3MONA

Crystal structures of two intensely sweet proteins
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
44
structure length
44
Chain Sequence
REIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONELLIN
publication title Crystal structures of two intensely sweet proteins.
pubmed doi rcsb
source organism Dioscoreophyllum cumminsii
molecule tags Sweet-tasting protein
total genus 6
structure length 44
sequence length 44
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 1992-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09200 Monellin Monellin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.610 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3monA00
4MONA 3MONA 1KRLA
chains in the Genus database with same CATH superfamily
2F4OA 3G4SZ 1VLAA 1KD12 3J80f 3J80b 3CPWZ 2YU9I 4MH4A 4S1TA 3RZDI 2JIOA 3HOYI 3CCR1 2DE5A 3CCRZ 3NDIA 3MONA 4E33A 5IP9I 4A3JI 3CCU1 3CCUZ 2RIQA 1YIJ1 1DL6A 1VQL1 1YIJZ 2NVTI 1VQLZ 1X0TA 1KQSZ 1I6HI 3VMGA 2P28A 2ZAEB 4HH4A 2VF1A 3CC21 2I3CA 3CCS1 1W2BZ 1RNIA 4NFRA 3CCSZ 2OTLZ 2VPZA 2HU9A 2NVYI 2VPYA 1Y1WI 3CPWY 3D6WA 3F3PC 1VQ81 1RQFA 1WJ2A 1VQ8Z 3NH4A 3F3FC 2V8JA 3HOUI 4BXXI 3JAMf 3JAMb 1ZH1A 3CCL1 3CC41 3CCLZ 2VUMI 3CCM1 3CC4Z 1KQSY 4RVGA 5D1PA 3CCMZ 4EWCA 5T6BA 4DGLA 5IT9f 1M901 3G711 1VQN1 3G71Z 2G2KA 1VQNZ 4E2ZA 1Q16A 1W2BY 2KPIA 3S1MI 1X3WA 2JIRA 3LUSA 3S1RI 1K83I 1NP6A 1S7MA 5IP7I 5CM2M 2Q51A 1USPA 1Q811 3VMHA 3MZLB 3S15I 3PO3I 2GTHA 3HOVI 1K9M1 3CMA1 3CMAZ 2M6NA 4NBDA 2GU2A 1VQM1 1Q7Y2 1VQMZ 2AYDA 4DK1A 3S2HI 1KD11 4A93I 2O4HA 3FQMA 2KI7B 4NH1C 4A3CI 4DQYB 4AYBA 1K731 1VQK1 2RHBA 5LL6f 1VQKZ 3CQZI 4NB8A 3GTJI 4A3II 1ML8A 1VQ61 1Q812 5AN9F 1VQ6Z 1QXFA 3D2LA 2IZ4A 1KRLA 2PMZA 5FLMI 3NH8A 1K9M2 2JA8I 3TDHB 2DE6A 3CD61 3GCFA 3CD6Z 2R7ZI 4E30A 4X6AI 4RVDA 3EEDA 3RZOI 4E2WA 2NAPA 4A3GI 2AKLA 1K732 1QF8A 1TFIA 2R93I 2WB1A 2F4MA 1VQ41 3VB9A 1VQ4Z 2RPRA 4NBHA 1TWAI 1YHQ1 1YHQZ 3BG0B 3I4NI 1NUIA 1Z01A 3GTLI 3EERA 4MXUA 1N8R1 2VUGA 2JIMA 1K8A1 3H3VJ 3CC2Z 3K7AI 1VQO1 4MD7A 4CL1A 1VQOZ 1WCMI 2K5RA 4E2XA 1ZB8A 2Y0SA 3HOWI 1TWFI 5A2Qf 2K3RA 5A2Qb 1JJ2Z 2RBLA 3CCQ1 2E2HI 5C4JI 4E31A 3CCQZ 3G6E1 4RS4A 3G6EZ 2VPXA 4NB9A 1QVGZ 2V8KA 2V3VA 1Q7Y1 3M3YI 4QTUA 4TNUA 3GKQA 4HGYA 1N8R2 2JNYA 1K8A2 5IT9b 3CME1 3GTMI 3CMEZ 1YUKA 1Y8CA 3TE5B 1M1K2 2QLVB 3U50C 4BY1I 2JMOA 3S17I 2E2JI 2E9HA 3KIFA 4A3DI 1VQ71 4BBSI 1JJ2Y 1VQ7Z 3T4NB 1Y1VI 2W04A 3IR7A 3D9XA 1S721 1QVGY 1S72Z 3I4MI 5C3EI 3PO3S 3GTQI 1R9TI 1NJI2 1AA6A 1YJN1 3FKII 1YJNZ 3VTNA 2HF1A 1RO2A 3CCE1 2P3YA 3CCEZ 3HOZI 3ESWA 3BG1B 1VQ51 2E7ZA 1VQ5Z 3GTGI 1RLYA 2OOXB 2QREB 2LEXA 3GTKI 3QWUA 5T67A 5C44I 3NH5A 5C4XI 2Q4ZA 5FLXf 5FLXb 1LQLA 2DE7A 2IV2X 4XX2A 2RT9A 2B63I 2QRCB 1P9NA 5D1OB 3MZKB 3CC71 3CC7Z 4NBAA 2JIQA 1TWHI 1WZNA 5T64A 2IZ3A 4NBBA 3S1QI 1Z02A 1QYPA 2NVQI 1FDOA 2H85A 2JR6A 4A3EI 1RO0A 1YJ91 1TWGI 3HOXI 1YJ9Z 3S1NI 2WAQA 2E2II 1SFOI 3Q87A 2JS4A 4NBCA 4RV9A 2OTJ1 2OZKA 2OTJZ 2NVXI 2GTIA 4NOZA 3P5JB 4RVHA 1PFTA 1M1K1 4Y52I 1L1OC 4E32A 3CCV1 1FDIA 4RVFA 2JA6I 4A3LI 3CCVZ 1WIIA 1X3ZA 1Q862 3HKZA 3IFUA 2R92I 3I561 3S14I 3I56Z 3S2DI 3H0GI 4MD9A 3S16I 1Z03A 2OTL1 3PO2I 2W03A 1YIT1 3I551 1YITZ 1NJI1 1WW9A 3I55Z 4MONA 1N2FA 3J7A4 2V8IA 3FQQA 2QKDA 2R6MA 3NDJA 4NBGA 1YI21 2M48A 4A3KI 3GTPI 1YI2Z 4QTTA 1YJW1 3GTMS 2LFUA 1YJWZ 2QR1B 1JWHC 3M4OI 3J81f 3J81b 2JA5I 2YADA 3IF8A 1QVFZ 4A3FI 1I3QI 2PK7A 3IX0A 1YUAA 2PM9A 4NBEA 3GTOI 1Y1VS 2EGTA 3CXCZ 1USPB 2QA41 1RO4A 3VMIA 2QA4Z 2JA7I 3OW2Z 1VQP1 1KC81 3NFZA 1I50I 1VQPZ 2QEX1 2QEXZ 3KIHA 2BJOA 1Q821 4A3MI 2JUBA 3I07A 4Y7NI 2LIYA 4MRIA 2JIPA 1M902 2O53A 2OOYB 1QVFY 5D1OA 2QRDB 4HGZA 1TWCI 1ZB9A 4BY7I 4MD8A 2J6AA 3CCJ1 3CXCY 2V45A 3CCJZ 1KC82 4E2YA 2VPWA 1Q861 4A3BI 3OW2Y 4BBRI 1VQ91 4NBFA 1VQ9Z 1SIWA 1Q822 3G4S1
chains in the Genus database with same CATH topology
2F4OA 3G4SZ 1VLAA 1KD12 3J80f 3J80b 3CPWZ 2YU9I 4MH4A 4S1TA 3RZDI 3HOYI 3CCR1 2DE5A 3CCRZ 3NDIA 3MONA 4E33A 5IP9I 4A3JI 3CCU1 3CCUZ 2RIQA 1YIJ1 1DL6A 1VQL1 1YIJZ 2NVTI 1VQLZ 1X0TA 1KQSZ 1I6HI 3VMGA 2P28A 2ZAEB 4HH4A 2VF1A 3CC21 2I3CA 3CCS1 1W2BZ 1RNIA 4NFRA 3CCSZ 2OTLZ 2HU9A 2NVYI 1Y1WI 3CPWY 3D6WA 3F3PC 1VQ81 1RQFA 1VQ8Z 3NH4A 3F3FC 2V8JA 3HOUI 4BXXI 3JAMf 3JAMb 1ZH1A 3CCL1 3CC41 3CCLZ 2VUMI 3CCM1 3CC4Z 1KQSY 4RVGA 5D1PA 3CCMZ 4EWCA 5T6BA 4DGLA 5IT9f 1M901 3G711 1VQN1 3G71Z 2G2KA 1VQNZ 4E2ZA 1W2BY 2KPIA 3S1MI 1X3WA 3LUSA 3S1RI 1K83I 1NP6A 1S7MA 5IP7I 5CM2M 2Q51A 1USPA 1Q811 3VMHA 3MZLB 3S15I 3PO3I 2GTHA 3HOVI 1K9M1 3CMA1 3CMAZ 2M6NA 4NBDA 2GU2A 1VQM1 1Q7Y2 1VQMZ 4DK1A 3S2HI 1KD11 4A93I 2O4HA 3FQMA 2KI7B 4NH1C 4A3CI 4DQYB 4AYBA 1K731 1VQK1 2RHBA 5LL6f 1VQKZ 3CQZI 4NB8A 3GTJI 4A3II 1ML8A 1VQ61 1Q812 5AN9F 1VQ6Z 2IZ4A 1KRLA 2PMZA 5FLMI 3NH8A 1K9M2 2JA8I 3TDHB 2DE6A 3CD61 3GCFA 3CD6Z 2R7ZI 4E30A 4X6AI 4RVDA 3EEDA 3RZOI 4E2WA 4A3GI 2AKLA 1K732 1QF8A 1TFIA 2R93I 2WB1A 2F4MA 1VQ41 3VB9A 1VQ4Z 2RPRA 4NBHA 1TWAI 1YHQ1 1YHQZ 3BG0B 3I4NI 1NUIA 1Z01A 3GTLI 3EERA 4MXUA 1N8R1 2VUGA 1K8A1 3H3VJ 3CC2Z 3K7AI 1VQO1 4MD7A 4CL1A 1VQOZ 1WCMI 2K5RA 4E2XA 1ZB8A 2Y0SA 3HOWI 1TWFI 5A2Qf 2K3RA 5A2Qb 1JJ2Z 2RBLA 3CCQ1 2E2HI 5C4JI 4E31A 3CCQZ 3G6E1 4RS4A 3G6EZ 4NB9A 1QVGZ 2V8KA 1Q7Y1 3M3YI 4QTUA 4TNUA 3GKQA 4HGYA 1N8R2 2JNYA 1K8A2 5IT9b 3CME1 3GTMI 3CMEZ 1YUKA 3TE5B 1M1K2 2QLVB 3U50C 4BY1I 2JMOA 3S17I 2E2JI 2E9HA 3KIFA 4A3DI 1VQ71 4BBSI 1JJ2Y 1VQ7Z 3T4NB 1Y1VI 2W04A 3D9XA 1S721 1QVGY 1S72Z 3I4MI 5C3EI 3PO3S 3GTQI 1R9TI 1NJI2 1YJN1 3FKII 1YJNZ 3VTNA 2HF1A 1RO2A 3CCE1 2P3YA 3CCEZ 3HOZI 3ESWA 3BG1B 1VQ51 1VQ5Z 3GTGI 1RLYA 2OOXB 2QREB 3GTKI 3QWUA 5T67A 5C44I 3NH5A 5C4XI 2Q4ZA 5FLXf 5FLXb 1LQLA 2DE7A 4XX2A 2RT9A 2B63I 2QRCB 1P9NA 5D1OB 3MZKB 3CC71 3CC7Z 4NBAA 1TWHI 5T64A 2IZ3A 4NBBA 3S1QI 1Z02A 1QYPA 2NVQI 2H85A 2JR6A 4A3EI 1RO0A 1YJ91 1TWGI 3HOXI 1YJ9Z 3S1NI 2WAQA 2E2II 1SFOI 3Q87A 2JS4A 4NBCA 4RV9A 2OTJ1 2OZKA 2OTJZ 2NVXI 2GTIA 4NOZA 3P5JB 4RVHA 1PFTA 1M1K1 4Y52I 1L1OC 4E32A 3CCV1 4RVFA 2JA6I 4A3LI 3CCVZ 1WIIA 1X3ZA 1Q862 3HKZA 3IFUA 2R92I 3I561 3S14I 3I56Z 3S2DI 3H0GI 4MD9A 3S16I 1Z03A 2OTL1 3PO2I 2W03A 1YIT1 3I551 1YITZ 1NJI1 1WW9A 3I55Z 4MONA 1N2FA 3J7A4 2V8IA 3FQQA 2QKDA 2R6MA 3NDJA 4NBGA 1YI21 2M48A 4A3KI 3GTPI 1YI2Z 4QTTA 1YJW1 3GTMS 2LFUA 1YJWZ 2QR1B 1JWHC 3M4OI 3J81f 3J81b 2JA5I 2YADA 3IF8A 1QVFZ 4A3FI 1I3QI 2PK7A 3IX0A 1YUAA 2PM9A 4NBEA 3GTOI 1Y1VS 2EGTA 3CXCZ 1USPB 2QA41 1RO4A 3VMIA 2QA4Z 2JA7I 3OW2Z 1VQP1 1KC81 3NFZA 1I50I 1VQPZ 2QEX1 2QEXZ 3KIHA 2BJOA 1Q821 4A3MI 2JUBA 3I07A 4Y7NI 2LIYA 4MRIA 1M902 2O53A 2OOYB 1QVFY 5D1OA 2QRDB 4HGZA 1TWCI 1ZB9A 4BY7I 4MD8A 2J6AA 3CCJ1 3CXCY 3CCJZ 1KC82 4E2YA 1Q861 4A3BI 3OW2Y 4BBRI 1VQ91 4NBFA 1VQ9Z 1Q822 3G4S1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MON A;  3MON A;  1KRL A; 
#chains in the Genus database with same CATH topology
 2F4O A;  3G4S Z;  1VLA A;  1KD1 2;  3J80 f;  3J80 b;  3CPW Z;  2YU9 I;  4MH4 A;  4S1T A;  3RZD I;  2JIO A;  3HOY I;  3CCR 1;  2DE5 A;  3CCR Z;  3NDI A;  3MON A;  4E33 A;  5IP9 I;  4A3J I;  3CCU 1;  3CCU Z;  2RIQ A;  1YIJ 1;  1DL6 A;  1VQL 1;  1YIJ Z;  2NVT I;  1VQL Z;  1X0T A;  1KQS Z;  1I6H I;  3VMG A;  2P28 A;  2ZAE B;  4HH4 A;  2VF1 A;  3CC2 1;  2I3C A;  3CCS 1;  1W2B Z;  1RNI A;  4NFR A;  3CCS Z;  2OTL Z;  2VPZ A;  2HU9 A;  2NVY I;  2VPY A;  1Y1W I;  3CPW Y;  3D6W A;  3F3P C;  1VQ8 1;  1RQF A;  1WJ2 A;  1VQ8 Z;  3NH4 A;  3F3F C;  2V8J A;  3HOU I;  4BXX I;  3JAM f;  3JAM b;  1ZH1 A;  3CCL 1;  3CC4 1;  3CCL Z;  2VUM I;  3CCM 1;  3CC4 Z;  1KQS Y;  4RVG A;  5D1P A;  3CCM Z;  4EWC A;  5T6B A;  4DGL A;  5IT9 f;  1M90 1;  3G71 1;  1VQN 1;  3G71 Z;  2G2K A;  1VQN Z;  4E2Z A;  1Q16 A;  1W2B Y;  2KPI A;  3S1M I;  1X3W A;  2JIR A;  3LUS A;  3S1R I;  1K83 I;  1NP6 A;  1S7M A;  5IP7 I;  5CM2 M;  2Q51 A;  1USP A;  1Q81 1;  3VMH A;  3MZL B;  3S15 I;  3PO3 I;  2GTH A;  3HOV I;  1K9M 1;  3CMA 1;  3CMA Z;  2M6N A;  4NBD A;  2GU2 A;  1VQM 1;  1Q7Y 2;  1VQM Z;  2AYD A;  4DK1 A;  3S2H I;  1KD1 1;  4A93 I;  2O4H A;  3FQM A;  2KI7 B;  4NH1 C;  4A3C I;  4DQY B;  4AYB A;  1K73 1;  1VQK 1;  2RHB A;  5LL6 f;  1VQK Z;  3CQZ I;  4NB8 A;  3GTJ I;  4A3I I;  1ML8 A;  1VQ6 1;  1Q81 2;  5AN9 F;  1VQ6 Z;  1QXF A;  3D2L A;  2IZ4 A;  1KRL A;  2PMZ A;  5FLM I;  3NH8 A;  1K9M 2;  2JA8 I;  3TDH B;  2DE6 A;  3CD6 1;  3GCF A;  3CD6 Z;  2R7Z I;  4E30 A;  4X6A I;  4RVD A;  3EED A;  3RZO I;  4E2W A;  2NAP A;  4A3G I;  2AKL A;  1K73 2;  1QF8 A;  1TFI A;  2R93 I;  2WB1 A;  2F4M A;  1VQ4 1;  3VB9 A;  1VQ4 Z;  2RPR A;  4NBH A;  1TWA I;  1YHQ 1;  1YHQ Z;  3BG0 B;  3I4N I;  1NUI A;  1Z01 A;  3GTL I;  3EER A;  4MXU A;  1N8R 1;  2VUG A;  2JIM A;  1K8A 1;  3H3V J;  3CC2 Z;  3K7A I;  1VQO 1;  4MD7 A;  4CL1 A;  1VQO Z;  1WCM I;  2K5R A;  4E2X A;  1ZB8 A;  2Y0S A;  3HOW I;  1TWF I;  5A2Q f;  2K3R A;  5A2Q b;  1JJ2 Z;  2RBL A;  3CCQ 1;  2E2H I;  5C4J I;  4E31 A;  3CCQ Z;  3G6E 1;  4RS4 A;  3G6E Z;  2VPX A;  4NB9 A;  1QVG Z;  2V8K A;  2V3V A;  1Q7Y 1;  3M3Y I;  4QTU A;  4TNU A;  3GKQ A;  4HGY A;  1N8R 2;  2JNY A;  1K8A 2;  5IT9 b;  3CME 1;  3GTM I;  3CME Z;  1YUK A;  1Y8C A;  3TE5 B;  1M1K 2;  2QLV B;  3U50 C;  4BY1 I;  2JMO A;  3S17 I;  2E2J I;  2E9H A;  3KIF A;  4A3D I;  1VQ7 1;  4BBS I;  1JJ2 Y;  1VQ7 Z;  3T4N B;  1Y1V I;  2W04 A;  3IR7 A;  3D9X A;  1S72 1;  1QVG Y;  1S72 Z;  3I4M I;  5C3E I;  3PO3 S;  3GTQ I;  1R9T I;  1NJI 2;  1AA6 A;  1YJN 1;  3FKI I;  1YJN Z;  3VTN A;  2HF1 A;  1RO2 A;  3CCE 1;  2P3Y A;  3CCE Z;  3HOZ I;  3ESW A;  3BG1 B;  1VQ5 1;  2E7Z A;  1VQ5 Z;  3GTG I;  1RLY A;  2OOX B;  2QRE B;  2LEX A;  3GTK I;  3QWU A;  5T67 A;  5C44 I;  3NH5 A;  5C4X I;  2Q4Z A;  5FLX f;  5FLX b;  1LQL A;  2DE7 A;  2IV2 X;  4XX2 A;  2RT9 A;  2B63 I;  2QRC B;  1P9N A;  5D1O B;  3MZK B;  3CC7 1;  3CC7 Z;  4NBA A;  2JIQ A;  1TWH I;  1WZN A;  5T64 A;  2IZ3 A;  4NBB A;  3S1Q I;  1Z02 A;  1QYP A;  2NVQ I;  1FDO A;  2H85 A;  2JR6 A;  4A3E I;  1RO0 A;  1YJ9 1;  1TWG I;  3HOX I;  1YJ9 Z;  3S1N I;  2WAQ A;  2E2I I;  1SFO I;  3Q87 A;  2JS4 A;  4NBC A;  4RV9 A;  2OTJ 1;  2OZK A;  2OTJ Z;  2NVX I;  2GTI A;  4NOZ A;  3P5J B;  4RVH A;  1PFT A;  1M1K 1;  4Y52 I;  1L1O C;  4E32 A;  3CCV 1;  1FDI A;  4RVF A;  2JA6 I;  4A3L I;  3CCV Z;  1WII A;  1X3Z A;  1Q86 2;  3HKZ A;  3IFU A;  2R92 I;  3I56 1;  3S14 I;  3I56 Z;  3S2D I;  3H0G I;  4MD9 A;  3S16 I;  1Z03 A;  2OTL 1;  3PO2 I;  2W03 A;  1YIT 1;  3I55 1;  1YIT Z;  1NJI 1;  1WW9 A;  3I55 Z;  4MON A;  1N2F A;  3J7A 4;  2V8I A;  3FQQ A;  2QKD A;  2R6M A;  3NDJ A;  4NBG A;  1YI2 1;  2M48 A;  4A3K I;  3GTP I;  1YI2 Z;  4QTT A;  1YJW 1;  3GTM S;  2LFU A;  1YJW Z;  2QR1 B;  1JWH C;  3M4O I;  3J81 f;  3J81 b;  2JA5 I;  2YAD A;  3IF8 A;  1QVF Z;  4A3F I;  1I3Q I;  2PK7 A;  3IX0 A;  1YUA A;  2PM9 A;  4NBE A;  3GTO I;  1Y1V S;  2EGT A;  3CXC Z;  1USP B;  2QA4 1;  1RO4 A;  3VMI A;  2QA4 Z;  2JA7 I;  3OW2 Z;  1VQP 1;  1KC8 1;  3NFZ A;  1I50 I;  1VQP Z;  2QEX 1;  2QEX Z;  3KIH A;  2BJO A;  1Q82 1;  4A3M I;  2JUB A;  3I07 A;  4Y7N I;  2LIY A;  4MRI A;  2JIP A;  1M90 2;  2O53 A;  2OOY B;  1QVF Y;  5D1O A;  2QRD B;  4HGZ A;  1TWC I;  1ZB9 A;  4BY7 I;  4MD8 A;  2J6A A;  3CCJ 1;  3CXC Y;  2V45 A;  3CCJ Z;  1KC8 2;  4E2Y A;  2VPW A;  1Q86 1;  4A3B I;  3OW2 Y;  4BBR I;  1VQ9 1;  4NBF A;  1VQ9 Z;  1SIW A;  1Q82 2;  3G4S 1; 
#chains in the Genus database with same CATH homology
 2F4O A;  3G4S Z;  1VLA A;  1KD1 2;  3J80 f;  3J80 b;  3CPW Z;  2YU9 I;  4MH4 A;  4S1T A;  3RZD I;  3HOY I;  3CCR 1;  2DE5 A;  3CCR Z;  3NDI A;  3MON A;  4E33 A;  5IP9 I;  4A3J I;  3CCU 1;  3CCU Z;  2RIQ A;  1YIJ 1;  1DL6 A;  1VQL 1;  1YIJ Z;  2NVT I;  1VQL Z;  1X0T A;  1KQS Z;  1I6H I;  3VMG A;  2P28 A;  2ZAE B;  4HH4 A;  2VF1 A;  3CC2 1;  2I3C A;  3CCS 1;  1W2B Z;  1RNI A;  4NFR A;  3CCS Z;  2OTL Z;  2HU9 A;  2NVY I;  1Y1W I;  3CPW Y;  3D6W A;  3F3P C;  1VQ8 1;  1RQF A;  1VQ8 Z;  3NH4 A;  3F3F C;  2V8J A;  3HOU I;  4BXX I;  3JAM f;  3JAM b;  1ZH1 A;  3CCL 1;  3CC4 1;  3CCL Z;  2VUM I;  3CCM 1;  3CC4 Z;  1KQS Y;  4RVG A;  5D1P A;  3CCM Z;  4EWC A;  5T6B A;  4DGL A;  5IT9 f;  1M90 1;  3G71 1;  1VQN 1;  3G71 Z;  2G2K A;  1VQN Z;  4E2Z A;  1W2B Y;  2KPI A;  3S1M I;  1X3W A;  3LUS A;  3S1R I;  1K83 I;  1NP6 A;  1S7M A;  5IP7 I;  5CM2 M;  2Q51 A;  1USP A;  1Q81 1;  3VMH A;  3MZL B;  3S15 I;  3PO3 I;  2GTH A;  3HOV I;  1K9M 1;  3CMA 1;  3CMA Z;  2M6N A;  4NBD A;  2GU2 A;  1VQM 1;  1Q7Y 2;  1VQM Z;  4DK1 A;  3S2H I;  1KD1 1;  4A93 I;  2O4H A;  3FQM A;  2KI7 B;  4NH1 C;  4A3C I;  4DQY B;  4AYB A;  1K73 1;  1VQK 1;  2RHB A;  5LL6 f;  1VQK Z;  3CQZ I;  4NB8 A;  3GTJ I;  4A3I I;  1ML8 A;  1VQ6 1;  1Q81 2;  5AN9 F;  1VQ6 Z;  2IZ4 A;  1KRL A;  2PMZ A;  5FLM I;  3NH8 A;  1K9M 2;  2JA8 I;  3TDH B;  2DE6 A;  3CD6 1;  3GCF A;  3CD6 Z;  2R7Z I;  4E30 A;  4X6A I;  4RVD A;  3EED A;  3RZO I;  4E2W A;  4A3G I;  2AKL A;  1K73 2;  1QF8 A;  1TFI A;  2R93 I;  2WB1 A;  2F4M A;  1VQ4 1;  3VB9 A;  1VQ4 Z;  2RPR A;  4NBH A;  1TWA I;  1YHQ 1;  1YHQ Z;  3BG0 B;  3I4N I;  1NUI A;  1Z01 A;  3GTL I;  3EER A;  4MXU A;  1N8R 1;  2VUG A;  1K8A 1;  3H3V J;  3CC2 Z;  3K7A I;  1VQO 1;  4MD7 A;  4CL1 A;  1VQO Z;  1WCM I;  2K5R A;  4E2X A;  1ZB8 A;  2Y0S A;  3HOW I;  1TWF I;  5A2Q f;  2K3R A;  5A2Q b;  1JJ2 Z;  2RBL A;  3CCQ 1;  2E2H I;  5C4J I;  4E31 A;  3CCQ Z;  3G6E 1;  4RS4 A;  3G6E Z;  4NB9 A;  1QVG Z;  2V8K A;  1Q7Y 1;  3M3Y I;  4QTU A;  4TNU A;  3GKQ A;  4HGY A;  1N8R 2;  2JNY A;  1K8A 2;  5IT9 b;  3CME 1;  3GTM I;  3CME Z;  1YUK A;  3TE5 B;  1M1K 2;  2QLV B;  3U50 C;  4BY1 I;  2JMO A;  3S17 I;  2E2J I;  2E9H A;  3KIF A;  4A3D I;  1VQ7 1;  4BBS I;  1JJ2 Y;  1VQ7 Z;  3T4N B;  1Y1V I;  2W04 A;  3D9X A;  1S72 1;  1QVG Y;  1S72 Z;  3I4M I;  5C3E I;  3PO3 S;  3GTQ I;  1R9T I;  1NJI 2;  1YJN 1;  3FKI I;  1YJN Z;  3VTN A;  2HF1 A;  1RO2 A;  3CCE 1;  2P3Y A;  3CCE Z;  3HOZ I;  3ESW A;  3BG1 B;  1VQ5 1;  1VQ5 Z;  3GTG I;  1RLY A;  2OOX B;  2QRE B;  3GTK I;  3QWU A;  5T67 A;  5C44 I;  3NH5 A;  5C4X I;  2Q4Z A;  5FLX f;  5FLX b;  1LQL A;  2DE7 A;  4XX2 A;  2RT9 A;  2B63 I;  2QRC B;  1P9N A;  5D1O B;  3MZK B;  3CC7 1;  3CC7 Z;  4NBA A;  1TWH I;  5T64 A;  2IZ3 A;  4NBB A;  3S1Q I;  1Z02 A;  1QYP A;  2NVQ I;  2H85 A;  2JR6 A;  4A3E I;  1RO0 A;  1YJ9 1;  1TWG I;  3HOX I;  1YJ9 Z;  3S1N I;  2WAQ A;  2E2I I;  1SFO I;  3Q87 A;  2JS4 A;  4NBC A;  4RV9 A;  2OTJ 1;  2OZK A;  2OTJ Z;  2NVX I;  2GTI A;  4NOZ A;  3P5J B;  4RVH A;  1PFT A;  1M1K 1;  4Y52 I;  1L1O C;  4E32 A;  3CCV 1;  4RVF A;  2JA6 I;  4A3L I;  3CCV Z;  1WII A;  1X3Z A;  1Q86 2;  3HKZ A;  3IFU A;  2R92 I;  3I56 1;  3S14 I;  3I56 Z;  3S2D I;  3H0G I;  4MD9 A;  3S16 I;  1Z03 A;  2OTL 1;  3PO2 I;  2W03 A;  1YIT 1;  3I55 1;  1YIT Z;  1NJI 1;  1WW9 A;  3I55 Z;  4MON A;  1N2F A;  3J7A 4;  2V8I A;  3FQQ A;  2QKD A;  2R6M A;  3NDJ A;  4NBG A;  1YI2 1;  2M48 A;  4A3K I;  3GTP I;  1YI2 Z;  4QTT A;  1YJW 1;  3GTM S;  2LFU A;  1YJW Z;  2QR1 B;  1JWH C;  3M4O I;  3J81 f;  3J81 b;  2JA5 I;  2YAD A;  3IF8 A;  1QVF Z;  4A3F I;  1I3Q I;  2PK7 A;  3IX0 A;  1YUA A;  2PM9 A;  4NBE A;  3GTO I;  1Y1V S;  2EGT A;  3CXC Z;  1USP B;  2QA4 1;  1RO4 A;  3VMI A;  2QA4 Z;  2JA7 I;  3OW2 Z;  1VQP 1;  1KC8 1;  3NFZ A;  1I50 I;  1VQP Z;  2QEX 1;  2QEX Z;  3KIH A;  2BJO A;  1Q82 1;  4A3M I;  2JUB A;  3I07 A;  4Y7N I;  2LIY A;  4MRI A;  1M90 2;  2O53 A;  2OOY B;  1QVF Y;  5D1O A;  2QRD B;  4HGZ A;  1TWC I;  1ZB9 A;  4BY7 I;  4MD8 A;  2J6A A;  3CCJ 1;  3CXC Y;  3CCJ Z;  1KC8 2;  4E2Y A;  1Q86 1;  4A3B I;  3OW2 Y;  4BBR I;  1VQ9 1;  4NBF A;  1VQ9 Z;  1Q82 2;  3G4S 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...