3GTQI

Backtracked rna polymerase ii complex induced by damage
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
total genus 9
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtqI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtqI02
3HOWI 2JNYA 1PFTA 1DL6A 1LQLA 2K5RA 1TFIA 1VLAA 3U50C 2DE6A 4NB9A 5C4JI 3GTPI 3VMHA 1N2FA 5C44I 3LUSA 3GTMS 4A3JI 3S17I 3RZOI 4A3LI 3S16I 3H3VJ 1TWAI 5CM2M 5FLMI 1RO4A 4X6AI 2P3YA 1RLYA 3GCFA 4BBRI 3ESWA 1NUIA 4A3CI 1L1OC 3GTJI 3FKII 5IP9I 2E2HI 1WW9A 2NVYI 4NBHA 3CQZI 3Q87A 4BXXI 1ML8A 4NBFA 2JA5I 3PO3S 3S1RI 4A93I 1I50I 2BJOA 4A3DI 3EERA 3I4MI 3GTMI 2HF1A 4NOZA 2JA7I 1Y1WI 4A3BI 3GTLI 2F4MA 4QTTA 4A3EI 4NBEA 1SFOI 3HOYI 2DE7A 4BBSI 3S2DI 2R93I 1X3ZA 5C3EI 3S1QI 2JA8I 4BY7I 3I07A 3HOUI 3PO3I 2B63I 2R92I 3GKQA 2NVXI 2RBLA 4BY1I 1Y1VS 2KPIA 1X3WA 4NBGA 2J6AA 3S1MI 2F4OA 3GTOI 2E2JI 4A3II 5C4XI 1K83I 1TWFI 4NB8A 3K7AI 3VMGA 3HOXI 1TWCI 2VUMI 2R7ZI 1USPB 3GTQI 3GTKI 3GTGI 3HOVI 1YUAA 2AKLA 3S15I 1WCMI 1QYPA 3M3YI 4NBAA 4A3KI 1Y1VI 2JR6A 2PK7A 5IP7I 4NBCA 4QTUA 3M4OI 1TWGI 4A3FI 4Y7NI 3I4NI 4MH4A 2JS4A 3S14I 4NBDA 2YU9I 2E2II 1ZB8A 4Y52I 1I3QI 3D6WA 4NBBA 4A3GI 3S1NI 3RZDI 2NVTI 1R9TI 3PO2I 3VMIA 1TWHI 4A3MI 2NVQI 1ZB9A 1USPA 3S2HI 2DE5A 1I6HI 4XX2A 3VB9A 3H0GI 2JA6I 3HOZI
chains in the Genus database with same CATH superfamily
3I551 2OOXB 3HOWI 2E7ZA 3CC41 1VLAA 1Y8CA 3U50C 1YIT1 3GTPI 3F3PC 1P9NA 3GTMS 3TE5B 4MONA 1VQMZ 2E9HA 4NFRA 2V8IA 2QRCB 3CPWZ 3BG0B 1VQ9Z 3ESWA 3I561 5IP9I 2V8KA 4NBHA 2JA5I 4NBFA 2V45A 1K731 4A93I 1YJ9Z 1I50I 2BJOA 2OTL1 2OZKA 2H85A 2JIPA 2JIQA 3G4S1 3J7A4 4NOZA 2JA7I 1Y1WI 2EGTA 2PM9A 2GTIA 4NBEA 3HOYI 1QVGY 1YHQ1 4BBSI 4RVGA 5C3EI 3S1QI 2OTJZ 1Q7Y1 5IT9b 3I07A 3NDIA 1NJI2 3GKQA 4RS4A 1VQ81 1X0TA 4NH1C 1S7MA 4NBGA 3TDHB 1AA6A 4MD9A 2E2JI 5C4XI 1TWFI 3CC21 3IX0A 3JAMf 1WIIA 2GU2A 1RQFA 2VPYA 4MD7A 3GTQI 3HOVI 1KRLA 5LL6f 1QVFZ 1YJN1 1JJ2Y 1VQ4Z 3D9XA 2PK7A 3CCUZ 1YIJ1 3CCM1 1TWGI 4A3FI 4Y7NI 4E30A 3I4NI 4MH4A 1VQ51 2QREB 2G2KA 2JMOA 3G711 2QA41 1ZB8A 3J81b 3OW2Z 2LEXA 4A3GI 2QEX1 3CCE1 1VQ71 2NVTI 3NDJA 4MRIA 3VMIA 1VQ61 4E32A 1VQN1 5D1OB 1VQK1 2JNYA 1PFTA 2V3VA 3CCV1 5C44I 1M1K2 1W2BY 4E33A 3CMA1 1YUKA 4RVHA 3CCS1 2PMZA 1TWAI 1Q822 4BBRI 4E2YA 3G6E1 3CME1 3S1RI 4DQYB 1KQSZ 4A3DI 3EERA 2Q4ZA 1M902 2F4MA 4MXUA 1VQOZ 4CL1A 3CCJ1 2DE7A 1X3ZA 3CCR1 1VQPZ 3CC7Z 3HOUI 4S1TA 2B63I 3CCL1 2O53A 2V8JA 1Q811 2NVXI 2RBLA 2KPIA 1X3WA 1Z01A 3CCQ1 2F4OA 2R6MA 2HU9A 1K83I 3K7AI 3VMGA 2VPWA 2R7ZI 2WAQA 4HGYA 3GTKI 1N8R2 2AKLA 3S15I 3J81f 2JIRA 1QYPA 1S721 1KC81 1QVGZ 4NBCA 3NH5A 1Q862 2JUBA 4HGZA 2NAPA 1K9M2 2AYDA 4NBDA 2YU9I 2E2II 1YJWZ 1VQLZ 5FLXf 4NBBA 1YI2Z 3F3FC 3RZDI 4RVDA 2QLVB 3CD6Z 1WZNA 2P28A 2NVQI 2VPXA 1I6HI 4XX2A 4MD8A 3VB9A 2KI7B 3QWUA 1DL6A 1LQLA 2K5RA 1TFIA 4DK1A 5C4JI 4NB9A 1VQM1 1JJ2Z 3I55Z 3CC4Z 3LUSA 1VQ91 3RZOI 1Q7Y2 4A3LI 1YITZ 3H3VJ 5CM2M 1M1K1 1RO4A 1RLYA 1QF8A 2RHBA 5T6BA 1L1OC 3GTJI 1Q821 3FKII 1YJ91 3D2LA 4BXXI 1ML8A 3I56Z 3IF8A 1RNIA 3MZKB 3IFUA 4A3BI 2OTLZ 1KD12 1RO2A 2OTJ1 3KIFA 1SFOI 3G4SZ 1Z03A 5FLXb 4E31A 1Q16A 3S2DI 1K8A2 2JA8I 4BY7I 2GTHA 3P5JB 1YHQZ 3PO3I 3NH4A 2R92I 1W2BZ 4BY1I 2W04A 2J6AA 3S1MI 3GTOI 1VQ8Z 2QR1B 4NB8A 3MONA 2IZ3A 2VUMI 2O4HA 1USPB 3NH8A 3CC2Z 3GTGI 1QXFA 4E2WA 2Q51A 1YUAA 1VQ41 4DGLA 3CCU1 4NBAA 1Y1VI 4EWCA 5IP7I 4QTUA 5T64A 1YJNZ 1NJI1 3M4OI 5D1PA 3CPWY 1Q861 3HKZA 1YIJZ 2JS4A 2I3CA 3CCMZ 1ZH1A 2RT9A 3S14I 1K9M1 3FQMA 4E2XA 5A2Qb 4Y52I 1I3QI 2JIMA 3D6WA 1VQ5Z 2IZ4A 3G71Z 2M6NA 2QA4Z 2QEXZ 1TWHI 3CCEZ 1VQ7Z 3S2HI 2JA6I 3J80b 1VQ6Z 2JIOA 1VQNZ 2LFUA 2DE6A 2RIQA 3EEDA 3VMHA 1N2FA 1VQKZ 4E2ZA 1RO0A 4A3JI 3S17I 3S16I 1WJ2A 4RV9A 2OOYB 3CCVZ 4HH4A 5FLMI 1JWHC 4X6AI 2P3YA 3GCFA 1Q812 3CMAZ 4A3CI 1NUIA 2RPRA 3CCSZ 2E2HI 5AN9F 1K732 1WW9A 2NVYI 2ZAEB 3CQZI 3Q87A 3PO3S 1SIWA 4TNUA 1VQO1 3I4MI 3G6EZ 1QVFY 3CMEZ 3GTMI 2HF1A 2M48A 2IV2X 3GTLI 4QTTA 4A3EI 1VQP1 3CC71 1KC82 1KD11 2R93I 1K8A1 4RVFA 2QRDB 3CCJZ 2W03A 3CCRZ 3T4NB 2LIYA 1Y1VS 3OW2Y 3CCLZ 4A3II 5T67A 2YADA 3HOXI 1NP6A 1TWCI 3CCQZ 3CXCY 2QKDA 1M901 3IR7A 1WCMI 5D1OA 5A2Qf 3M3YI 2VUGA 4AYBA 4A3KI 3NFZA 2JR6A 3CXCZ 3KIHA 1S72Z 3MZLB 2VF1A 1Z02A 3J80f 3JAMb 1FDOA 1YJW1 1VQL1 1YI21 2K3RA 2VPZA 3VTNA 2WB1A 3CD61 3S1NI 1KQSY 1R9TI 2Y0SA 1N8R1 5IT9f 3PO2I 1FDIA 4A3MI 1ZB9A 1USPA 3BG1B 2DE5A 3FQQA 3H0GI 3HOZI
chains in the Genus database with same CATH topology
3I551 2OOXB 3HOWI 3CC41 1VLAA 3U50C 1YIT1 3GTPI 3F3PC 1P9NA 3GTMS 3TE5B 4MONA 1VQMZ 2E9HA 4NFRA 2V8IA 2QRCB 3CPWZ 3BG0B 1VQ9Z 3ESWA 3I561 5IP9I 2V8KA 4NBHA 2JA5I 4NBFA 1K731 4A93I 1YJ9Z 1I50I 2BJOA 2OTL1 2OZKA 2H85A 3G4S1 3J7A4 4NOZA 2JA7I 1Y1WI 2EGTA 2PM9A 2GTIA 4NBEA 3HOYI 1QVGY 1YHQ1 4BBSI 4RVGA 5C3EI 3S1QI 2OTJZ 1Q7Y1 5IT9b 3I07A 3NDIA 1NJI2 3GKQA 4RS4A 1VQ81 1X0TA 4NH1C 1S7MA 4NBGA 3TDHB 4MD9A 2E2JI 5C4XI 1TWFI 3CC21 3IX0A 3JAMf 1WIIA 2GU2A 1RQFA 4MD7A 3GTQI 3HOVI 1KRLA 5LL6f 1QVFZ 1YJN1 1JJ2Y 1VQ4Z 3D9XA 2PK7A 3CCUZ 1YIJ1 3CCM1 1TWGI 4A3FI 4Y7NI 4E30A 3I4NI 4MH4A 1VQ51 2QREB 2G2KA 2JMOA 3G711 2QA41 1ZB8A 3J81b 3OW2Z 4A3GI 2QEX1 3CCE1 1VQ71 2NVTI 3NDJA 4MRIA 3VMIA 1VQ61 4E32A 1VQN1 5D1OB 1VQK1 2JNYA 1PFTA 3CCV1 5C44I 1M1K2 1W2BY 4E33A 3CMA1 1YUKA 4RVHA 3CCS1 2PMZA 1TWAI 1Q822 4BBRI 4E2YA 3G6E1 3CME1 3S1RI 4DQYB 1KQSZ 4A3DI 3EERA 2Q4ZA 1M902 2F4MA 4MXUA 1VQOZ 4CL1A 3CCJ1 2DE7A 1X3ZA 3CCR1 1VQPZ 3CC7Z 3HOUI 4S1TA 2B63I 3CCL1 2O53A 2V8JA 1Q811 2NVXI 2RBLA 2KPIA 1X3WA 1Z01A 3CCQ1 2F4OA 2R6MA 2HU9A 1K83I 3K7AI 3VMGA 2R7ZI 2WAQA 4HGYA 3GTKI 1N8R2 2AKLA 3S15I 3J81f 1QYPA 1S721 1KC81 1QVGZ 4NBCA 3NH5A 1Q862 2JUBA 4HGZA 1K9M2 4NBDA 2YU9I 2E2II 1YJWZ 1VQLZ 5FLXf 4NBBA 1YI2Z 3F3FC 3RZDI 4RVDA 2QLVB 3CD6Z 2P28A 2NVQI 1I6HI 4XX2A 4MD8A 3VB9A 2KI7B 3QWUA 1DL6A 1LQLA 2K5RA 1TFIA 4DK1A 5C4JI 4NB9A 1VQM1 1JJ2Z 3I55Z 3CC4Z 3LUSA 1VQ91 3RZOI 1Q7Y2 4A3LI 1YITZ 3H3VJ 5CM2M 1M1K1 1RO4A 1RLYA 1QF8A 2RHBA 5T6BA 1L1OC 3GTJI 1Q821 3FKII 1YJ91 4BXXI 1ML8A 3I56Z 3IF8A 1RNIA 3MZKB 3IFUA 4A3BI 2OTLZ 1KD12 1RO2A 2OTJ1 3KIFA 1SFOI 3G4SZ 1Z03A 5FLXb 4E31A 3S2DI 1K8A2 2JA8I 4BY7I 2GTHA 3P5JB 1YHQZ 3PO3I 3NH4A 2R92I 1W2BZ 4BY1I 2W04A 2J6AA 3S1MI 3GTOI 1VQ8Z 2QR1B 4NB8A 3MONA 2IZ3A 2VUMI 2O4HA 1USPB 3NH8A 3CC2Z 3GTGI 4E2WA 2Q51A 1YUAA 1VQ41 4DGLA 3CCU1 4NBAA 1Y1VI 4EWCA 5IP7I 4QTUA 5T64A 1YJNZ 1NJI1 3M4OI 5D1PA 3CPWY 1Q861 3HKZA 1YIJZ 2JS4A 2I3CA 3CCMZ 1ZH1A 2RT9A 3S14I 1K9M1 3FQMA 4E2XA 5A2Qb 4Y52I 1I3QI 3D6WA 1VQ5Z 2IZ4A 3G71Z 2M6NA 2QA4Z 2QEXZ 1TWHI 3CCEZ 1VQ7Z 3S2HI 2JA6I 3J80b 1VQ6Z 1VQNZ 2LFUA 2DE6A 2RIQA 3EEDA 3VMHA 1N2FA 1VQKZ 4E2ZA 1RO0A 4A3JI 3S17I 3S16I 4RV9A 2OOYB 3CCVZ 4HH4A 5FLMI 1JWHC 4X6AI 2P3YA 3GCFA 1Q812 3CMAZ 4A3CI 1NUIA 2RPRA 3CCSZ 2E2HI 5AN9F 1K732 1WW9A 2NVYI 2ZAEB 3CQZI 3Q87A 3PO3S 4TNUA 1VQO1 3I4MI 3G6EZ 1QVFY 3CMEZ 3GTMI 2HF1A 2M48A 3GTLI 4QTTA 4A3EI 1VQP1 3CC71 1KC82 1KD11 2R93I 1K8A1 4RVFA 2QRDB 3CCJZ 2W03A 3CCRZ 3T4NB 2LIYA 1Y1VS 3OW2Y 3CCLZ 4A3II 5T67A 2YADA 3HOXI 1NP6A 1TWCI 3CCQZ 3CXCY 2QKDA 1M901 1WCMI 5D1OA 5A2Qf 3M3YI 2VUGA 4AYBA 4A3KI 3NFZA 2JR6A 3CXCZ 3KIHA 1S72Z 3MZLB 2VF1A 1Z02A 3J80f 3JAMb 1YJW1 1VQL1 1YI21 2K3RA 3VTNA 2WB1A 3CD61 3S1NI 1KQSY 1R9TI 2Y0SA 1N8R1 5IT9f 3PO2I 4A3MI 1ZB9A 1USPA 3BG1B 2DE5A 3FQQA 3H0GI 3HOZI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOW I;  2JNY A;  1PFT A;  1DL6 A;  1LQL A;  2K5R A;  1TFI A;  1VLA A;  3U50 C;  2DE6 A;  4NB9 A;  5C4J I;  3GTP I;  3VMH A;  1N2F A;  5C44 I;  3LUS A;  3GTM S;  4A3J I;  3S17 I;  3RZO I;  4A3L I;  3S16 I;  3H3V J;  1TWA I;  5CM2 M;  5FLM I;  1RO4 A;  4X6A I;  2P3Y A;  1RLY A;  3GCF A;  4BBR I;  3ESW A;  1NUI A;  4A3C I;  1L1O C;  3GTJ I;  3FKI I;  5IP9 I;  2E2H I;  1WW9 A;  2NVY I;  4NBH A;  3CQZ I;  3Q87 A;  4BXX I;  1ML8 A;  4NBF A;  2JA5 I;  3PO3 S;  3S1R I;  4A93 I;  1I50 I;  2BJO A;  4A3D I;  3EER A;  3I4M I;  3GTM I;  2HF1 A;  4NOZ A;  2JA7 I;  1Y1W I;  4A3B I;  3GTL I;  2F4M A;  4QTT A;  4A3E I;  4NBE A;  1SFO I;  3HOY I;  2DE7 A;  4BBS I;  3S2D I;  2R93 I;  1X3Z A;  5C3E I;  3S1Q I;  2JA8 I;  4BY7 I;  3I07 A;  3HOU I;  3PO3 I;  2B63 I;  2R92 I;  3GKQ A;  2NVX I;  2RBL A;  4BY1 I;  1Y1V S;  2KPI A;  1X3W A;  4NBG A;  2J6A A;  3S1M I;  2F4O A;  3GTO I;  2E2J I;  4A3I I;  5C4X I;  1K83 I;  1TWF I;  4NB8 A;  3K7A I;  3VMG A;  3HOX I;  1TWC I;  2VUM I;  2R7Z I;  1USP B;  3GTQ I;  3GTK I;  3GTG I;  3HOV I;  1YUA A;  2AKL A;  3S15 I;  1WCM I;  1QYP A;  3M3Y I;  4NBA A;  4A3K I;  1Y1V I;  2JR6 A;  2PK7 A;  5IP7 I;  4NBC A;  4QTU A;  3M4O I;  1TWG I;  4A3F I;  4Y7N I;  3I4N I;  4MH4 A;  2JS4 A;  3S14 I;  4NBD A;  2YU9 I;  2E2I I;  1ZB8 A;  4Y52 I;  1I3Q I;  3D6W A;  4NBB A;  4A3G I;  3S1N I;  3RZD I;  2NVT I;  1R9T I;  3PO2 I;  3VMI A;  1TWH I;  4A3M I;  2NVQ I;  1ZB9 A;  1USP A;  3S2H I;  2DE5 A;  1I6H I;  4XX2 A;  3VB9 A;  3H0G I;  2JA6 I;  3HOZ I; 
#chains in the Genus database with same CATH topology
 3I55 1;  2OOX B;  3HOW I;  2E7Z A;  3CC4 1;  1VLA A;  1Y8C A;  3U50 C;  1YIT 1;  3GTP I;  3F3P C;  1P9N A;  3GTM S;  3TE5 B;  4MON A;  1VQM Z;  2E9H A;  4NFR A;  2V8I A;  2QRC B;  3CPW Z;  3BG0 B;  1VQ9 Z;  3ESW A;  3I56 1;  5IP9 I;  2V8K A;  4NBH A;  2JA5 I;  4NBF A;  2V45 A;  1K73 1;  4A93 I;  1YJ9 Z;  1I50 I;  2BJO A;  2OTL 1;  2OZK A;  2H85 A;  2JIP A;  2JIQ A;  3G4S 1;  3J7A 4;  4NOZ A;  2JA7 I;  1Y1W I;  2EGT A;  2PM9 A;  2GTI A;  4NBE A;  3HOY I;  1QVG Y;  1YHQ 1;  4BBS I;  4RVG A;  5C3E I;  3S1Q I;  2OTJ Z;  1Q7Y 1;  5IT9 b;  3I07 A;  3NDI A;  1NJI 2;  3GKQ A;  4RS4 A;  1VQ8 1;  1X0T A;  4NH1 C;  1S7M A;  4NBG A;  3TDH B;  1AA6 A;  4MD9 A;  2E2J I;  5C4X I;  1TWF I;  3CC2 1;  3IX0 A;  3JAM f;  1WII A;  2GU2 A;  1RQF A;  2VPY A;  4MD7 A;  3GTQ I;  3HOV I;  1KRL A;  5LL6 f;  1QVF Z;  1YJN 1;  1JJ2 Y;  1VQ4 Z;  3D9X A;  2PK7 A;  3CCU Z;  1YIJ 1;  3CCM 1;  1TWG I;  4A3F I;  4Y7N I;  4E30 A;  3I4N I;  4MH4 A;  1VQ5 1;  2QRE B;  2G2K A;  2JMO A;  3G71 1;  2QA4 1;  1ZB8 A;  3J81 b;  3OW2 Z;  2LEX A;  4A3G I;  2QEX 1;  3CCE 1;  1VQ7 1;  2NVT I;  3NDJ A;  4MRI A;  3VMI A;  1VQ6 1;  4E32 A;  1VQN 1;  5D1O B;  1VQK 1;  2JNY A;  1PFT A;  2V3V A;  3CCV 1;  5C44 I;  1M1K 2;  1W2B Y;  4E33 A;  3CMA 1;  1YUK A;  4RVH A;  3CCS 1;  2PMZ A;  1TWA I;  1Q82 2;  4BBR I;  4E2Y A;  3G6E 1;  3CME 1;  3S1R I;  4DQY B;  1KQS Z;  4A3D I;  3EER A;  2Q4Z A;  1M90 2;  2F4M A;  4MXU A;  1VQO Z;  4CL1 A;  3CCJ 1;  2DE7 A;  1X3Z A;  3CCR 1;  1VQP Z;  3CC7 Z;  3HOU I;  4S1T A;  2B63 I;  3CCL 1;  2O53 A;  2V8J A;  1Q81 1;  2NVX I;  2RBL A;  2KPI A;  1X3W A;  1Z01 A;  3CCQ 1;  2F4O A;  2R6M A;  2HU9 A;  1K83 I;  3K7A I;  3VMG A;  2VPW A;  2R7Z I;  2WAQ A;  4HGY A;  3GTK I;  1N8R 2;  2AKL A;  3S15 I;  3J81 f;  2JIR A;  1QYP A;  1S72 1;  1KC8 1;  1QVG Z;  4NBC A;  3NH5 A;  1Q86 2;  2JUB A;  4HGZ A;  2NAP A;  1K9M 2;  2AYD A;  4NBD A;  2YU9 I;  2E2I I;  1YJW Z;  1VQL Z;  5FLX f;  4NBB A;  1YI2 Z;  3F3F C;  3RZD I;  4RVD A;  2QLV B;  3CD6 Z;  1WZN A;  2P28 A;  2NVQ I;  2VPX A;  1I6H I;  4XX2 A;  4MD8 A;  3VB9 A;  2KI7 B;  3QWU A;  1DL6 A;  1LQL A;  2K5R A;  1TFI A;  4DK1 A;  5C4J I;  4NB9 A;  1VQM 1;  1JJ2 Z;  3I55 Z;  3CC4 Z;  3LUS A;  1VQ9 1;  3RZO I;  1Q7Y 2;  4A3L I;  1YIT Z;  3H3V J;  5CM2 M;  1M1K 1;  1RO4 A;  1RLY A;  1QF8 A;  2RHB A;  5T6B A;  1L1O C;  3GTJ I;  1Q82 1;  3FKI I;  1YJ9 1;  3D2L A;  4BXX I;  1ML8 A;  3I56 Z;  3IF8 A;  1RNI A;  3MZK B;  3IFU A;  4A3B I;  2OTL Z;  1KD1 2;  1RO2 A;  2OTJ 1;  3KIF A;  1SFO I;  3G4S Z;  1Z03 A;  5FLX b;  4E31 A;  1Q16 A;  3S2D I;  1K8A 2;  2JA8 I;  4BY7 I;  2GTH A;  3P5J B;  1YHQ Z;  3PO3 I;  3NH4 A;  2R92 I;  1W2B Z;  4BY1 I;  2W04 A;  2J6A A;  3S1M I;  3GTO I;  1VQ8 Z;  2QR1 B;  4NB8 A;  3MON A;  2IZ3 A;  2VUM I;  2O4H A;  1USP B;  3NH8 A;  3CC2 Z;  3GTG I;  1QXF A;  4E2W A;  2Q51 A;  1YUA A;  1VQ4 1;  4DGL A;  3CCU 1;  4NBA A;  1Y1V I;  4EWC A;  5IP7 I;  4QTU A;  5T64 A;  1YJN Z;  1NJI 1;  3M4O I;  5D1P A;  3CPW Y;  1Q86 1;  3HKZ A;  1YIJ Z;  2JS4 A;  2I3C A;  3CCM Z;  1ZH1 A;  2RT9 A;  3S14 I;  1K9M 1;  3FQM A;  4E2X A;  5A2Q b;  4Y52 I;  1I3Q I;  2JIM A;  3D6W A;  1VQ5 Z;  2IZ4 A;  3G71 Z;  2M6N A;  2QA4 Z;  2QEX Z;  1TWH I;  3CCE Z;  1VQ7 Z;  3S2H I;  2JA6 I;  3J80 b;  1VQ6 Z;  2JIO A;  1VQN Z;  2LFU A;  2DE6 A;  2RIQ A;  3EED A;  3VMH A;  1N2F A;  1VQK Z;  4E2Z A;  1RO0 A;  4A3J I;  3S17 I;  3S16 I;  1WJ2 A;  4RV9 A;  2OOY B;  3CCV Z;  4HH4 A;  5FLM I;  1JWH C;  4X6A I;  2P3Y A;  3GCF A;  1Q81 2;  3CMA Z;  4A3C I;  1NUI A;  2RPR A;  3CCS Z;  2E2H I;  5AN9 F;  1K73 2;  1WW9 A;  2NVY I;  2ZAE B;  3CQZ I;  3Q87 A;  3PO3 S;  1SIW A;  4TNU A;  1VQO 1;  3I4M I;  3G6E Z;  1QVF Y;  3CME Z;  3GTM I;  2HF1 A;  2M48 A;  2IV2 X;  3GTL I;  4QTT A;  4A3E I;  1VQP 1;  3CC7 1;  1KC8 2;  1KD1 1;  2R93 I;  1K8A 1;  4RVF A;  2QRD B;  3CCJ Z;  2W03 A;  3CCR Z;  3T4N B;  2LIY A;  1Y1V S;  3OW2 Y;  3CCL Z;  4A3I I;  5T67 A;  2YAD A;  3HOX I;  1NP6 A;  1TWC I;  3CCQ Z;  3CXC Y;  2QKD A;  1M90 1;  3IR7 A;  1WCM I;  5D1O A;  5A2Q f;  3M3Y I;  2VUG A;  4AYB A;  4A3K I;  3NFZ A;  2JR6 A;  3CXC Z;  3KIH A;  1S72 Z;  3MZL B;  2VF1 A;  1Z02 A;  3J80 f;  3JAM b;  1FDO A;  1YJW 1;  1VQL 1;  1YI2 1;  2K3R A;  2VPZ A;  3VTN A;  2WB1 A;  3CD6 1;  3S1N I;  1KQS Y;  1R9T I;  2Y0S A;  1N8R 1;  5IT9 f;  3PO2 I;  1FDI A;  4A3M I;  1ZB9 A;  1USP A;  3BG1 B;  2DE5 A;  3FQQ A;  3H0G I;  3HOZ I; 
#chains in the Genus database with same CATH homology
 3I55 1;  2OOX B;  3HOW I;  3CC4 1;  1VLA A;  3U50 C;  1YIT 1;  3GTP I;  3F3P C;  1P9N A;  3GTM S;  3TE5 B;  4MON A;  1VQM Z;  2E9H A;  4NFR A;  2V8I A;  2QRC B;  3CPW Z;  3BG0 B;  1VQ9 Z;  3ESW A;  3I56 1;  5IP9 I;  2V8K A;  4NBH A;  2JA5 I;  4NBF A;  1K73 1;  4A93 I;  1YJ9 Z;  1I50 I;  2BJO A;  2OTL 1;  2OZK A;  2H85 A;  3G4S 1;  3J7A 4;  4NOZ A;  2JA7 I;  1Y1W I;  2EGT A;  2PM9 A;  2GTI A;  4NBE A;  3HOY I;  1QVG Y;  1YHQ 1;  4BBS I;  4RVG A;  5C3E I;  3S1Q I;  2OTJ Z;  1Q7Y 1;  5IT9 b;  3I07 A;  3NDI A;  1NJI 2;  3GKQ A;  4RS4 A;  1VQ8 1;  1X0T A;  4NH1 C;  1S7M A;  4NBG A;  3TDH B;  4MD9 A;  2E2J I;  5C4X I;  1TWF I;  3CC2 1;  3IX0 A;  3JAM f;  1WII A;  2GU2 A;  1RQF A;  4MD7 A;  3GTQ I;  3HOV I;  1KRL A;  5LL6 f;  1QVF Z;  1YJN 1;  1JJ2 Y;  1VQ4 Z;  3D9X A;  2PK7 A;  3CCU Z;  1YIJ 1;  3CCM 1;  1TWG I;  4A3F I;  4Y7N I;  4E30 A;  3I4N I;  4MH4 A;  1VQ5 1;  2QRE B;  2G2K A;  2JMO A;  3G71 1;  2QA4 1;  1ZB8 A;  3J81 b;  3OW2 Z;  4A3G I;  2QEX 1;  3CCE 1;  1VQ7 1;  2NVT I;  3NDJ A;  4MRI A;  3VMI A;  1VQ6 1;  4E32 A;  1VQN 1;  5D1O B;  1VQK 1;  2JNY A;  1PFT A;  3CCV 1;  5C44 I;  1M1K 2;  1W2B Y;  4E33 A;  3CMA 1;  1YUK A;  4RVH A;  3CCS 1;  2PMZ A;  1TWA I;  1Q82 2;  4BBR I;  4E2Y A;  3G6E 1;  3CME 1;  3S1R I;  4DQY B;  1KQS Z;  4A3D I;  3EER A;  2Q4Z A;  1M90 2;  2F4M A;  4MXU A;  1VQO Z;  4CL1 A;  3CCJ 1;  2DE7 A;  1X3Z A;  3CCR 1;  1VQP Z;  3CC7 Z;  3HOU I;  4S1T A;  2B63 I;  3CCL 1;  2O53 A;  2V8J A;  1Q81 1;  2NVX I;  2RBL A;  2KPI A;  1X3W A;  1Z01 A;  3CCQ 1;  2F4O A;  2R6M A;  2HU9 A;  1K83 I;  3K7A I;  3VMG A;  2R7Z I;  2WAQ A;  4HGY A;  3GTK I;  1N8R 2;  2AKL A;  3S15 I;  3J81 f;  1QYP A;  1S72 1;  1KC8 1;  1QVG Z;  4NBC A;  3NH5 A;  1Q86 2;  2JUB A;  4HGZ A;  1K9M 2;  4NBD A;  2YU9 I;  2E2I I;  1YJW Z;  1VQL Z;  5FLX f;  4NBB A;  1YI2 Z;  3F3F C;  3RZD I;  4RVD A;  2QLV B;  3CD6 Z;  2P28 A;  2NVQ I;  1I6H I;  4XX2 A;  4MD8 A;  3VB9 A;  2KI7 B;  3QWU A;  1DL6 A;  1LQL A;  2K5R A;  1TFI A;  4DK1 A;  5C4J I;  4NB9 A;  1VQM 1;  1JJ2 Z;  3I55 Z;  3CC4 Z;  3LUS A;  1VQ9 1;  3RZO I;  1Q7Y 2;  4A3L I;  1YIT Z;  3H3V J;  5CM2 M;  1M1K 1;  1RO4 A;  1RLY A;  1QF8 A;  2RHB A;  5T6B A;  1L1O C;  3GTJ I;  1Q82 1;  3FKI I;  1YJ9 1;  4BXX I;  1ML8 A;  3I56 Z;  3IF8 A;  1RNI A;  3MZK B;  3IFU A;  4A3B I;  2OTL Z;  1KD1 2;  1RO2 A;  2OTJ 1;  3KIF A;  1SFO I;  3G4S Z;  1Z03 A;  5FLX b;  4E31 A;  3S2D I;  1K8A 2;  2JA8 I;  4BY7 I;  2GTH A;  3P5J B;  1YHQ Z;  3PO3 I;  3NH4 A;  2R92 I;  1W2B Z;  4BY1 I;  2W04 A;  2J6A A;  3S1M I;  3GTO I;  1VQ8 Z;  2QR1 B;  4NB8 A;  3MON A;  2IZ3 A;  2VUM I;  2O4H A;  1USP B;  3NH8 A;  3CC2 Z;  3GTG I;  4E2W A;  2Q51 A;  1YUA A;  1VQ4 1;  4DGL A;  3CCU 1;  4NBA A;  1Y1V I;  4EWC A;  5IP7 I;  4QTU A;  5T64 A;  1YJN Z;  1NJI 1;  3M4O I;  5D1P A;  3CPW Y;  1Q86 1;  3HKZ A;  1YIJ Z;  2JS4 A;  2I3C A;  3CCM Z;  1ZH1 A;  2RT9 A;  3S14 I;  1K9M 1;  3FQM A;  4E2X A;  5A2Q b;  4Y52 I;  1I3Q I;  3D6W A;  1VQ5 Z;  2IZ4 A;  3G71 Z;  2M6N A;  2QA4 Z;  2QEX Z;  1TWH I;  3CCE Z;  1VQ7 Z;  3S2H I;  2JA6 I;  3J80 b;  1VQ6 Z;  1VQN Z;  2LFU A;  2DE6 A;  2RIQ A;  3EED A;  3VMH A;  1N2F A;  1VQK Z;  4E2Z A;  1RO0 A;  4A3J I;  3S17 I;  3S16 I;  4RV9 A;  2OOY B;  3CCV Z;  4HH4 A;  5FLM I;  1JWH C;  4X6A I;  2P3Y A;  3GCF A;  1Q81 2;  3CMA Z;  4A3C I;  1NUI A;  2RPR A;  3CCS Z;  2E2H I;  5AN9 F;  1K73 2;  1WW9 A;  2NVY I;  2ZAE B;  3CQZ I;  3Q87 A;  3PO3 S;  4TNU A;  1VQO 1;  3I4M I;  3G6E Z;  1QVF Y;  3CME Z;  3GTM I;  2HF1 A;  2M48 A;  3GTL I;  4QTT A;  4A3E I;  1VQP 1;  3CC7 1;  1KC8 2;  1KD1 1;  2R93 I;  1K8A 1;  4RVF A;  2QRD B;  3CCJ Z;  2W03 A;  3CCR Z;  3T4N B;  2LIY A;  1Y1V S;  3OW2 Y;  3CCL Z;  4A3I I;  5T67 A;  2YAD A;  3HOX I;  1NP6 A;  1TWC I;  3CCQ Z;  3CXC Y;  2QKD A;  1M90 1;  1WCM I;  5D1O A;  5A2Q f;  3M3Y I;  2VUG A;  4AYB A;  4A3K I;  3NFZ A;  2JR6 A;  3CXC Z;  3KIH A;  1S72 Z;  3MZL B;  2VF1 A;  1Z02 A;  3J80 f;  3JAM b;  1YJW 1;  1VQL 1;  1YI2 1;  2K3R A;  3VTN A;  2WB1 A;  3CD6 1;  3S1N I;  1KQS Y;  1R9T I;  2Y0S A;  1N8R 1;  5IT9 f;  3PO2 I;  4A3M I;  1ZB9 A;  1USP A;  3BG1 B;  2DE5 A;  3FQQ A;  3H0G I;  3HOZ I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...