K83 I;  3CCE 1;  4A3I I;  3S1Q I;  1NJI 2;  4HH4 A;  2ZAE B;  3G4S 1;  5D1O B;  1YIT 1;  1YUK A;  3J81 b;  3K7A I;  2W03 A;  3I55 Z;  2RIQ A;  1JJ2 Z;  2QKD A;  4EWC A;  2V3V A;  1WJ2 A;  2KI7 B;  3HOU I;  3RZO I;  2JA6 I;  2VF1 A;  3GTG I;  4MD9 A;  3FQQ A;  1VQ6 1;  2NVT I;  1VQM Z;  1YIT Z;  4A3K I;  3G6E 1;  1K8A 2;  1N2F A;  1K9M 2;  1K8A 1;  2JIP A;  2OOX B;  2NVY I;  4A3F I;  1YI2 1;  2GU2 A;  3IF8 A;  4AYB A;  3I56 1;  4RVG A;  3GTO I;  2VUG A;  2OTJ Z;  2DE7 A;  2JA7 I;  1N8R 1;  4E32 A;  1Q81 1;  1ZB9 A;  1Q82 1;  4QTT A;  1L1O C;  2QA4 Z;  3CCU Z;  1YJW Z;  4XX2 A;  1VQO 1;  1WZN A;  3FQM A;  2BJO A;  4BBS I;  3GTJ I;  4A93 I;  4BBR I;  3CCM Z;  2V8J A;  4E31 A;  2JMO A;  2LEX A;  2V8K A;  2R93 I;  2VPX A;  1WW9 A;  1JJ2 Y;  2JS4 A;  3T4N B;  1TFI A;  3CCL Z;  3D6W A;  5IP9 I;  3CCS Z;  3CCV 1;  2AKL A;  3VB9 A;  3I4N I;  4RVF A;  1VQ5 1;  2J6A A;  2HF1 A;  2K5R A;  3GTM I;  3KIF A;  3Q87 A;  3MZK B;  1KD1 2;  1S72 Z;  1QVG Z;  3CXC Z;  3MON A;  3LUS A;  3S17 I;  2P3Y A;  3PO3 S;  2NAP A;  1Q7Y 2;  3HOW I;  1I50 I;  4DGL A;  2PM9 A;  3CCJ 1;  3S1M I;  4E2Z A;  4E2W A;  3S1N I;  3EED A;  4NBE A;  2VPY A;  2NVX I;  1I3Q I;  2YAD A;  1QXF A;  4NBA A;  1VQ7 Z;  1KC8 2;  1KC8 1;  2PMZ A;  3NDJ A;  4BY1 I;  4Y7N I;  4NB8 A;  1QVF Z;  1WII A;  1VQ9 Z;  4MXU A;  2VUM I;  3I55 1;  1M90 1;  3H0G I;  1RO2 A;  3CC7 Z;  2OTL Z;  4NH1 C;  2RHB A;  2HU9 A;  3U50 C;  1YIJ Z;  3D9X A;  1VQM 1;  3HOX I;  1TWG I;  1PFT A;  1QVG Y;  3CXC Y;  4TNU A;  1VQK Z;  4NOZ A;  4A3L I;  1Z01 A;  3IR7 A;  2OTJ 1;  3NH8 A;  2JNY A;  3VMI A;  1YJN Z;  1W2B Y;  3I4M I;  1VQP Z;  2QLV B;  3NDI A;  1VQN Z;  2QA4 1;  3CCU 1;  3QWU A;  2VPW A;  1YJW 1;  4RS4 A;  2JIQ A;  1N8R 2;  1Q81 2;  1Q82 2;  5C4J I;  3CCR Z;  1KRL A;  4NBH A;  3IX0 A;  3CCM 1;  5AN9 F;  4X6A I;  2E2J I;  1FDI A;  3TDH B;  4E2Y A;  1QVF Y;  1USP A;  2O53 A;  3BG1 B;  2M6N A;  1AA6 A;  1YHQ Z;  2IZ3 A;  1RNI A;  3CCL 1;  2V8I A;  2Q51 A;  2QEX Z;  1M1K 2;  3S15 I;  1M1K 1;  3CCS 1;  3P5J B;  2PK7 A;  2JUB A;  1VQL Z;  2JIM A;  2AYD A;  5IT9 b;  2OZK A;  1S72 1;  1VQ4 Z;  3S14 I;  2P28 A;  3HOZ I;  3GKQ A;  3TE5 B;  4NBB A;  3HOY I;  5FLX b;  4DQY B;  1X0T A;  1TWH I;  3FKI I;  3PO3 I;  2WAQ A;  3CMA Z;  1RQF A;  4NBD A;  2Y0S A;  3CQZ I;  1Y1V I;  3EER A;  3S2D I;  4A3D I;  1VQ7 1;  3HOV I;  1Y8C A;  1W2B Z;  1Q86 2;  5A2Q f;  1Q86 1;  1R9T I;  2M48 A;  3OW2 Z;  3GTQ I;  2OOY B;  3CPW Z;  3CC4 Z;  4A3E I;  1VQ9 1;  1I6H I;  5IT9 f;  3CC7 1;  2OTL 1;  1NP6 A;  1RO4 A;  1RO0 A;  1YIJ 1;  3HKZ A;  1VQ8 Z;  1TWA I;  4A3J I;  3G71 Z;  1P9N A;  5IP7 I;  4CL1 A;  4E30 A;  2JIO A;  3ESW A;  1M90 2;  2R6M A;  3CME Z;  5FLX f;  1VQK 1;  4HGY A;  1X3W A;  2H85 A;  4NB9 A;  3VMG A;  2I3C A;  5CM2 M;  2G2K A;  1YJN 1;  1FDO A;  2DE5 A;  5T6B A;  2RBL A;  1SIW A;  3GCF A;  2YU9 I;  2R92 I;  3CD6 Z;  1USP B;  4BXX I;  1VQP 1;  1VQN 1;  4RVD A;  2JR6 A;  4NFR A;  1RLY A;  3J80 f;  3IFU A;  1Z03 A;  2EGT A;  1NJI 1;  2K3R A;  4NBF A;  4QTU A;  1K73 2;  3NFZ A;  3CCR 1;  1K73 1;  1KQS Y;  2O4H A;  2JA8 I;  3CC2 Z;  3OW2 Y;  2E7Z A;  5D1P A;  3S16 I;  3CCE Z;  3CPW Y;  2RT9 A;  2QRC B;  3I07 A;  4DK1 A;  1YHQ 1;  2W04 A;  5T67 A;  4MRI A;  2Q4Z A;  3G4S Z;  2DE6 A;  3H3V J;  2JA5 I;  3BG0 B;  4S1T A;  4MH4 A;  3PO2 I;  2QEX 1;  1K9M 1;  3F3F C;  2B63 I;  1DL6 A;  2E2H I;  3GTP I;  2QR1 B;  1VQL 1;  1VQ6 Z;  5A2Q b;  3G6E Z;  1VQ4 1;  1S7M A;  2QRD B;  3RZD I;  1ZH1 A;  1TWC I;  5D1O A;  1WCM I;  1Z02 A;  1ML8 A;  1YI2 Z;  2F4M A;  3I56 Z;  3CCQ 1;  3J7A 4;  1TWF I;  2JIR A;  3J81 f;  1ZB8 A;  4NBC A;  1Q16 A;  3CMA 1;  3S2H I;  1VLA A;  2VPZ A;  3S1R I;  1YJ9 1;  5T64 A;  1LQL A;  1VQO Z;  2R7Z I;  3CCQ Z;  3GTK I;  1QYP A;  3M3Y I;  3GTL I;  2F4O A;  1X3Z A;  2LFU A;  5C3E I;  1Y1W I;  4BY7 I;  3CC4 1;  2RPR A;  1YJ9 Z;  3JAM b;  3M4O I;  1NUI A;  5FLM I;  4A3M I;  4MON A;  1KQS Z;  1SFO I;  1VQ8 1;  4E33 A;  3G71 1;  2NVQ I;  4E2X A;  3J80 b;  3VTN A;  3MZL B;  2IV2 X;  4HGZ A;  1KD1 1;  3NH5 A;  5C4X I;  2QRE B;  3CCV Z;  2WB1 A;  4NBG A;  3CME 1;  2GTI A;  3GTM S;  2V45 A;  3NH4 A;  1YUA A;  4A3C I;  4MD7 A;  1VQ5 Z;  1Q7Y 1;  1Y1V S;  1JWH C;  4Y52 I;  2E9H A;  4RVH A;  3D2L A; 
#chains in the Genus database with same CATH homology
 4RV9 A;  4MD8 A;  3CD6 1;  2KPI A;  5LL6 f;  2LIY A;  3VMH A;  2GTH A;  3CCJ Z;  1QF8 A;  3KIH A;  3F3P C;  2IZ4 A;  5C44 I;  3JAM f;  4A3B I;  3CC2 1;  2E2I I;  4A3G I;  1K83 I;  3CCE 1;  4A3I I;  3S1Q I;  1NJI 2;  4HH4 A;  2ZAE B;  3G4S 1;  5D1O B;  1YIT 1;  1YUK A;  3J81 b;  3K7A I;  2W03 A;  3I55 Z;  2RIQ A;  1JJ2 Z;  2QKD A;  4EWC A;  2KI7 B;  3HOU I;  3RZO I;  2JA6 I;  2VF1 A;  3GTG I;  4MD9 A;  3FQQ A;  1VQ6 1;  2NVT I;  1VQM Z;  1YIT Z;  4A3K I;  3G6E 1;  1K8A 2;  1N2F A;  1K9M 2;  1K8A 1;  2OOX B;  2NVY I;  4A3F I;  1YI2 1;  2GU2 A;  3IF8 A;  4AYB A;  3I56 1;  4RVG A;  3GTO I;  2VUG A;  2OTJ Z;  2DE7 A;  2JA7 I;  1N8R 1;  4E32 A;  1Q81 1;  1ZB9 A;  1Q82 1;  4QTT A;  1L1O C;  2QA4 Z;  3CCU Z;  1YJW Z;  4XX2 A;  1VQO 1;  3FQM A;  2BJO A;  4BBS I;  3GTJ I;  4A93 I;  4BBR I;  3CCM Z;  2V8J A;  4E31 A;  2JMO A;  2V8K A;  2R93 I;  1WW9 A;  1JJ2 Y;  2JS4 A;  3T4N B;  1TFI A;  3CCL Z;  3D6W A;  5IP9 I;  3CCS Z;  3CCV 1;  2AKL A;  3VB9 A;  3I4N I;  4RVF A;  1VQ5 1;  2J6A A;  2HF1 A;  2K5R A;  3GTM I;  3KIF A;  3Q87 A;  3MZK B;  1KD1 2;  1S72 Z;  1QVG Z;  3CXC Z;  3MON A;  3LUS A;  3S17 I;  2P3Y A;  3PO3 S;  1Q7Y 2;  3HOW I;  1I50 I;  4DGL A;  2PM9 A;  3CCJ 1;  3S1M I;  4E2Z A;  4E2W A;  3S1N I;  3EED A;  4NBE A;  2NVX I;  1I3Q I;  2YAD A;  4NBA A;  1VQ7 Z;  1KC8 2;  1KC8 1;  2PMZ A;  3NDJ A;  4BY1 I;  4Y7N I;  4NB8 A;  1QVF Z;  1WII A;  1VQ9 Z;  4MXU A;  2VUM I;  3I55 1;  1M90 1;  3H0G I;  1RO2 A;  3CC7 Z;  2OTL Z;  4NH1 C;  2RHB A;  2HU9 A;  3U50 C;  1YIJ Z;  3D9X A;  1VQM 1;  3HOX I;  1TWG I;  1PFT A;  1QVG Y;  3CXC Y;  4TNU A;  1VQK Z;  4NOZ A;  4A3L I;  1Z01 A;  2OTJ 1;  3NH8 A;  2JNY A;  3VMI A;  1YJN Z;  1W2B Y;  3I4M I;  1VQP Z;  2QLV B;  3NDI A;  1VQN Z;  2QA4 1;  3CCU 1;  3QWU A;  1YJW 1;  4RS4 A;  1N8R 2;  1Q81 2;  1Q82 2;  5C4J I;  3CCR Z;  1KRL A;  4NBH A;  3IX0 A;  3CCM 1;  5AN9 F;  4X6A I;  2E2J I;  3TDH B;  4E2Y A;  1QVF Y;  1USP A;  2O53 A;  3BG1 B;  2M6N A;  1YHQ Z;  2IZ3 A;  1RNI A;  3CCL 1;  2V8I A;  2Q51 A;  2QEX Z;  1M1K 2;  3S15 I;  1M1K 1;  3CCS 1;  3P5J B;  2PK7 A;  2JUB A;  1VQL Z;  5IT9 b;  2OZK A;  1S72 1;  1VQ4 Z;  3S14 I;  2P28 A;  3HOZ I;  3GKQ A;  3TE5 B;  4NBB A;  3HOY I;  5FLX b;  4DQY B;  1X0T A;  1TWH I;  3FKI I;  3PO3 I;  2WAQ A;  3CMA Z;  1RQF A;  4NBD A;  2Y0S A;  3CQZ I;  1Y1V I;  3EER A;  3S2D I;  4A3D I;  1VQ7 1;  3HOV I;  1W2B Z;  1Q86 2;  5A2Q f;  1Q86 1;  1R9T I;  2M48 A;  3OW2 Z;  3GTQ I;  2OOY B;  3CPW Z;  3CC4 Z;  4A3E I;  1VQ9 1;  1I6H I;  5IT9 f;  3CC7 1;  2OTL 1;  1NP6 A;  1RO4 A;  1RO0 A;  1YIJ 1;  3HKZ A;  1VQ8 Z;  1TWA I;  4A3J I;  3G71 Z;  1P9N A;  5IP7 I;  4CL1 A;  4E30 A;  3ESW A;  1M90 2;  2R6M A;  3CME Z;  5FLX f;  1VQK 1;  4HGY A;  1X3W A;  2H85 A;  4NB9 A;  3VMG A;  2I3C A;  5CM2 M;  2G2K A;  1YJN 1;  2DE5 A;  5T6B A;  2RBL A;  3GCF A;  2YU9 I;  2R92 I;  3CD6 Z;  1USP B;  4BXX I;  1VQP 1;  1VQN 1;  4RVD A;  2JR6 A;  4NFR A;  1RLY A;  3J80 f;  3IFU A;  1Z03 A;  2EGT A;  1NJI 1;  2K3R A;  4NBF A;  4QTU A;  1K73 2;  3NFZ A;  3CCR 1;  1K73 1;  1KQS Y;  2O4H A;  2JA8 I;  3CC2 Z;  3OW2 Y;  5D1P A;  3S16 I;  3CCE Z;  3CPW Y;  2RT9 A;  2QRC B;  3I07 A;  4DK1 A;  1YHQ 1;  2W04 A;  5T67 A;  4MRI A;  2Q4Z A;  3G4S Z;  2DE6 A;  3H3V J;  2JA5 I;  3BG0 B;  4S1T A;  4MH4 A;  3PO2 I;  2QEX 1;  1K9M 1;  3F3F C;  2B63 I;  1DL6 A;  2E2H I;  3GTP I;  2QR1 B;  1VQL 1;  1VQ6 Z;  5A2Q b;  3G6E Z;  1VQ4 1;  1S7M A;  2QRD B;  3RZD I;  1ZH1 A;  1TWC I;  5D1O A;  1WCM I;  1Z02 A;  1ML8 A;  1YI2 Z;  2F4M A;  3I56 Z;  3CCQ 1;  3J7A 4;  1TWF I;  3J81 f;  1ZB8 A;  4NBC A;  3CMA 1;  3S2H I;  1VLA A;  3S1R I;  1YJ9 1;  5T64 A;  1LQL A;  1VQO Z;  2R7Z I;  3CCQ Z;  3GTK I;  1QYP A;  3M3Y I;  3GTL I;  2F4O A;  1X3Z A;  2LFU A;  5C3E I;  1Y1W I;  4BY7 I;  3CC4 1;  2RPR A;  1YJ9 Z;  3JAM b;  3M4O I;  1NUI A;  5FLM I;  4A3M I;  4MON A;  1KQS Z;  1SFO I;  1VQ8 1;  4E33 A;  3G71 1;  2NVQ I;  4E2X A;  3J80 b;  3VTN A;  3MZL B;  4HGZ A;  1KD1 1;  3NH5 A;  5C4X I;  2QRE B;  3CCV Z;  2WB1 A;  4NBG A;  3CME 1;  2GTI A;  3GTM S;  3NH4 A;  1YUA A;  4A3C I;  4MD7 A;  1VQ5 Z;  1Q7Y 1;  1Y1V S;  1JWH C;  4Y52 I;  2E9H A;  4RVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...