3GTQI

Backtracked rna polymerase ii complex induced by damage
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
119
structure length
119
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
total genus 9
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtqI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtqI02
4BBSI 3RZOI 4A3BI 4A3II 5CM2M 3S1MI 3GTPI 2NVQI 1ZB9A 2JA7I 3I4MI 1X3WA 3D6WA 4NBBA 3GTKI 3H0GI 3HOXI 4XX2A 1I50I 1TWHI 2F4OA 3S1RI 3I07A 2JA5I 2PK7A 1YUAA 1WW9A 4NBDA 2JA8I 3HOWI 4A3DI 4A3EI 3K7AI 4Y7NI 3RZDI 4BY1I 2DE5A 1K83I 4NB8A 3M3YI 3S14I 3VB9A 1TWGI 1DL6A 1USPB 1I6HI 2NVXI 4QTTA 2HF1A 4BY7I 1LQLA 3GTJI 4A3MI 1ZB8A 3S15I 3GTOI 3GKQA 4QTUA 4NB9A 4NOZA 4BBRI 4NBAA 2F4MA 4A3JI 2E2II 1VLAA 1WCMI 3S1QI 4A3KI 1RO4A 3S16I 1X3ZA 1TFIA 3H3VJ 3M4OI 3VMIA 1PFTA 3HOUI 3VMHA 3GTMI 3GCFA 3I4NI 2JS4A 4A3LI 5C44I 3HOZI 3S1NI 3ESWA 5C4XI 4NBFA 4NBHA 3GTQI 4A3CI 2E2JI 1Y1WI 2NVYI 3U50C 3GTMS 5C4JI 5IP9I 3LUSA 1RLYA 2BJOA 2JR6A 3PO3I 2E2HI 2DE7A 1TWCI 1ML8A 3S2HI 5IP7I 2K5RA 4A93I 2J6AA 2JNYA 4NBEA 3EERA 3GTGI 1R9TI 3PO3S 4NBCA 1TWAI 4NBGA 4Y52I 3Q87A 4MH4A 2B63I 1Y1VI 2AKLA 3HOYI 2RBLA 2NVTI 1NUIA 1TWFI 1USPA 1QYPA 2R93I 3HOVI 1SFOI 2DE6A 3S2DI 1L1OC 3CQZI 4A3GI 2JA6I 2R92I 1Y1VS 4A3FI 3FKII 2VUMI 2KPIA 2YU9I 2P3YA 3PO2I 3GTLI 1I3QI 2R7ZI 4X6AI 4BXXI 3VMGA 3S17I 1N2FA 5FLMI 5C3EI
chains in the Genus database with same CATH superfamily
4MD9A 3CC21 2NVQI 2JA7I 3CD61 4RS4A 2VPZA 2RPRA 2VPXA 1YUAA 1VQ51 2RHBA 3HOWI 3K7AI 4BY1I 1Q862 2DE5A 1Q861 4RVHA 3S14I 2G2KA 2IV2X 3CCMZ 1YIJ1 5IT9f 4BY7I 3MZKB 1VQ61 3GTOI 2JIMA 4NBAA 2F4MA 1YUKA 1YJ91 1X0TA 1WCMI 4MRIA 2IZ3A 2QA4Z 1X3ZA 1TFIA 2QRCB 3H3VJ 3FQQA 1YJNZ 4E2ZA 3VMHA 2O4HA 3J81f 3GCFA 3I4NI 4CL1A 3HOZI 3S1NI 3ESWA 1S7MA 3CMEZ 1K8A1 3NDJA 5T67A 5A2Qf 2QLVB 2OOXB 3MONA 1RLYA 2BJOA 2JR6A 1QVGZ 4DGLA 4E31A 4MXUA 3CCLZ 4RVDA 4E2YA 2VF1A 2RIQA 5IP7I 2PMZA 4A93I 1VQLZ 1WIIA 2P28A 1R9TI 4NBCA 1QF8A 1TWAI 4NBGA 3JAMb 2ZAEB 5T64A 3CC2Z 3TE5B 1USPA 3NFZA 2R93I 4AYBA 4A3GI 2JUBA 1VQPZ 1YJWZ 4A3FI 5AN9F 1VQ5Z 2QA41 2P3YA 3PO2I 2I3CA 2R6MA 3KIFA 1I3QI 1YJN1 3J80b 4BXXI 5FLMI 4A3II 3BG0B 3CME1 5FLXb 3G711 1X3WA 3D6WA 4NBBA 3GTKI 3H0GI 3HOXI 1ZH1A 2V3VA 1Q822 4DK1A 4MD8A 2V8IA 2PK7A 3CCL1 3RZDI 3M3YI 1QVFZ 1VQL1 1USPB 3CCQ1 1VQ7Z 1LQLA 2JMOA 3GKQA 1K732 1K731 2E2II 1VQMZ 3S1QI 4A3KI 5LL6f 4E30A 5D1OA 2V8JA 1VQP1 1QVGY 3M4OI 1YJW1 3JAMf 3CCV1 1N8R1 5T6BA 3FQMA 1K9M1 3NH5A 5C4XI 3GTQI 3CCJZ 1KC81 3U50C 2JIQA 4MD7A 1FDOA 3LUSA 3J80f 1Z03A 3J7A4 3G4SZ 3HKZA 2PM9A 2GTHA 5FLXf 4NBEA 3EERA 3GTGI 2V8KA 4HH4A 3Q87A 4MH4A 2AKLA 2RBLA 2RT9A 3G71Z 1K8A2 1VQ9Z 3CCUZ 1Q7Y1 3NDIA 3QWUA 1VQ71 1QYPA 1S72Z 4RV9A 5D1OB 2Q4ZA 2DE6A 2VPWA 3CQZI 5D1PA 2R92I 3CXCZ 1VQM1 2KPIA 2IZ4A 1JJ2Z 2R7ZI 1NP6A 4X6AI 3S17I 3RZOI 1VQKZ 3CCQZ 1Z01A 1QVFY 3S1MI 4NH1C 2QREB 2LEXA 4EWCA 3CCJ1 3CCE1 2OOYB 3G6EZ 4XX2A 1I50I 1TWHI 1Y8CA 2GU2A 3CCVZ 3G4S1 2JA8I 3P5JB 4A3DI 3IF8A 4A3EI 1K83I 2HU9A 3VB9A 2W03A 1TWGI 3I561 1DL6A 3OW2Z 1I6HI 4QTTA 4A3MI 1ZB8A 3S15I 1RO0A 1YI2Z 1VQ91 3CCU1 3CC7Z 2KI7B 1VQ8Z 1S721 5IT9b 3D9XA 2VUGA 3S16I 3VMIA 2E7ZA 4TNUA 2QR1B 4A3LI 2M48A 1KD12 2M6NA 3CCRZ 1KD11 1VQK1 2QEXZ 1M902 1M901 4A3CI 3T4NB 2QKDA 2NVYI 2Q51A 5C4JI 3CCSZ 3I55Z 2Y0SA 1W2BY 2JIPA 3G6E1 3CC41 5A2Qb 3CPWZ 3CXCY 1NJI2 1NJI1 1TWCI 1VQN1 1FDIA 1ML8A 1RO2A 1N8R2 1JJ2Y 2K5RA 2NAPA 2JNYA 1K9M2 4HGZA 1Y1VI 3HOYI 4E33A 3CMA1 3EEDA 2O53A 1KC82 1KQSZ 4DQYB 1KRLA 3CCEZ 1SFOI 1YI21 3CC71 3BG1B 3S2DI 2LIYA 1VQ81 1Y1VS 4RVGA 1YHQZ 2AYDA 3GTLI 1RQFA 3F3PC 3VMGA 2K3RA 3I56Z 1WZNA 2WB1A 5C3EI 2V45A 4BBSI 4A3BI 3NH8A 1WJ2A 3OW2Y 3CCR1 4MONA 5CM2M 3GTPI 1AA6A 4HGYA 2QEX1 1Q7Y2 1ZB9A 3I4MI 2JIRA 4E2WA 2OTJZ 1W2BZ 3CCS1 3I551 1Q812 2F4OA 3S1RI 1Q811 2E9HA 4S1TA 3I07A 1VQ4Z 2JA5I 2OTL1 1WW9A 3KIHA 4NBDA 4Y7NI 3D2LA 2EGTA 4NB8A 2W04A 3MZLB 2NVXI 2HF1A 2YADA 3GTJI 4QTUA 1Q16A 4NB9A 4NOZA 2WAQA 3VTNA 4BBRI 4A3JI 1VLAA 2VPYA 1RO4A 3TDHB 3CC4Z 1YITZ 1PFTA 1VQNZ 3CPWY 3HOUI 1YHQ1 3GTMI 1VQOZ 3IX0A 2JS4A 4RVFA 2JIOA 5C44I 4NBFA 3F3FC 4NBHA 1P9NA 3CCM1 4NFRA 3CMAZ 3CD6Z 2E2JI 1Y1WI 3GTMS 2QRDB 1M1K2 1KQSY 1M1K1 1RNIA 3IFUA 5IP9I 3PO3I 1JWHC 2OTJ1 2E2HI 1Z02A 2DE7A 1VQ41 3S2HI 2LFUA 2J6AA 2H85A 1YIJZ 3PO3S 4Y52I 2OZKA 2B63I 3J81b 1VQ6Z 2GTIA 2NVTI 1NUIA 1TWFI 1YJ9Z 3IR7A 4E2XA 3HOVI 1L1OC 1Q821 2JA6I 3FKII 2VUMI 2OTLZ 2YU9I 1YIT1 4E32A 1SIWA 1VQO1 1N2FA 3NH4A 1QXFA
chains in the Genus database with same CATH topology
4MD9A 3CC21 2NVQI 2JA7I 3CD61 4RS4A 2RPRA 1YUAA 1VQ51 2RHBA 3HOWI 3K7AI 4BY1I 1Q862 2DE5A 1Q861 4RVHA 3S14I 2G2KA 3CCMZ 1YIJ1 5IT9f 4BY7I 3MZKB 1VQ61 3GTOI 4NBAA 2F4MA 1YUKA 1YJ91 1X0TA 1WCMI 4MRIA 2IZ3A 2QA4Z 1X3ZA 1TFIA 2QRCB 3H3VJ 3FQQA 1YJNZ 4E2ZA 3VMHA 2O4HA 3J81f 3GCFA 3I4NI 4CL1A 3HOZI 3S1NI 3ESWA 1S7MA 3CMEZ 1K8A1 3NDJA 5T67A 5A2Qf 2QLVB 2OOXB 3MONA 1RLYA 2BJOA 2JR6A 1QVGZ 4DGLA 4E31A 4MXUA 3CCLZ 4RVDA 4E2YA 2VF1A 2RIQA 5IP7I 2PMZA 4A93I 1VQLZ 1WIIA 2P28A 1R9TI 4NBCA 1QF8A 1TWAI 4NBGA 3JAMb 2ZAEB 5T64A 3CC2Z 3TE5B 1USPA 3NFZA 2R93I 4AYBA 4A3GI 2JUBA 1VQPZ 1YJWZ 4A3FI 5AN9F 1VQ5Z 2QA41 2P3YA 3PO2I 2I3CA 2R6MA 3KIFA 1I3QI 1YJN1 3J80b 4BXXI 5FLMI 4A3II 3BG0B 3CME1 5FLXb 3G711 1X3WA 3D6WA 4NBBA 3GTKI 3H0GI 3HOXI 1ZH1A 1Q822 4DK1A 4MD8A 2V8IA 2PK7A 3CCL1 3RZDI 3M3YI 1QVFZ 1VQL1 1USPB 3CCQ1 1VQ7Z 1LQLA 2JMOA 3GKQA 1K732 1K731 2E2II 1VQMZ 3S1QI 4A3KI 5LL6f 4E30A 5D1OA 2V8JA 1VQP1 1QVGY 3M4OI 1YJW1 3JAMf 3CCV1 1N8R1 5T6BA 3FQMA 1K9M1 3NH5A 5C4XI 3GTQI 3CCJZ 1KC81 3U50C 4MD7A 3LUSA 3J80f 1Z03A 3J7A4 3G4SZ 3HKZA 2PM9A 2GTHA 5FLXf 4NBEA 3EERA 3GTGI 2V8KA 4HH4A 3Q87A 4MH4A 2AKLA 2RBLA 2RT9A 3G71Z 1K8A2 1VQ9Z 3CCUZ 1Q7Y1 3NDIA 3QWUA 1VQ71 1QYPA 1S72Z 4RV9A 5D1OB 2Q4ZA 2DE6A 3CQZI 5D1PA 2R92I 3CXCZ 1VQM1 2KPIA 2IZ4A 1JJ2Z 2R7ZI 1NP6A 4X6AI 3S17I 3RZOI 1VQKZ 3CCQZ 1Z01A 1QVFY 3S1MI 4NH1C 2QREB 4EWCA 3CCJ1 3CCE1 2OOYB 3G6EZ 4XX2A 1I50I 1TWHI 2GU2A 3CCVZ 3G4S1 2JA8I 3P5JB 4A3DI 3IF8A 4A3EI 1K83I 2HU9A 3VB9A 2W03A 1TWGI 3I561 1DL6A 3OW2Z 1I6HI 4QTTA 4A3MI 1ZB8A 3S15I 1RO0A 1YI2Z 1VQ91 3CCU1 3CC7Z 2KI7B 1VQ8Z 1S721 5IT9b 3D9XA 2VUGA 3S16I 3VMIA 4TNUA 2QR1B 4A3LI 2M48A 1KD12 2M6NA 3CCRZ 1KD11 1VQK1 2QEXZ 1M902 1M901 4A3CI 3T4NB 2QKDA 2NVYI 2Q51A 5C4JI 3CCSZ 3I55Z 2Y0SA 1W2BY 3G6E1 3CC41 5A2Qb 3CPWZ 3CXCY 1NJI2 1NJI1 1TWCI 1VQN1 1ML8A 1RO2A 1N8R2 1JJ2Y 2K5RA 2JNYA 1K9M2 4HGZA 1Y1VI 3HOYI 4E33A 3CMA1 3EEDA 2O53A 1KC82 1KQSZ 4DQYB 1KRLA 3CCEZ 1SFOI 1YI21 3CC71 3BG1B 3S2DI 2LIYA 1VQ81 1Y1VS 4RVGA 1YHQZ 3GTLI 1RQFA 3F3PC 3VMGA 2K3RA 3I56Z 2WB1A 5C3EI 4BBSI 4A3BI 3NH8A 3OW2Y 3CCR1 4MONA 5CM2M 3GTPI 4HGYA 2QEX1 1Q7Y2 1ZB9A 3I4MI 4E2WA 2OTJZ 1W2BZ 3CCS1 3I551 1Q812 2F4OA 3S1RI 1Q811 2E9HA 4S1TA 3I07A 1VQ4Z 2JA5I 2OTL1 1WW9A 3KIHA 4NBDA 4Y7NI 2EGTA 4NB8A 2W04A 3MZLB 2NVXI 2HF1A 2YADA 3GTJI 4QTUA 4NB9A 4NOZA 2WAQA 3VTNA 4BBRI 4A3JI 1VLAA 1RO4A 3TDHB 3CC4Z 1YITZ 1PFTA 1VQNZ 3CPWY 3HOUI 1YHQ1 3GTMI 1VQOZ 3IX0A 2JS4A 4RVFA 5C44I 4NBFA 3F3FC 4NBHA 1P9NA 3CCM1 4NFRA 3CMAZ 3CD6Z 2E2JI 1Y1WI 3GTMS 2QRDB 1M1K2 1KQSY 1M1K1 1RNIA 3IFUA 5IP9I 3PO3I 1JWHC 2OTJ1 2E2HI 1Z02A 2DE7A 1VQ41 3S2HI 2LFUA 2J6AA 2H85A 1YIJZ 3PO3S 4Y52I 2OZKA 2B63I 3J81b 1VQ6Z 2GTIA 2NVTI 1NUIA 1TWFI 1YJ9Z 4E2XA 3HOVI 1L1OC 1Q821 2JA6I 3FKII 2VUMI 2OTLZ 2YU9I 1YIT1 4E32A 1VQO1 1N2FA 3NH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BBS I;  3RZO I;  4A3B I;  4A3I I;  5CM2 M;  3S1M I;  3GTP I;  2NVQ I;  1ZB9 A;  2JA7 I;  3I4M I;  1X3W A;  3D6W A;  4NBB A;  3GTK I;  3H0G I;  3HOX I;  4XX2 A;  1I50 I;  1TWH I;  2F4O A;  3S1R I;  3I07 A;  2JA5 I;  2PK7 A;  1YUA A;  1WW9 A;  4NBD A;  2JA8 I;  3HOW I;  4A3D I;  4A3E I;  3K7A I;  4Y7N I;  3RZD I;  4BY1 I;  2DE5 A;  1K83 I;  4NB8 A;  3M3Y I;  3S14 I;  3VB9 A;  1TWG I;  1DL6 A;  1USP B;  1I6H I;  2NVX I;  4QTT A;  2HF1 A;  4BY7 I;  1LQL A;  3GTJ I;  4A3M I;  1ZB8 A;  3S15 I;  3GTO I;  3GKQ A;  4QTU A;  4NB9 A;  4NOZ A;  4BBR I;  4NBA A;  2F4M A;  4A3J I;  2E2I I;  1VLA A;  1WCM I;  3S1Q I;  4A3K I;  1RO4 A;  3S16 I;  1X3Z A;  1TFI A;  3H3V J;  3M4O I;  3VMI A;  1PFT A;  3HOU I;  3VMH A;  3GTM I;  3GCF A;  3I4N I;  2JS4 A;  4A3L I;  5C44 I;  3HOZ I;  3S1N I;  3ESW A;  5C4X I;  4NBF A;  4NBH A;  3GTQ I;  4A3C I;  2E2J I;  1Y1W I;  2NVY I;  3U50 C;  3GTM S;  5C4J I;  5IP9 I;  3LUS A;  1RLY A;  2BJO A;  2JR6 A;  3PO3 I;  2E2H I;  2DE7 A;  1TWC I;  1ML8 A;  3S2H I;  5IP7 I;  2K5R A;  4A93 I;  2J6A A;  2JNY A;  4NBE A;  3EER A;  3GTG I;  1R9T I;  3PO3 S;  4NBC A;  1TWA I;  4NBG A;  4Y52 I;  3Q87 A;  4MH4 A;  2B63 I;  1Y1V I;  2AKL A;  3HOY I;  2RBL A;  2NVT I;  1NUI A;  1TWF I;  1USP A;  1QYP A;  2R93 I;  3HOV I;  1SFO I;  2DE6 A;  3S2D I;  1L1O C;  3CQZ I;  4A3G I;  2JA6 I;  2R92 I;  1Y1V S;  4A3F I;  3FKI I;  2VUM I;  2KPI A;  2YU9 I;  2P3Y A;  3PO2 I;  3GTL I;  1I3Q I;  2R7Z I;  4X6A I;  4BXX I;  3VMG A;  3S17 I;  1N2F A;  5FLM I;  5C3E I; 
#chains in the Genus database with same CATH topology
 4MD9 A;  3CC2 1;  2NVQ I;  2JA7 I;  3CD6 1;  4RS4 A;  2VPZ A;  2RPR A;  2VPX A;  1YUA A;  1VQ5 1;  2RHB A;  3HOW I;  3K7A I;  4BY1 I;  1Q86 2;  2DE5 A;  1Q86 1;  4RVH A;  3S14 I;  2G2K A;  2IV2 X;  3CCM Z;  1YIJ 1;  5IT9 f;  4BY7 I;  3MZK B;  1VQ6 1;  3GTO I;  2JIM A;  4NBA A;  2F4M A;  1YUK A;  1YJ9 1;  1X0T A;  1WCM I;  4MRI A;  2IZ3 A;  2QA4 Z;  1X3Z A;  1TFI A;  2QRC B;  3H3V J;  3FQQ A;  1YJN Z;  4E2Z A;  3VMH A;  2O4H A;  3J81 f;  3GCF A;  3I4N I;  4CL1 A;  3HOZ I;  3S1N I;  3ESW A;  1S7M A;  3CME Z;  1K8A 1;  3NDJ A;  5T67 A;  5A2Q f;  2QLV B;  2OOX B;  3MON A;  1RLY A;  2BJO A;  2JR6 A;  1QVG Z;  4DGL A;  4E31 A;  4MXU A;  3CCL Z;  4RVD A;  4E2Y A;  2VF1 A;  2RIQ A;  5IP7 I;  2PMZ A;  4A93 I;  1VQL Z;  1WII A;  2P28 A;  1R9T I;  4NBC A;  1QF8 A;  1TWA I;  4NBG A;  3JAM b;  2ZAE B;  5T64 A;  3CC2 Z;  3TE5 B;  1USP A;  3NFZ A;  2R93 I;  4AYB A;  4A3G I;  2JUB A;  1VQP Z;  1YJW Z;  4A3F I;  5AN9 F;  1VQ5 Z;  2QA4 1;  2P3Y A;  3PO2 I;  2I3C A;  2R6M A;  3KIF A;  1I3Q I;  1YJN 1;  3J80 b;  4BXX I;  5FLM I;  4A3I I;  3BG0 B;  3CME 1;  5FLX b;  3G71 1;  1X3W A;  3D6W A;  4NBB A;  3GTK I;  3H0G I;  3HOX I;  1ZH1 A;  2V3V A;  1Q82 2;  4DK1 A;  4MD8 A;  2V8I A;  2PK7 A;  3CCL 1;  3RZD I;  3M3Y I;  1QVF Z;  1VQL 1;  1USP B;  3CCQ 1;  1VQ7 Z;  1LQL A;  2JMO A;  3GKQ A;  1K73 2;  1K73 1;  2E2I I;  1VQM Z;  3S1Q I;  4A3K I;  5LL6 f;  4E30 A;  5D1O A;  2V8J A;  1VQP 1;  1QVG Y;  3M4O I;  1YJW 1;  3JAM f;  3CCV 1;  1N8R 1;  5T6B A;  3FQM A;  1K9M 1;  3NH5 A;  5C4X I;  3GTQ I;  3CCJ Z;  1KC8 1;  3U50 C;  2JIQ A;  4MD7 A;  1FDO A;  3LUS A;  3J80 f;  1Z03 A;  3J7A 4;  3G4S Z;  3HKZ A;  2PM9 A;  2GTH A;  5FLX f;  4NBE A;  3EER A;  3GTG I;  2V8K A;  4HH4 A;  3Q87 A;  4MH4 A;  2AKL A;  2RBL A;  2RT9 A;  3G71 Z;  1K8A 2;  1VQ9 Z;  3CCU Z;  1Q7Y 1;  3NDI A;  3QWU A;  1VQ7 1;  1QYP A;  1S72 Z;  4RV9 A;  5D1O B;  2Q4Z A;  2DE6 A;  2VPW A;  3CQZ I;  5D1P A;  2R92 I;  3CXC Z;  1VQM 1;  2KPI A;  2IZ4 A;  1JJ2 Z;  2R7Z I;  1NP6 A;  4X6A I;  3S17 I;  3RZO I;  1VQK Z;  3CCQ Z;  1Z01 A;  1QVF Y;  3S1M I;  4NH1 C;  2QRE B;  2LEX A;  4EWC A;  3CCJ 1;  3CCE 1;  2OOY B;  3G6E Z;  4XX2 A;  1I50 I;  1TWH I;  1Y8C A;  2GU2 A;  3CCV Z;  3G4S 1;  2JA8 I;  3P5J B;  4A3D I;  3IF8 A;  4A3E I;  1K83 I;  2HU9 A;  3VB9 A;  2W03 A;  1TWG I;  3I56 1;  1DL6 A;  3OW2 Z;  1I6H I;  4QTT A;  4A3M I;  1ZB8 A;  3S15 I;  1RO0 A;  1YI2 Z;  1VQ9 1;  3CCU 1;  3CC7 Z;  2KI7 B;  1VQ8 Z;  1S72 1;  5IT9 b;  3D9X A;  2VUG A;  3S16 I;  3VMI A;  2E7Z A;  4TNU A;  2QR1 B;  4A3L I;  2M48 A;  1KD1 2;  2M6N A;  3CCR Z;  1KD1 1;  1VQK 1;  2QEX Z;  1M90 2;  1M90 1;  4A3C I;  3T4N B;  2QKD A;  2NVY I;  2Q51 A;  5C4J I;  3CCS Z;  3I55 Z;  2Y0S A;  1W2B Y;  2JIP A;  3G6E 1;  3CC4 1;  5A2Q b;  3CPW Z;  3CXC Y;  1NJI 2;  1NJI 1;  1TWC I;  1VQN 1;  1FDI A;  1ML8 A;  1RO2 A;  1N8R 2;  1JJ2 Y;  2K5R A;  2NAP A;  2JNY A;  1K9M 2;  4HGZ A;  1Y1V I;  3HOY I;  4E33 A;  3CMA 1;  3EED A;  2O53 A;  1KC8 2;  1KQS Z;  4DQY B;  1KRL A;  3CCE Z;  1SFO I;  1YI2 1;  3CC7 1;  3BG1 B;  3S2D I;  2LIY A;  1VQ8 1;  1Y1V S;  4RVG A;  1YHQ Z;  2AYD A;  3GTL I;  1RQF A;  3F3P C;  3VMG A;  2K3R A;  3I56 Z;  1WZN A;  2WB1 A;  5C3E I;  2V45 A;  4BBS I;  4A3B I;  3NH8 A;  1WJ2 A;  3OW2 Y;  3CCR 1;  4MON A;  5CM2 M;  3GTP I;  1AA6 A;  4HGY A;  2QEX 1;  1Q7Y 2;  1ZB9 A;  3I4M I;  2JIR A;  4E2W A;  2OTJ Z;  1W2B Z;  3CCS 1;  3I55 1;  1Q81 2;  2F4O A;  3S1R I;  1Q81 1;  2E9H A;  4S1T A;  3I07 A;  1VQ4 Z;  2JA5 I;  2OTL 1;  1WW9 A;  3KIH A;  4NBD A;  4Y7N I;  3D2L A;  2EGT A;  4NB8 A;  2W04 A;  3MZL B;  2NVX I;  2HF1 A;  2YAD A;  3GTJ I;  4QTU A;  1Q16 A;  4NB9 A;  4NOZ A;  2WAQ A;  3VTN A;  4BBR I;  4A3J I;  1VLA A;  2VPY A;  1RO4 A;  3TDH B;  3CC4 Z;  1YIT Z;  1PFT A;  1VQN Z;  3CPW Y;  3HOU I;  1YHQ 1;  3GTM I;  1VQO Z;  3IX0 A;  2JS4 A;  4RVF A;  2JIO A;  5C44 I;  4NBF A;  3F3F C;  4NBH A;  1P9N A;  3CCM 1;  4NFR A;  3CMA Z;  3CD6 Z;  2E2J I;  1Y1W I;  3GTM S;  2QRD B;  1M1K 2;  1KQS Y;  1M1K 1;  1RNI A;  3IFU A;  5IP9 I;  3PO3 I;  1JWH C;  2OTJ 1;  2E2H I;  1Z02 A;  2DE7 A;  1VQ4 1;  3S2H I;  2LFU A;  2J6A A;  2H85 A;  1YIJ Z;  3PO3 S;  4Y52 I;  2OZK A;  2B63 I;  3J81 b;  1VQ6 Z;  2GTI A;  2NVT I;  1NUI A;  1TWF I;  1YJ9 Z;  3IR7 A;  4E2X A;  3HOV I;  1L1O C;  1Q82 1;  2JA6 I;  3FKI I;  2VUM I;  2OTL Z;  2YU9 I;  1YIT 1;  4E32 A;  1SIW A;  1VQO 1;  1N2F A;  3NH4 A;  1QXF A; 
#chains in the Genus database with same CATH homology
 4MD9 A;  3CC2 1;  2NVQ I;  2JA7 I;  3CD6 1;  4RS4 A;  2RPR A;  1YUA A;  1VQ5 1;  2RHB A;  3HOW I;  3K7A I;  4BY1 I;  1Q86 2;  2DE5 A;  1Q86 1;  4RVH A;  3S14 I;  2G2K A;  3CCM Z;  1YIJ 1;  5IT9 f;  4BY7 I;  3MZK B;  1VQ6 1;  3GTO I;  4NBA A;  2F4M A;  1YUK A;  1YJ9 1;  1X0T A;  1WCM I;  4MRI A;  2IZ3 A;  2QA4 Z;  1X3Z A;  1TFI A;  2QRC B;  3H3V J;  3FQQ A;  1YJN Z;  4E2Z A;  3VMH A;  2O4H A;  3J81 f;  3GCF A;  3I4N I;  4CL1 A;  3HOZ I;  3S1N I;  3ESW A;  1S7M A;  3CME Z;  1K8A 1;  3NDJ A;  5T67 A;  5A2Q f;  2QLV B;  2OOX B;  3MON A;  1RLY A;  2BJO A;  2JR6 A;  1QVG Z;  4DGL A;  4E31 A;  4MXU A;  3CCL Z;  4RVD A;  4E2Y A;  2VF1 A;  2RIQ A;  5IP7 I;  2PMZ A;  4A93 I;  1VQL Z;  1WII A;  2P28 A;  1R9T I;  4NBC A;  1QF8 A;  1TWA I;  4NBG A;  3JAM b;  2ZAE B;  5T64 A;  3CC2 Z;  3TE5 B;  1USP A;  3NFZ A;  2R93 I;  4AYB A;  4A3G I;  2JUB A;  1VQP Z;  1YJW Z;  4A3F I;  5AN9 F;  1VQ5 Z;  2QA4 1;  2P3Y A;  3PO2 I;  2I3C A;  2R6M A;  3KIF A;  1I3Q I;  1YJN 1;  3J80 b;  4BXX I;  5FLM I;  4A3I I;  3BG0 B;  3CME 1;  5FLX b;  3G71 1;  1X3W A;  3D6W A;  4NBB A;  3GTK I;  3H0G I;  3HOX I;  1ZH1 A;  1Q82 2;  4DK1 A;  4MD8 A;  2V8I A;  2PK7 A;  3CCL 1;  3RZD I;  3M3Y I;  1QVF Z;  1VQL 1;  1USP B;  3CCQ 1;  1VQ7 Z;  1LQL A;  2JMO A;  3GKQ A;  1K73 2;  1K73 1;  2E2I I;  1VQM Z;  3S1Q I;  4A3K I;  5LL6 f;  4E30 A;  5D1O A;  2V8J A;  1VQP 1;  1QVG Y;  3M4O I;  1YJW 1;  3JAM f;  3CCV 1;  1N8R 1;  5T6B A;  3FQM A;  1K9M 1;  3NH5 A;  5C4X I;  3GTQ I;  3CCJ Z;  1KC8 1;  3U50 C;  4MD7 A;  3LUS A;  3J80 f;  1Z03 A;  3J7A 4;  3G4S Z;  3HKZ A;  2PM9 A;  2GTH A;  5FLX f;  4NBE A;  3EER A;  3GTG I;  2V8K A;  4HH4 A;  3Q87 A;  4MH4 A;  2AKL A;  2RBL A;  2RT9 A;  3G71 Z;  1K8A 2;  1VQ9 Z;  3CCU Z;  1Q7Y 1;  3NDI A;  3QWU A;  1VQ7 1;  1QYP A;  1S72 Z;  4RV9 A;  5D1O B;  2Q4Z A;  2DE6 A;  3CQZ I;  5D1P A;  2R92 I;  3CXC Z;  1VQM 1;  2KPI A;  2IZ4 A;  1JJ2 Z;  2R7Z I;  1NP6 A;  4X6A I;  3S17 I;  3RZO I;  1VQK Z;  3CCQ Z;  1Z01 A;  1QVF Y;  3S1M I;  4NH1 C;  2QRE B;  4EWC A;  3CCJ 1;  3CCE 1;  2OOY B;  3G6E Z;  4XX2 A;  1I50 I;  1TWH I;  2GU2 A;  3CCV Z;  3G4S 1;  2JA8 I;  3P5J B;  4A3D I;  3IF8 A;  4A3E I;  1K83 I;  2HU9 A;  3VB9 A;  2W03 A;  1TWG I;  3I56 1;  1DL6 A;  3OW2 Z;  1I6H I;  4QTT A;  4A3M I;  1ZB8 A;  3S15 I;  1RO0 A;  1YI2 Z;  1VQ9 1;  3CCU 1;  3CC7 Z;  2KI7 B;  1VQ8 Z;  1S72 1;  5IT9 b;  3D9X A;  2VUG A;  3S16 I;  3VMI A;  4TNU A;  2QR1 B;  4A3L I;  2M48 A;  1KD1 2;  2M6N A;  3CCR Z;  1KD1 1;  1VQK 1;  2QEX Z;  1M90 2;  1M90 1;  4A3C I;  3T4N B;  2QKD A;  2NVY I;  2Q51 A;  5C4J I;  3CCS Z;  3I55 Z;  2Y0S A;  1W2B Y;  3G6E 1;  3CC4 1;  5A2Q b;  3CPW Z;  3CXC Y;  1NJI 2;  1NJI 1;  1TWC I;  1VQN 1;  1ML8 A;  1RO2 A;  1N8R 2;  1JJ2 Y;  2K5R A;  2JNY A;  1K9M 2;  4HGZ A;  1Y1V I;  3HOY I;  4E33 A;  3CMA 1;  3EED A;  2O53 A;  1KC8 2;  1KQS Z;  4DQY B;  1KRL A;  3CCE Z;  1SFO I;  1YI2 1;  3CC7 1;  3BG1 B;  3S2D I;  2LIY A;  1VQ8 1;  1Y1V S;  4RVG A;  1YHQ Z;  3GTL I;  1RQF A;  3F3P C;  3VMG A;  2K3R A;  3I56 Z;  2WB1 A;  5C3E I;  4BBS I;  4A3B I;  3NH8 A;  3OW2 Y;  3CCR 1;  4MON A;  5CM2 M;  3GTP I;  4HGY A;  2QEX 1;  1Q7Y 2;  1ZB9 A;  3I4M I;  4E2W A;  2OTJ Z;  1W2B Z;  3CCS 1;  3I55 1;  1Q81 2;  2F4O A;  3S1R I;  1Q81 1;  2E9H A;  4S1T A;  3I07 A;  1VQ4 Z;  2JA5 I;  2OTL 1;  1WW9 A;  3KIH A;  4NBD A;  4Y7N I;  2EGT A;  4NB8 A;  2W04 A;  3MZL B;  2NVX I;  2HF1 A;  2YAD A;  3GTJ I;  4QTU A;  4NB9 A;  4NOZ A;  2WAQ A;  3VTN A;  4BBR I;  4A3J I;  1VLA A;  1RO4 A;  3TDH B;  3CC4 Z;  1YIT Z;  1PFT A;  1VQN Z;  3CPW Y;  3HOU I;  1YHQ 1;  3GTM I;  1VQO Z;  3IX0 A;  2JS4 A;  4RVF A;  5C44 I;  4NBF A;  3F3F C;  4NBH A;  1P9N A;  3CCM 1;  4NFR A;  3CMA Z;  3CD6 Z;  2E2J I;  1Y1W I;  3GTM S;  2QRD B;  1M1K 2;  1KQS Y;  1M1K 1;  1RNI A;  3IFU A;  5IP9 I;  3PO3 I;  1JWH C;  2OTJ 1;  2E2H I;  1Z02 A;  2DE7 A;  1VQ4 1;  3S2H I;  2LFU A;  2J6A A;  2H85 A;  1YIJ Z;  3PO3 S;  4Y52 I;  2OZK A;  2B63 I;  3J81 b;  1VQ6 Z;  2GTI A;  2NVT I;  1NUI A;  1TWF I;  1YJ9 Z;  4E2X A;  3HOV I;  1L1O C;  1Q82 1;  2JA6 I;  3FKI I;  2VUM I;  2OTL Z;  2YU9 I;  1YIT 1;  4E32 A;  1VQO 1;  1N2F A;  3NH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...