3J80b

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
81
structure length
81
Chain Sequence
b'VLVQDLLHPTAASEARKHKLKTLVQSPRSHFLDVKCPGCLNITTVFSHAQTAVTCESCSTVLCTPTGGKAKLSEGTSFRRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 7
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
b PF01667 Ribosomal_S27e Ribosomal protein S27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.640 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3j80b00
5A2Qb 5LL6f 3J80b 3J81b 5FLXb 5IT9b 3JAMb 3J7A4
chains in the Genus database with same CATH superfamily
3MONA 2Y0SA 1VQN1 3HOYI 3NH8A 3GTGI 3ESWA 3BG1B 3VMIA 4NBEA 4CL1A 2OOYB 2P28A 1Q862 1Q812 3VTNA 2R93I 1Y8CA 2RPRA 2W03A 3IF8A 1YI21 2JIQA 2V8IA 5T67A 1WZNA 2OTLZ 5C4JI 1TWFI 4A3MI 4A3CI 2PK7A 1WJ2A 2V8JA 4A3BI 2LFUA 3S1QI 2OZKA 2AYDA 3CCEZ 1N8R2 1QXFA 3NDIA 3GTMS 3J81b 4E32A 2R6MA 3S17I 2F4OA 3OW2Y 4S1TA 1Q821 2G2KA 2JA5I 3OW2Z 5A2Qf 3RZDI 4MD7A 1YJ91 2VUMI 3FKII 1YIJ1 1QYPA 4MRIA 1YIT1 1JWHC 1YI2Z 2JIOA 4XX2A 1RO4A 2OTJZ 1FDOA 2B63I 1VQMZ 2DE7A 3J80f 1VQK1 1USPA 4NB9A 1M901 1WCMI 3Q87A 5C3EI 2NAPA 2Q4ZA 3M3YI 1M1K1 5LL6f 2NVTI 4HGZA 2Q51A 3KIFA 3CPWZ 2QRCB 3H0GI 3CC21 4HH4A 1X3WA 4DQYB 3I07A 3HOXI 3HOUI 4BBRI 2PM9A 2HF1A 4A3II 3GTMI 3CCUZ 3S1RI 3CQZI 3IX0A 3GTJI 1Q822 3CCRZ 1VQ41 1YJ9Z 3U50C 1RO0A 1TWGI 4MXUA 3S2HI 2GTIA 1YITZ 5CM2M 4NBBA 3VB9A 2LIYA 1VQLZ 2E2HI 3CCV1 4NBAA 1JJ2Y 3G4S1 1P9NA 4QTTA 2ZAEB 4Y7NI 1JJ2Z 3IFUA 3CD61 3PO3S 3D2LA 3CMA1 4RS4A 1K732 1YJN1 1NJI2 2YU9I 5T6BA 2GU2A 2M48A 4E30A 1VQ8Z 3CCQZ 2K3RA 3HOWI 4NBHA 2RBLA 3I4MI 5FLXb 4BBSI 2K5RA 3I56Z 2JUBA 5IT9f 5D1OB 4DGLA 4AYBA 3LUSA 1YUKA 3MZKB 3CCVZ 2VPYA 2H85A 4X6AI 3G4SZ 3CCJ1 2VPWA 3G6EZ 4A3EI 2E7ZA 3CCS1 3CMAZ 3S2DI 1QVFY 1YHQ1 1QVFZ 3PO3I 4A3GI 1K8A1 3IR7A 2HU9A 5D1PA 2RIQA 1NUIA 1LQLA 3NH5A 2JIPA 4NH1C 1VQ71 1I3QI 3S1MI 1SIWA 3CXCY 1VQNZ 2NVXI 3CXCZ 2JA7I 3F3PC 1K83I 1KRLA 5A2Qb 3CME1 1RQFA 3D6WA 2DE6A 1K9M1 2NVQI 3HOZI 3S16I 1PFTA 3CCJZ 1VQO1 3J81f 1NP6A 4RVDA 2QRDB 4MONA 1KD11 3GKQA 3KIHA 2VPZA 3S15I 1TFIA 5D1OA 2QR1B 1X3ZA 1VQ7Z 1S721 1VQ51 3CC71 2AKLA 1Q7Y1 2E2JI 3I551 1VQ61 2NVYI 3JAMf 3GTQI 4BY7I 2QA41 1WIIA 2GTHA 2O53A 1Z01A 3CMEZ 1YIJZ 2M6NA 1TWCI 4E33A 3CCM1 2LEXA 4RVGA 1Z02A 4MD8A 1TWAI 3MZLB 1VQKZ 2R7ZI 1YJW1 3EEDA 1QVGY 3CC41 3S14I 2BJOA 2W04A 3FQMA 4E2XA 1M902 1VLAA 4RVFA 3CCL1 2RT9A 4RVHA 1M1K2 4NBDA 2DE5A 2V3VA 1Q861 3I55Z 3CC2Z 2OOXB 2R92I 2JA8I 2RHBA 2QLVB 2QA4Z 4A93I 1VQ4Z 3NH4A 1ZB9A 2OTL1 4EWCA 1KC81 3T4NB 2JNYA 3H3VJ 1S7MA 4TNUA 1N8R1 3CC4Z 3TDHB 4NBFA 3CCE1 3CD6Z 5FLXf 3CCLZ 3GTPI 3G711 2JS4A 5IP9I 3EERA 4NBGA 1YJNZ 3RZOI 2VF1A 3BG0B 3P5JB 2VUGA 3GTKI 5AN9F 1VQ91 4A3JI 1KQSY 4A3LI 2QEX1 2KPIA 1N2FA 1Y1WI 1KQSZ 2OTJ1 2YADA 1VQM1 1R9TI 1ZB8A 2IZ3A 5C44I 4E2WA 1Y1VS 4RV9A 1KC82 3TE5B 1DL6A 3J80b 4E31A 1X0TA 3CCSZ 3G71Z 3VMGA 2V45A 1I6HI 1YHQZ 2E9HA 3VMHA 3CCU1 3CCR1 2P3YA 1K8A2 4E2ZA 1QF8A 2JR6A 1VQ9Z 2JIRA 2QEXZ 3S1NI 3F3FC 1VQL1 2V8KA 1W2BY 3JAMb 1L1OC 1W2BZ 4MH4A 5C4XI 1RLYA 3NFZA 2VPXA 1K731 3CPWY 4A3FI 1VQP1 1SFOI 4NOZA 1NJI1 1Y1VI 2IV2X 1K9M2 1VQOZ 1WW9A 3I4NI 1YUAA 3M4OI 4HGYA 1RO2A 1QVGZ 1VQ81 3CCQ1 4Y52I 5IP7I 4NB8A 1KD12 4A3DI 3NDJA 2JA6I 2JMOA 3GCFA 3D9XA 3I561 2O4HA 2I3CA 1AA6A 1S72Z 4A3KI 2E2II 1VQ5Z 2F4MA 1Z03A 3CC7Z 4BXXI 1Q811 1Q16A 1VQ6Z 2EGTA 1TWHI 4BY1I 1Q7Y2 1FDIA 4MD9A 2JIMA 4NBCA 3HOVI 3J7A4 2QKDA 3G6E1 3HKZA 1VQPZ 2WAQA 3FQQA 5IT9b 4DK1A 2KI7B 1ML8A 2QREB 5FLMI 5T64A 1RNIA 4QTUA 3CCMZ 1I50I 2PMZA 3GTLI 2J6AA 1ZH1A 3QWUA 1YJWZ 4E2YA 3K7AI 3GTOI 3PO2I 4NFRA 2IZ4A 2WB1A 1USPB
chains in the Genus database with same CATH topology
3MONA 2Y0SA 1VQN1 3HOYI 3NH8A 3GTGI 3ESWA 3BG1B 3VMIA 4NBEA 4CL1A 2OOYB 2P28A 1Q862 1Q812 3VTNA 2R93I 2RPRA 2W03A 3IF8A 1YI21 2V8IA 5T67A 2OTLZ 5C4JI 1TWFI 4A3MI 4A3CI 2PK7A 2V8JA 4A3BI 2LFUA 3S1QI 2OZKA 3CCEZ 1N8R2 3NDIA 3GTMS 3J81b 4E32A 2R6MA 3S17I 2F4OA 3OW2Y 4S1TA 1Q821 2G2KA 2JA5I 3OW2Z 5A2Qf 3RZDI 4MD7A 1YJ91 2VUMI 3FKII 1YIJ1 1QYPA 4MRIA 1YIT1 1JWHC 1YI2Z 4XX2A 1RO4A 2OTJZ 2B63I 1VQMZ 2DE7A 3J80f 1VQK1 1USPA 4NB9A 1M901 1WCMI 3Q87A 5C3EI 2Q4ZA 3M3YI 1M1K1 5LL6f 2NVTI 4HGZA 2Q51A 3KIFA 3CPWZ 2QRCB 3H0GI 3CC21 4HH4A 1X3WA 4DQYB 3I07A 3HOXI 3HOUI 4BBRI 2PM9A 2HF1A 4A3II 3GTMI 3CCUZ 3S1RI 3CQZI 3IX0A 3GTJI 1Q822 3CCRZ 1VQ41 1YJ9Z 3U50C 1RO0A 1TWGI 4MXUA 3S2HI 2GTIA 1YITZ 5CM2M 4NBBA 3VB9A 2LIYA 1VQLZ 2E2HI 3CCV1 4NBAA 1JJ2Y 3G4S1 1P9NA 4QTTA 2ZAEB 4Y7NI 1JJ2Z 3IFUA 3CD61 3PO3S 3CMA1 4RS4A 1K732 1YJN1 1NJI2 2YU9I 5T6BA 2GU2A 2M48A 4E30A 1VQ8Z 3CCQZ 2K3RA 3HOWI 4NBHA 2RBLA 3I4MI 5FLXb 4BBSI 2K5RA 3I56Z 2JUBA 5IT9f 5D1OB 4DGLA 4AYBA 3LUSA 1YUKA 3MZKB 3CCVZ 2H85A 4X6AI 3G4SZ 3CCJ1 3G6EZ 4A3EI 3CCS1 3CMAZ 3S2DI 1QVFY 1YHQ1 1QVFZ 3PO3I 4A3GI 1K8A1 2HU9A 5D1PA 2RIQA 1NUIA 1LQLA 3NH5A 4NH1C 1VQ71 1I3QI 3S1MI 3CXCY 1VQNZ 2NVXI 3CXCZ 2JA7I 3F3PC 1K83I 1KRLA 5A2Qb 3CME1 1RQFA 3D6WA 2DE6A 1K9M1 2NVQI 3HOZI 3S16I 1PFTA 3CCJZ 1VQO1 3J81f 1NP6A 4RVDA 2QRDB 4MONA 1KD11 3GKQA 3KIHA 3S15I 1TFIA 5D1OA 2QR1B 1X3ZA 1VQ7Z 1S721 1VQ51 3CC71 2AKLA 1Q7Y1 2E2JI 3I551 1VQ61 2NVYI 3JAMf 3GTQI 4BY7I 2QA41 1WIIA 2GTHA 2O53A 1Z01A 3CMEZ 1YIJZ 2M6NA 1TWCI 4E33A 3CCM1 4RVGA 1Z02A 4MD8A 1TWAI 3MZLB 1VQKZ 2R7ZI 1YJW1 3EEDA 1QVGY 3CC41 3S14I 2BJOA 2W04A 3FQMA 4E2XA 1M902 1VLAA 4RVFA 3CCL1 2RT9A 4RVHA 1M1K2 4NBDA 2DE5A 1Q861 3I55Z 3CC2Z 2OOXB 2R92I 2JA8I 2RHBA 2QLVB 2QA4Z 4A93I 1VQ4Z 3NH4A 1ZB9A 2OTL1 4EWCA 1KC81 3T4NB 2JNYA 3H3VJ 1S7MA 4TNUA 1N8R1 3CC4Z 3TDHB 4NBFA 3CCE1 3CD6Z 5FLXf 3CCLZ 3GTPI 3G711 2JS4A 5IP9I 3EERA 4NBGA 1YJNZ 3RZOI 2VF1A 3BG0B 3P5JB 2VUGA 3GTKI 5AN9F 1VQ91 4A3JI 1KQSY 4A3LI 2QEX1 2KPIA 1N2FA 1Y1WI 1KQSZ 2OTJ1 2YADA 1VQM1 1R9TI 1ZB8A 2IZ3A 5C44I 4E2WA 1Y1VS 4RV9A 1KC82 3TE5B 1DL6A 3J80b 4E31A 1X0TA 3CCSZ 3G71Z 3VMGA 1I6HI 1YHQZ 2E9HA 3VMHA 3CCU1 3CCR1 2P3YA 1K8A2 4E2ZA 1QF8A 2JR6A 1VQ9Z 2QEXZ 3S1NI 3F3FC 1VQL1 2V8KA 1W2BY 3JAMb 1L1OC 1W2BZ 4MH4A 5C4XI 1RLYA 3NFZA 1K731 3CPWY 4A3FI 1VQP1 1SFOI 4NOZA 1NJI1 1Y1VI 1K9M2 1VQOZ 1WW9A 3I4NI 1YUAA 3M4OI 4HGYA 1RO2A 1QVGZ 1VQ81 3CCQ1 4Y52I 5IP7I 4NB8A 1KD12 4A3DI 3NDJA 2JA6I 2JMOA 3GCFA 3D9XA 3I561 2O4HA 2I3CA 1S72Z 4A3KI 2E2II 1VQ5Z 2F4MA 1Z03A 3CC7Z 4BXXI 1Q811 1VQ6Z 2EGTA 1TWHI 4BY1I 1Q7Y2 4MD9A 4NBCA 3HOVI 3J7A4 2QKDA 3G6E1 3HKZA 1VQPZ 2WAQA 3FQQA 5IT9b 4DK1A 2KI7B 1ML8A 2QREB 5FLMI 5T64A 1RNIA 4QTUA 3CCMZ 1I50I 2PMZA 3GTLI 2J6AA 1ZH1A 3QWUA 1YJWZ 4E2YA 3K7AI 3GTOI 3PO2I 4NFRA 2IZ4A 2WB1A 1USPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A2Q b;  5LL6 f;  3J80 b;  3J81 b;  5FLX b;  5IT9 b;  3JAM b;  3J7A 4; 
#chains in the Genus database with same CATH topology
 3MON A;  2Y0S A;  1VQN 1;  3HOY I;  3NH8 A;  3GTG I;  3ESW A;  3BG1 B;  3VMI A;  4NBE A;  4CL1 A;  2OOY B;  2P28 A;  1Q86 2;  1Q81 2;  3VTN A;  2R93 I;  1Y8C A;  2RPR A;  2W03 A;  3IF8 A;  1YI2 1;  2JIQ A;  2V8I A;  5T67 A;  1WZN A;  2OTL Z;  5C4J I;  1TWF I;  4A3M I;  4A3C I;  2PK7 A;  1WJ2 A;  2V8J A;  4A3B I;  2LFU A;  3S1Q I;  2OZK A;  2AYD A;  3CCE Z;  1N8R 2;  1QXF A;  3NDI A;  3GTM S;  3J81 b;  4E32 A;  2R6M A;  3S17 I;  2F4O A;  3OW2 Y;  4S1T A;  1Q82 1;  2G2K A;  2JA5 I;  3OW2 Z;  5A2Q f;  3RZD I;  4MD7 A;  1YJ9 1;  2VUM I;  3FKI I;  1YIJ 1;  1QYP A;  4MRI A;  1YIT 1;  1JWH C;  1YI2 Z;  2JIO A;  4XX2 A;  1RO4 A;  2OTJ Z;  1FDO A;  2B63 I;  1VQM Z;  2DE7 A;  3J80 f;  1VQK 1;  1USP A;  4NB9 A;  1M90 1;  1WCM I;  3Q87 A;  5C3E I;  2NAP A;  2Q4Z A;  3M3Y I;  1M1K 1;  5LL6 f;  2NVT I;  4HGZ A;  2Q51 A;  3KIF A;  3CPW Z;  2QRC B;  3H0G I;  3CC2 1;  4HH4 A;  1X3W A;  4DQY B;  3I07 A;  3HOX I;  3HOU I;  4BBR I;  2PM9 A;  2HF1 A;  4A3I I;  3GTM I;  3CCU Z;  3S1R I;  3CQZ I;  3IX0 A;  3GTJ I;  1Q82 2;  3CCR Z;  1VQ4 1;  1YJ9 Z;  3U50 C;  1RO0 A;  1TWG I;  4MXU A;  3S2H I;  2GTI A;  1YIT Z;  5CM2 M;  4NBB A;  3VB9 A;  2LIY A;  1VQL Z;  2E2H I;  3CCV 1;  4NBA A;  1JJ2 Y;  3G4S 1;  1P9N A;  4QTT A;  2ZAE B;  4Y7N I;  1JJ2 Z;  3IFU A;  3CD6 1;  3PO3 S;  3D2L A;  3CMA 1;  4RS4 A;  1K73 2;  1YJN 1;  1NJI 2;  2YU9 I;  5T6B A;  2GU2 A;  2M48 A;  4E30 A;  1VQ8 Z;  3CCQ Z;  2K3R A;  3HOW I;  4NBH A;  2RBL A;  3I4M I;  5FLX b;  4BBS I;  2K5R A;  3I56 Z;  2JUB A;  5IT9 f;  5D1O B;  4DGL A;  4AYB A;  3LUS A;  1YUK A;  3MZK B;  3CCV Z;  2VPY A;  2H85 A;  4X6A I;  3G4S Z;  3CCJ 1;  2VPW A;  3G6E Z;  4A3E I;  2E7Z A;  3CCS 1;  3CMA Z;  3S2D I;  1QVF Y;  1YHQ 1;  1QVF Z;  3PO3 I;  4A3G I;  1K8A 1;  3IR7 A;  2HU9 A;  5D1P A;  2RIQ A;  1NUI A;  1LQL A;  3NH5 A;  2JIP A;  4NH1 C;  1VQ7 1;  1I3Q I;  3S1M I;  1SIW A;  3CXC Y;  1VQN Z;  2NVX I;  3CXC Z;  2JA7 I;  3F3P C;  1K83 I;  1KRL A;  5A2Q b;  3CME 1;  1RQF A;  3D6W A;  2DE6 A;  1K9M 1;  2NVQ I;  3HOZ I;  3S16 I;  1PFT A;  3CCJ Z;  1VQO 1;  3J81 f;  1NP6 A;  4RVD A;  2QRD B;  4MON A;  1KD1 1;  3GKQ A;  3KIH A;  2VPZ A;  3S15 I;  1TFI A;  5D1O A;  2QR1 B;  1X3Z A;  1VQ7 Z;  1S72 1;  1VQ5 1;  3CC7 1;  2AKL A;  1Q7Y 1;  2E2J I;  3I55 1;  1VQ6 1;  2NVY I;  3JAM f;  3GTQ I;  4BY7 I;  2QA4 1;  1WII A;  2GTH A;  2O53 A;  1Z01 A;  3CME Z;  1YIJ Z;  2M6N A;  1TWC I;  4E33 A;  3CCM 1;  2LEX A;  4RVG A;  1Z02 A;  4MD8 A;  1TWA I;  3MZL B;  1VQK Z;  2R7Z I;  1YJW 1;  3EED A;  1QVG Y;  3CC4 1;  3S14 I;  2BJO A;  2W04 A;  3FQM A;  4E2X A;  1M90 2;  1VLA A;  4RVF A;  3CCL 1;  2RT9 A;  4RVH A;  1M1K 2;  4NBD A;  2DE5 A;  2V3V A;  1Q86 1;  3I55 Z;  3CC2 Z;  2OOX B;  2R92 I;  2JA8 I;  2RHB A;  2QLV B;  2QA4 Z;  4A93 I;  1VQ4 Z;  3NH4 A;  1ZB9 A;  2OTL 1;  4EWC A;  1KC8 1;  3T4N B;  2JNY A;  3H3V J;  1S7M A;  4TNU A;  1N8R 1;  3CC4 Z;  3TDH B;  4NBF A;  3CCE 1;  3CD6 Z;  5FLX f;  3CCL Z;  3GTP I;  3G71 1;  2JS4 A;  5IP9 I;  3EER A;  4NBG A;  1YJN Z;  3RZO I;  2VF1 A;  3BG0 B;  3P5J B;  2VUG A;  3GTK I;  5AN9 F;  1VQ9 1;  4A3J I;  1KQS Y;  4A3L I;  2QEX 1;  2KPI A;  1N2F A;  1Y1W I;  1KQS Z;  2OTJ 1;  2YAD A;  1VQM 1;  1R9T I;  1ZB8 A;  2IZ3 A;  5C44 I;  4E2W A;  1Y1V S;  4RV9 A;  1KC8 2;  3TE5 B;  1DL6 A;  3J80 b;  4E31 A;  1X0T A;  3CCS Z;  3G71 Z;  3VMG A;  2V45 A;  1I6H I;  1YHQ Z;  2E9H A;  3VMH A;  3CCU 1;  3CCR 1;  2P3Y A;  1K8A 2;  4E2Z A;  1QF8 A;  2JR6 A;  1VQ9 Z;  2JIR A;  2QEX Z;  3S1N I;  3F3F C;  1VQL 1;  2V8K A;  1W2B Y;  3JAM b;  1L1O C;  1W2B Z;  4MH4 A;  5C4X I;  1RLY A;  3NFZ A;  2VPX A;  1K73 1;  3CPW Y;  4A3F I;  1VQP 1;  1SFO I;  4NOZ A;  1NJI 1;  1Y1V I;  2IV2 X;  1K9M 2;  1VQO Z;  1WW9 A;  3I4N I;  1YUA A;  3M4O I;  4HGY A;  1RO2 A;  1QVG Z;  1VQ8 1;  3CCQ 1;  4Y52 I;  5IP7 I;  4NB8 A;  1KD1 2;  4A3D I;  3NDJ A;  2JA6 I;  2JMO A;  3GCF A;  3D9X A;  3I56 1;  2O4H A;  2I3C A;  1AA6 A;  1S72 Z;  4A3K I;  2E2I I;  1VQ5 Z;  2F4M A;  1Z03 A;  3CC7 Z;  4BXX I;  1Q81 1;  1Q16 A;  1VQ6 Z;  2EGT A;  1TWH I;  4BY1 I;  1Q7Y 2;  1FDI A;  4MD9 A;  2JIM A;  4NBC A;  3HOV I;  3J7A 4;  2QKD A;  3G6E 1;  3HKZ A;  1VQP Z;  2WAQ A;  3FQQ A;  5IT9 b;  4DK1 A;  2KI7 B;  1ML8 A;  2QRE B;  5FLM I;  5T64 A;  1RNI A;  4QTU A;  3CCM Z;  1I50 I;  2PMZ A;  3GTL I;  2J6A A;  1ZH1 A;  3QWU A;  1YJW Z;  4E2Y A;  3K7A I;  3GTO I;  3PO2 I;  4NFR A;  2IZ4 A;  2WB1 A;  1USP B; 
#chains in the Genus database with same CATH homology
 3MON A;  2Y0S A;  1VQN 1;  3HOY I;  3NH8 A;  3GTG I;  3ESW A;  3BG1 B;  3VMI A;  4NBE A;  4CL1 A;  2OOY B;  2P28 A;  1Q86 2;  1Q81 2;  3VTN A;  2R93 I;  2RPR A;  2W03 A;  3IF8 A;  1YI2 1;  2V8I A;  5T67 A;  2OTL Z;  5C4J I;  1TWF I;  4A3M I;  4A3C I;  2PK7 A;  2V8J A;  4A3B I;  2LFU A;  3S1Q I;  2OZK A;  3CCE Z;  1N8R 2;  3NDI A;  3GTM S;  3J81 b;  4E32 A;  2R6M A;  3S17 I;  2F4O A;  3OW2 Y;  4S1T A;  1Q82 1;  2G2K A;  2JA5 I;  3OW2 Z;  5A2Q f;  3RZD I;  4MD7 A;  1YJ9 1;  2VUM I;  3FKI I;  1YIJ 1;  1QYP A;  4MRI A;  1YIT 1;  1JWH C;  1YI2 Z;  4XX2 A;  1RO4 A;  2OTJ Z;  2B63 I;  1VQM Z;  2DE7 A;  3J80 f;  1VQK 1;  1USP A;  4NB9 A;  1M90 1;  1WCM I;  3Q87 A;  5C3E I;  2Q4Z A;  3M3Y I;  1M1K 1;  5LL6 f;  2NVT I;  4HGZ A;  2Q51 A;  3KIF A;  3CPW Z;  2QRC B;  3H0G I;  3CC2 1;  4HH4 A;  1X3W A;  4DQY B;  3I07 A;  3HOX I;  3HOU I;  4BBR I;  2PM9 A;  2HF1 A;  4A3I I;  3GTM I;  3CCU Z;  3S1R I;  3CQZ I;  3IX0 A;  3GTJ I;  1Q82 2;  3CCR Z;  1VQ4 1;  1YJ9 Z;  3U50 C;  1RO0 A;  1TWG I;  4MXU A;  3S2H I;  2GTI A;  1YIT Z;  5CM2 M;  4NBB A;  3VB9 A;  2LIY A;  1VQL Z;  2E2H I;  3CCV 1;  4NBA A;  1JJ2 Y;  3G4S 1;  1P9N A;  4QTT A;  2ZAE B;  4Y7N I;  1JJ2 Z;  3IFU A;  3CD6 1;  3PO3 S;  3CMA 1;  4RS4 A;  1K73 2;  1YJN 1;  1NJI 2;  2YU9 I;  5T6B A;  2GU2 A;  2M48 A;  4E30 A;  1VQ8 Z;  3CCQ Z;  2K3R A;  3HOW I;  4NBH A;  2RBL A;  3I4M I;  5FLX b;  4BBS I;  2K5R A;  3I56 Z;  2JUB A;  5IT9 f;  5D1O B;  4DGL A;  4AYB A;  3LUS A;  1YUK A;  3MZK B;  3CCV Z;  2H85 A;  4X6A I;  3G4S Z;  3CCJ 1;  3G6E Z;  4A3E I;  3CCS 1;  3CMA Z;  3S2D I;  1QVF Y;  1YHQ 1;  1QVF Z;  3PO3 I;  4A3G I;  1K8A 1;  2HU9 A;  5D1P A;  2RIQ A;  1NUI A;  1LQL A;  3NH5 A;  4NH1 C;  1VQ7 1;  1I3Q I;  3S1M I;  3CXC Y;  1VQN Z;  2NVX I;  3CXC Z;  2JA7 I;  3F3P C;  1K83 I;  1KRL A;  5A2Q b;  3CME 1;  1RQF A;  3D6W A;  2DE6 A;  1K9M 1;  2NVQ I;  3HOZ I;  3S16 I;  1PFT A;  3CCJ Z;  1VQO 1;  3J81 f;  1NP6 A;  4RVD A;  2QRD B;  4MON A;  1KD1 1;  3GKQ A;  3KIH A;  3S15 I;  1TFI A;  5D1O A;  2QR1 B;  1X3Z A;  1VQ7 Z;  1S72 1;  1VQ5 1;  3CC7 1;  2AKL A;  1Q7Y 1;  2E2J I;  3I55 1;  1VQ6 1;  2NVY I;  3JAM f;  3GTQ I;  4BY7 I;  2QA4 1;  1WII A;  2GTH A;  2O53 A;  1Z01 A;  3CME Z;  1YIJ Z;  2M6N A;  1TWC I;  4E33 A;  3CCM 1;  4RVG A;  1Z02 A;  4MD8 A;  1TWA I;  3MZL B;  1VQK Z;  2R7Z I;  1YJW 1;  3EED A;  1QVG Y;  3CC4 1;  3S14 I;  2BJO A;  2W04 A;  3FQM A;  4E2X A;  1M90 2;  1VLA A;  4RVF A;  3CCL 1;  2RT9 A;  4RVH A;  1M1K 2;  4NBD A;  2DE5 A;  1Q86 1;  3I55 Z;  3CC2 Z;  2OOX B;  2R92 I;  2JA8 I;  2RHB A;  2QLV B;  2QA4 Z;  4A93 I;  1VQ4 Z;  3NH4 A;  1ZB9 A;  2OTL 1;  4EWC A;  1KC8 1;  3T4N B;  2JNY A;  3H3V J;  1S7M A;  4TNU A;  1N8R 1;  3CC4 Z;  3TDH B;  4NBF A;  3CCE 1;  3CD6 Z;  5FLX f;  3CCL Z;  3GTP I;  3G71 1;  2JS4 A;  5IP9 I;  3EER A;  4NBG A;  1YJN Z;  3RZO I;  2VF1 A;  3BG0 B;  3P5J B;  2VUG A;  3GTK I;  5AN9 F;  1VQ9 1;  4A3J I;  1KQS Y;  4A3L I;  2QEX 1;  2KPI A;  1N2F A;  1Y1W I;  1KQS Z;  2OTJ 1;  2YAD A;  1VQM 1;  1R9T I;  1ZB8 A;  2IZ3 A;  5C44 I;  4E2W A;  1Y1V S;  4RV9 A;  1KC8 2;  3TE5 B;  1DL6 A;  3J80 b;  4E31 A;  1X0T A;  3CCS Z;  3G71 Z;  3VMG A;  1I6H I;  1YHQ Z;  2E9H A;  3VMH A;  3CCU 1;  3CCR 1;  2P3Y A;  1K8A 2;  4E2Z A;  1QF8 A;  2JR6 A;  1VQ9 Z;  2QEX Z;  3S1N I;  3F3F C;  1VQL 1;  2V8K A;  1W2B Y;  3JAM b;  1L1O C;  1W2B Z;  4MH4 A;  5C4X I;  1RLY A;  3NFZ A;  1K73 1;  3CPW Y;  4A3F I;  1VQP 1;  1SFO I;  4NOZ A;  1NJI 1;  1Y1V I;  1K9M 2;  1VQO Z;  1WW9 A;  3I4N I;  1YUA A;  3M4O I;  4HGY A;  1RO2 A;  1QVG Z;  1VQ8 1;  3CCQ 1;  4Y52 I;  5IP7 I;  4NB8 A;  1KD1 2;  4A3D I;  3NDJ A;  2JA6 I;  2JMO A;  3GCF A;  3D9X A;  3I56 1;  2O4H A;  2I3C A;  1S72 Z;  4A3K I;  2E2I I;  1VQ5 Z;  2F4M A;  1Z03 A;  3CC7 Z;  4BXX I;  1Q81 1;  1VQ6 Z;  2EGT A;  1TWH I;  4BY1 I;  1Q7Y 2;  4MD9 A;  4NBC A;  3HOV I;  3J7A 4;  2QKD A;  3G6E 1;  3HKZ A;  1VQP Z;  2WAQ A;  3FQQ A;  5IT9 b;  4DK1 A;  2KI7 B;  1ML8 A;  2QRE B;  5FLM I;  5T64 A;  1RNI A;  4QTU A;  3CCM Z;  1I50 I;  2PMZ A;  3GTL I;  2J6A A;  1ZH1 A;  3QWU A;  1YJW Z;  4E2Y A;  3K7A I;  3GTO I;  3PO2 I;  4NFR A;  2IZ4 A;  2WB1 A;  1USP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...