3MONA

Crystal structures of two intensely sweet proteins
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
44
structure length
44
Chain Sequence
REIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sweet-tasting protein
molecule keywords MONELLIN
publication title Crystal structures of two intensely sweet proteins.
pubmed doi rcsb
source organism Dioscoreophyllum cumminsii
total genus 6
structure length 44
sequence length 44
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 1992-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09200 Monellin Monellin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.610 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3monA00
4MONA 1KRLA 3MONA
chains in the Genus database with same CATH superfamily
4TNUA 2DE7A 3S1RI 1YUAA 3GTQI 1I3QI 2DE5A 4HH4A 3CC71 1YHQZ 3F3FC 4RVGA 1YJNZ 2E7ZA 2OOYB 3OW2Z 1JJ2Y 3KIHA 5T64A 1VQ5Z 3CCU1 2JR6A 2KPIA 1WJ2A 2JIMA 4A3MI 3I561 1X3WA 1LQLA 4NB8A 2RT9A 4NBGA 3FQMA 3D9XA 2E2JI 4XX2A 3S2HI 2NVQI 2O4HA 1Q811 2E2HI 4NBHA 4A3GI 3S1QI 3MZLB 3CCL1 1W2BY 3HOVI 3HKZA 1VQLZ 4MONA 3G6E1 2JNYA 1KD12 4NBDA 4E2YA 3M4OI 2QEXZ 4RS4A 1Q16A 1KQSZ 4Y7NI 1NJI1 5FLMI 4HGYA 4MD8A 1K732 3IF8A 3J80f 1WIIA 3TE5B 2OTLZ 1I6HI 3GTMS 2OOXB 3J81f 1Y1VI 3CCR1 2R93I 2HF1A 2B63I 3MONA 1K9M2 4QTTA 1Q7Y2 3S16I 5IT9f 4NBFA 2LIYA 2JUBA 3S15I 3IR7A 3MZKB 3GTPI 4E33A 3CCS1 1N8R2 3JAMb 1Z03A 3CCE1 3ESWA 1YI2Z 5IP9I 3CCJ1 4BBSI 2M6NA 1QVFZ 1TWCI 2Q51A 3J7A4 3G711 5T67A 5AN9F 1M901 1ZB8A 3NH4A 4NBCA 4MD7A 3CMA1 3GTOI 3EEDA 2QEX1 1K731 2R92I 3U50C 1N2FA 3GTGI 4A3BI 1VQ9Z 3GKQA 1VQPZ 4A3JI 1VQ41 2QR1B 5T6BA 2WB1A 1VQKZ 5IP7I 4HGZA 5D1PA 3IFUA 4E30A 1VQNZ 3PO3I 1RO0A 1TWGI 2JA8I 2V3VA 1Y8CA 1Q812 4X6AI 1YUKA 1RO2A 1YIJ1 2Y0SA 3CMEZ 2Q4ZA 1VQ7Z 4E2ZA 4RVDA 4E32A 2P28A 1K83I 1WCMI 4DK1A 5FLXf 2PMZA 3Q87A 4A3KI 2O53A 3P5JB 5LL6f 4DGLA 2RHBA 1NJI2 3J80b 2QA4Z 2JA7I 3H3VJ 4A3II 1AA6A 3CXCY 3VTNA 3VMIA 2W04A 2QLVB 2WAQA 3J81b 4MH4A 1YITZ 1YJ9Z 1JJ2Z 5A2Qf 1ZH1A 3CCQZ 3CCMZ 5IT9b 3CPWY 4BBRI 3CD6Z 4RVFA 2JIOA 5C4JI 3NH8A 3CME1 3CC21 3S1NI 3M3YI 3PO2I 2QRCB 1TFIA 1VQMZ 4NH1C 1YHQ1 4CL1A 1TWHI 1YJN1 4NFRA 1M902 2QRDB 4MRIA 3D6WA 1QVGY 3HOYI 3TDHB 2VPXA 2R7ZI 2IZ4A 3S2DI 1NP6A 2VUMI 2NVTI 1VQ51 1W2BZ 4AYBA 3I4NI 5C4XI 1KQSY 2F4OA 2JMOA 1KC82 3NDIA 2F4MA 3F3PC 3GTKI 1S72Z 3S17I 4A3LI 3IX0A 3PO3S 2E9HA 1RLYA 1YJ91 2NVYI 1VQ8Z 3CCVZ 3I55Z 1SIWA 2OZKA 1ML8A 4DQYB 4A3FI 3EERA 4A3EI 3FKII 2RIQA 3S1MI 2QREB 2OTJZ 1Q862 1VQL1 2EGTA 1NUIA 4A3CI 1VQOZ 4E2XA 2V8IA 2GTIA 4QTUA 1RNIA 1YJWZ 3I07A 3BG1B 3RZDI 2IV2X 5FLXb 1KC81 1RQFA 4NBBA 3G4SZ 2JA5I 2OTL1 2QKDA 1TWFI 4MD9A 2JIRA 3CC7Z 3K7AI 2JIQA 2V8KA 5CM2M 2G2KA 2VF1A 2LEXA 5C44I 3I4MI 1VQ81 1USPB 5A2Qb 3CCV1 1QF8A 3NFZA 3I551 2LFUA 2GU2A 3CCUZ 1Q861 1JWHC 2V45A 1X3ZA 1YI21 3D2LA 4NB9A 1RO4A 2J6AA 4Y52I 2W03A 3VMHA 4EWCA 1VQ91 3OW2Y 3VMGA 3LUSA 3CCLZ 1VQP1 1Y1VS 2NVXI 1VQ6Z 3G6EZ 1SFOI 1VQK1 4RV9A 4BY1I 1K8A1 2I3CA 2NAPA 4S1TA 3H0GI 1VQN1 1M1K1 3QWUA 3T4NB 1S7MA 3NDJA 1USPA 2E2II 4BXXI 3CXCZ 4E2WA 1VQ71 1I50I 1Z02A 1R9TI 3VB9A 3CCRZ 4NBAA 3RZOI 2DE6A 3CPWZ 1Q821 3CQZI 2JS4A 3CCSZ 2YU9I 3CCEZ 2R6MA 2QA41 3CCJZ 2AYDA 1QXFA 4NOZA 3G71Z 2ZAEB 2RPRA 1KRLA 1VQ61 2VPWA 3HOXI 1QVGZ 3CMAZ 1YIT1 2KI7B 2HU9A 3CCQ1 3CCM1 3CD61 1FDOA 3HOWI 1PFTA 1VLAA 3GCFA 4A3DI 1FDIA 4MXUA 3BG0B 1VQ4Z 3CC4Z 1L1OC 2IZ3A 1X0TA 1Z01A 1VQM1 1QVFY 1TWAI 1P9NA 2RBLA 4NBEA 5D1OB 2JIPA 2VPYA 1DL6A 2H85A 2K3RA 3KIFA 2BJOA 2P3YA 1YIJZ 1S721 1KD11 2K5RA 1QYPA 2VUGA 1WZNA 3HOUI 3HOZI 1K8A2 3FQQA 4BY7I 2PM9A 1M1K2 2GTHA 2V8JA 2VPZA 1Y1WI 4A93I 2M48A 4E31A 3I56Z 2OTJ1 3CC41 5C3EI 1ZB9A 3GTJI 3S14I 1VQO1 1WW9A 1K9M1 3GTMI 1Q7Y1 2PK7A 2JA6I 1YJW1 3NH5A 1N8R1 1Q822 2AKLA 4RVHA 3JAMf 5D1OA 3G4S1 2YADA 3GTLI 3CC2Z
chains in the Genus database with same CATH topology
4TNUA 2DE7A 3S1RI 1YUAA 3GTQI 1I3QI 2DE5A 4HH4A 3CC71 1YHQZ 3F3FC 4RVGA 1YJNZ 2OOYB 3OW2Z 1JJ2Y 3KIHA 5T64A 1VQ5Z 3CCU1 2JR6A 2KPIA 4A3MI 3I561 1X3WA 1LQLA 4NB8A 2RT9A 4NBGA 3FQMA 3D9XA 2E2JI 4XX2A 3S2HI 2NVQI 2O4HA 1Q811 2E2HI 4NBHA 4A3GI 3S1QI 3MZLB 3CCL1 1W2BY 3HOVI 3HKZA 1VQLZ 4MONA 3G6E1 2JNYA 1KD12 4NBDA 4E2YA 3M4OI 2QEXZ 4RS4A 1KQSZ 4Y7NI 1NJI1 5FLMI 4HGYA 4MD8A 1K732 3IF8A 3J80f 1WIIA 3TE5B 2OTLZ 1I6HI 3GTMS 2OOXB 3J81f 1Y1VI 3CCR1 2R93I 2HF1A 2B63I 3MONA 1K9M2 4QTTA 1Q7Y2 3S16I 5IT9f 4NBFA 2LIYA 2JUBA 3S15I 3MZKB 3GTPI 4E33A 3CCS1 1N8R2 3JAMb 1Z03A 3CCE1 3ESWA 1YI2Z 5IP9I 3CCJ1 4BBSI 2M6NA 1QVFZ 1TWCI 2Q51A 3J7A4 3G711 5T67A 5AN9F 1M901 1ZB8A 3NH4A 4NBCA 4MD7A 3CMA1 3GTOI 3EEDA 2QEX1 1K731 2R92I 3U50C 1N2FA 3GTGI 4A3BI 1VQ9Z 3GKQA 1VQPZ 4A3JI 1VQ41 2QR1B 5T6BA 2WB1A 1VQKZ 5IP7I 4HGZA 5D1PA 3IFUA 4E30A 1VQNZ 3PO3I 1RO0A 1TWGI 2JA8I 1Q812 4X6AI 1YUKA 1RO2A 1YIJ1 2Y0SA 3CMEZ 2Q4ZA 1VQ7Z 4E2ZA 4RVDA 4E32A 2P28A 1K83I 1WCMI 4DK1A 5FLXf 2PMZA 3Q87A 4A3KI 2O53A 3P5JB 5LL6f 4DGLA 2RHBA 1NJI2 3J80b 2QA4Z 2JA7I 3H3VJ 4A3II 3CXCY 3VTNA 3VMIA 2W04A 2QLVB 2WAQA 3J81b 4MH4A 1YITZ 1YJ9Z 1JJ2Z 5A2Qf 1ZH1A 3CCQZ 3CCMZ 5IT9b 3CPWY 4BBRI 3CD6Z 4RVFA 5C4JI 3NH8A 3CME1 3CC21 3S1NI 3M3YI 3PO2I 2QRCB 1TFIA 1VQMZ 4NH1C 1YHQ1 4CL1A 1TWHI 1YJN1 4NFRA 1M902 2QRDB 4MRIA 3D6WA 1QVGY 3HOYI 3TDHB 2R7ZI 3S2DI 2IZ4A 1NP6A 2VUMI 2NVTI 1VQ51 1W2BZ 4AYBA 3I4NI 5C4XI 1KQSY 2F4OA 2JMOA 1KC82 3NDIA 2F4MA 3F3PC 3GTKI 1S72Z 3S17I 4A3LI 3IX0A 3PO3S 2E9HA 1RLYA 1YJ91 2NVYI 1VQ8Z 3CCVZ 3I55Z 2OZKA 1ML8A 4DQYB 4A3FI 3EERA 4A3EI 3FKII 2RIQA 3S1MI 2QREB 2OTJZ 1Q862 1VQL1 2EGTA 1NUIA 4A3CI 1VQOZ 4E2XA 2V8IA 2GTIA 4QTUA 1RNIA 1YJWZ 3I07A 3BG1B 3RZDI 5FLXb 1KC81 1RQFA 4NBBA 3G4SZ 2JA5I 2OTL1 2QKDA 1TWFI 4MD9A 3CC7Z 3K7AI 2V8KA 5CM2M 2G2KA 2VF1A 5C44I 3I4MI 1VQ81 1USPB 5A2Qb 3CCV1 1QF8A 3NFZA 3I551 2LFUA 2GU2A 3CCUZ 1Q861 1JWHC 1X3ZA 1YI21 4NB9A 1RO4A 2J6AA 4Y52I 2W03A 3VMHA 4EWCA 1VQ91 3OW2Y 3VMGA 3LUSA 3CCLZ 1VQP1 1Y1VS 2NVXI 1VQ6Z 3G6EZ 1SFOI 1VQK1 4RV9A 4BY1I 1K8A1 2I3CA 4S1TA 3H0GI 1VQN1 1M1K1 3QWUA 3T4NB 1S7MA 3NDJA 1USPA 2E2II 4BXXI 3CXCZ 4E2WA 1VQ71 1I50I 1Z02A 1R9TI 3VB9A 3CCRZ 4NBAA 3RZOI 2DE6A 3CPWZ 1Q821 3CQZI 2JS4A 3CCSZ 2YU9I 3CCEZ 2R6MA 2QA41 3CCJZ 4NOZA 3G71Z 2ZAEB 2RPRA 1KRLA 1VQ61 3HOXI 1QVGZ 3CMAZ 1YIT1 2KI7B 2HU9A 3CCQ1 3CCM1 3CD61 3HOWI 1PFTA 1VLAA 3GCFA 4A3DI 4MXUA 3BG0B 1VQ4Z 3CC4Z 1L1OC 2IZ3A 1X0TA 1Z01A 1VQM1 1QVFY 1TWAI 1P9NA 2RBLA 4NBEA 5D1OB 1DL6A 2H85A 2K3RA 3KIFA 2BJOA 2P3YA 1YIJZ 1S721 1KD11 2K5RA 1QYPA 2VUGA 3HOUI 3HOZI 1K8A2 3FQQA 4BY7I 2PM9A 1M1K2 2GTHA 2V8JA 1Y1WI 4A93I 2M48A 4E31A 3I56Z 2OTJ1 3CC41 5C3EI 1ZB9A 3GTJI 3S14I 1VQO1 1WW9A 1K9M1 3GTMI 1Q7Y1 2PK7A 2JA6I 1YJW1 3NH5A 1N8R1 1Q822 2AKLA 4RVHA 3JAMf 5D1OA 3G4S1 2YADA 3GTLI 3CC2Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MON A;  1KRL A;  3MON A; 
#chains in the Genus database with same CATH topology
 4TNU A;  2DE7 A;  3S1R I;  1YUA A;  3GTQ I;  1I3Q I;  2DE5 A;  4HH4 A;  3CC7 1;  1YHQ Z;  3F3F C;  4RVG A;  1YJN Z;  2E7Z A;  2OOY B;  3OW2 Z;  1JJ2 Y;  3KIH A;  5T64 A;  1VQ5 Z;  3CCU 1;  2JR6 A;  2KPI A;  1WJ2 A;  2JIM A;  4A3M I;  3I56 1;  1X3W A;  1LQL A;  4NB8 A;  2RT9 A;  4NBG A;  3FQM A;  3D9X A;  2E2J I;  4XX2 A;  3S2H I;  2NVQ I;  2O4H A;  1Q81 1;  2E2H I;  4NBH A;  4A3G I;  3S1Q I;  3MZL B;  3CCL 1;  1W2B Y;  3HOV I;  3HKZ A;  1VQL Z;  4MON A;  3G6E 1;  2JNY A;  1KD1 2;  4NBD A;  4E2Y A;  3M4O I;  2QEX Z;  4RS4 A;  1Q16 A;  1KQS Z;  4Y7N I;  1NJI 1;  5FLM I;  4HGY A;  4MD8 A;  1K73 2;  3IF8 A;  3J80 f;  1WII A;  3TE5 B;  2OTL Z;  1I6H I;  3GTM S;  2OOX B;  3J81 f;  1Y1V I;  3CCR 1;  2R93 I;  2HF1 A;  2B63 I;  3MON A;  1K9M 2;  4QTT A;  1Q7Y 2;  3S16 I;  5IT9 f;  4NBF A;  2LIY A;  2JUB A;  3S15 I;  3IR7 A;  3MZK B;  3GTP I;  4E33 A;  3CCS 1;  1N8R 2;  3JAM b;  1Z03 A;  3CCE 1;  3ESW A;  1YI2 Z;  5IP9 I;  3CCJ 1;  4BBS I;  2M6N A;  1QVF Z;  1TWC I;  2Q51 A;  3J7A 4;  3G71 1;  5T67 A;  5AN9 F;  1M90 1;  1ZB8 A;  3NH4 A;  4NBC A;  4MD7 A;  3CMA 1;  3GTO I;  3EED A;  2QEX 1;  1K73 1;  2R92 I;  3U50 C;  1N2F A;  3GTG I;  4A3B I;  1VQ9 Z;  3GKQ A;  1VQP Z;  4A3J I;  1VQ4 1;  2QR1 B;  5T6B A;  2WB1 A;  1VQK Z;  5IP7 I;  4HGZ A;  5D1P A;  3IFU A;  4E30 A;  1VQN Z;  3PO3 I;  1RO0 A;  1TWG I;  2JA8 I;  2V3V A;  1Y8C A;  1Q81 2;  4X6A I;  1YUK A;  1RO2 A;  1YIJ 1;  2Y0S A;  3CME Z;  2Q4Z A;  1VQ7 Z;  4E2Z A;  4RVD A;  4E32 A;  2P28 A;  1K83 I;  1WCM I;  4DK1 A;  5FLX f;  2PMZ A;  3Q87 A;  4A3K I;  2O53 A;  3P5J B;  5LL6 f;  4DGL A;  2RHB A;  1NJI 2;  3J80 b;  2QA4 Z;  2JA7 I;  3H3V J;  4A3I I;  1AA6 A;  3CXC Y;  3VTN A;  3VMI A;  2W04 A;  2QLV B;  2WAQ A;  3J81 b;  4MH4 A;  1YIT Z;  1YJ9 Z;  1JJ2 Z;  5A2Q f;  1ZH1 A;  3CCQ Z;  3CCM Z;  5IT9 b;  3CPW Y;  4BBR I;  3CD6 Z;  4RVF A;  2JIO A;  5C4J I;  3NH8 A;  3CME 1;  3CC2 1;  3S1N I;  3M3Y I;  3PO2 I;  2QRC B;  1TFI A;  1VQM Z;  4NH1 C;  1YHQ 1;  4CL1 A;  1TWH I;  1YJN 1;  4NFR A;  1M90 2;  2QRD B;  4MRI A;  3D6W A;  1QVG Y;  3HOY I;  3TDH B;  2VPX A;  2R7Z I;  2IZ4 A;  3S2D I;  1NP6 A;  2VUM I;  2NVT I;  1VQ5 1;  1W2B Z;  4AYB A;  3I4N I;  5C4X I;  1KQS Y;  2F4O A;  2JMO A;  1KC8 2;  3NDI A;  2F4M A;  3F3P C;  3GTK I;  1S72 Z;  3S17 I;  4A3L I;  3IX0 A;  3PO3 S;  2E9H A;  1RLY A;  1YJ9 1;  2NVY I;  1VQ8 Z;  3CCV Z;  3I55 Z;  1SIW A;  2OZK A;  1ML8 A;  4DQY B;  4A3F I;  3EER A;  4A3E I;  3FKI I;  2RIQ A;  3S1M I;  2QRE B;  2OTJ Z;  1Q86 2;  1VQL 1;  2EGT A;  1NUI A;  4A3C I;  1VQO Z;  4E2X A;  2V8I A;  2GTI A;  4QTU A;  1RNI A;  1YJW Z;  3I07 A;  3BG1 B;  3RZD I;  2IV2 X;  5FLX b;  1KC8 1;  1RQF A;  4NBB A;  3G4S Z;  2JA5 I;  2OTL 1;  2QKD A;  1TWF I;  4MD9 A;  2JIR A;  3CC7 Z;  3K7A I;  2JIQ A;  2V8K A;  5CM2 M;  2G2K A;  2VF1 A;  2LEX A;  5C44 I;  3I4M I;  1VQ8 1;  1USP B;  5A2Q b;  3CCV 1;  1QF8 A;  3NFZ A;  3I55 1;  2LFU A;  2GU2 A;  3CCU Z;  1Q86 1;  1JWH C;  2V45 A;  1X3Z A;  1YI2 1;  3D2L A;  4NB9 A;  1RO4 A;  2J6A A;  4Y52 I;  2W03 A;  3VMH A;  4EWC A;  1VQ9 1;  3OW2 Y;  3VMG A;  3LUS A;  3CCL Z;  1VQP 1;  1Y1V S;  2NVX I;  1VQ6 Z;  3G6E Z;  1SFO I;  1VQK 1;  4RV9 A;  4BY1 I;  1K8A 1;  2I3C A;  2NAP A;  4S1T A;  3H0G I;  1VQN 1;  1M1K 1;  3QWU A;  3T4N B;  1S7M A;  3NDJ A;  1USP A;  2E2I I;  4BXX I;  3CXC Z;  4E2W A;  1VQ7 1;  1I50 I;  1Z02 A;  1R9T I;  3VB9 A;  3CCR Z;  4NBA A;  3RZO I;  2DE6 A;  3CPW Z;  1Q82 1;  3CQZ I;  2JS4 A;  3CCS Z;  2YU9 I;  3CCE Z;  2R6M A;  2QA4 1;  3CCJ Z;  2AYD A;  1QXF A;  4NOZ A;  3G71 Z;  2ZAE B;  2RPR A;  1KRL A;  1VQ6 1;  2VPW A;  3HOX I;  1QVG Z;  3CMA Z;  1YIT 1;  2KI7 B;  2HU9 A;  3CCQ 1;  3CCM 1;  3CD6 1;  1FDO A;  3HOW I;  1PFT A;  1VLA A;  3GCF A;  4A3D I;  1FDI A;  4MXU A;  3BG0 B;  1VQ4 Z;  3CC4 Z;  1L1O C;  2IZ3 A;  1X0T A;  1Z01 A;  1VQM 1;  1QVF Y;  1TWA I;  1P9N A;  2RBL A;  4NBE A;  5D1O B;  2JIP A;  2VPY A;  1DL6 A;  2H85 A;  2K3R A;  3KIF A;  2BJO A;  2P3Y A;  1YIJ Z;  1S72 1;  1KD1 1;  2K5R A;  1QYP A;  2VUG A;  1WZN A;  3HOU I;  3HOZ I;  1K8A 2;  3FQQ A;  4BY7 I;  2PM9 A;  1M1K 2;  2GTH A;  2V8J A;  2VPZ A;  1Y1W I;  4A93 I;  2M48 A;  4E31 A;  3I56 Z;  2OTJ 1;  3CC4 1;  5C3E I;  1ZB9 A;  3GTJ I;  3S14 I;  1VQO 1;  1WW9 A;  1K9M 1;  3GTM I;  1Q7Y 1;  2PK7 A;  2JA6 I;  1YJW 1;  3NH5 A;  1N8R 1;  1Q82 2;  2AKL A;  4RVH A;  3JAM f;  5D1O A;  3G4S 1;  2YAD A;  3GTL I;  3CC2 Z; 
#chains in the Genus database with same CATH homology
 4TNU A;  2DE7 A;  3S1R I;  1YUA A;  3GTQ I;  1I3Q I;  2DE5 A;  4HH4 A;  3CC7 1;  1YHQ Z;  3F3F C;  4RVG A;  1YJN Z;  2OOY B;  3OW2 Z;  1JJ2 Y;  3KIH A;  5T64 A;  1VQ5 Z;  3CCU 1;  2JR6 A;  2KPI A;  4A3M I;  3I56 1;  1X3W A;  1LQL A;  4NB8 A;  2RT9 A;  4NBG A;  3FQM A;  3D9X A;  2E2J I;  4XX2 A;  3S2H I;  2NVQ I;  2O4H A;  1Q81 1;  2E2H I;  4NBH A;  4A3G I;  3S1Q I;  3MZL B;  3CCL 1;  1W2B Y;  3HOV I;  3HKZ A;  1VQL Z;  4MON A;  3G6E 1;  2JNY A;  1KD1 2;  4NBD A;  4E2Y A;  3M4O I;  2QEX Z;  4RS4 A;  1KQS Z;  4Y7N I;  1NJI 1;  5FLM I;  4HGY A;  4MD8 A;  1K73 2;  3IF8 A;  3J80 f;  1WII A;  3TE5 B;  2OTL Z;  1I6H I;  3GTM S;  2OOX B;  3J81 f;  1Y1V I;  3CCR 1;  2R93 I;  2HF1 A;  2B63 I;  3MON A;  1K9M 2;  4QTT A;  1Q7Y 2;  3S16 I;  5IT9 f;  4NBF A;  2LIY A;  2JUB A;  3S15 I;  3MZK B;  3GTP I;  4E33 A;  3CCS 1;  1N8R 2;  3JAM b;  1Z03 A;  3CCE 1;  3ESW A;  1YI2 Z;  5IP9 I;  3CCJ 1;  4BBS I;  2M6N A;  1QVF Z;  1TWC I;  2Q51 A;  3J7A 4;  3G71 1;  5T67 A;  5AN9 F;  1M90 1;  1ZB8 A;  3NH4 A;  4NBC A;  4MD7 A;  3CMA 1;  3GTO I;  3EED A;  2QEX 1;  1K73 1;  2R92 I;  3U50 C;  1N2F A;  3GTG I;  4A3B I;  1VQ9 Z;  3GKQ A;  1VQP Z;  4A3J I;  1VQ4 1;  2QR1 B;  5T6B A;  2WB1 A;  1VQK Z;  5IP7 I;  4HGZ A;  5D1P A;  3IFU A;  4E30 A;  1VQN Z;  3PO3 I;  1RO0 A;  1TWG I;  2JA8 I;  1Q81 2;  4X6A I;  1YUK A;  1RO2 A;  1YIJ 1;  2Y0S A;  3CME Z;  2Q4Z A;  1VQ7 Z;  4E2Z A;  4RVD A;  4E32 A;  2P28 A;  1K83 I;  1WCM I;  4DK1 A;  5FLX f;  2PMZ A;  3Q87 A;  4A3K I;  2O53 A;  3P5J B;  5LL6 f;  4DGL A;  2RHB A;  1NJI 2;  3J80 b;  2QA4 Z;  2JA7 I;  3H3V J;  4A3I I;  3CXC Y;  3VTN A;  3VMI A;  2W04 A;  2QLV B;  2WAQ A;  3J81 b;  4MH4 A;  1YIT Z;  1YJ9 Z;  1JJ2 Z;  5A2Q f;  1ZH1 A;  3CCQ Z;  3CCM Z;  5IT9 b;  3CPW Y;  4BBR I;  3CD6 Z;  4RVF A;  5C4J I;  3NH8 A;  3CME 1;  3CC2 1;  3S1N I;  3M3Y I;  3PO2 I;  2QRC B;  1TFI A;  1VQM Z;  4NH1 C;  1YHQ 1;  4CL1 A;  1TWH I;  1YJN 1;  4NFR A;  1M90 2;  2QRD B;  4MRI A;  3D6W A;  1QVG Y;  3HOY I;  3TDH B;  2R7Z I;  3S2D I;  2IZ4 A;  1NP6 A;  2VUM I;  2NVT I;  1VQ5 1;  1W2B Z;  4AYB A;  3I4N I;  5C4X I;  1KQS Y;  2F4O A;  2JMO A;  1KC8 2;  3NDI A;  2F4M A;  3F3P C;  3GTK I;  1S72 Z;  3S17 I;  4A3L I;  3IX0 A;  3PO3 S;  2E9H A;  1RLY A;  1YJ9 1;  2NVY I;  1VQ8 Z;  3CCV Z;  3I55 Z;  2OZK A;  1ML8 A;  4DQY B;  4A3F I;  3EER A;  4A3E I;  3FKI I;  2RIQ A;  3S1M I;  2QRE B;  2OTJ Z;  1Q86 2;  1VQL 1;  2EGT A;  1NUI A;  4A3C I;  1VQO Z;  4E2X A;  2V8I A;  2GTI A;  4QTU A;  1RNI A;  1YJW Z;  3I07 A;  3BG1 B;  3RZD I;  5FLX b;  1KC8 1;  1RQF A;  4NBB A;  3G4S Z;  2JA5 I;  2OTL 1;  2QKD A;  1TWF I;  4MD9 A;  3CC7 Z;  3K7A I;  2V8K A;  5CM2 M;  2G2K A;  2VF1 A;  5C44 I;  3I4M I;  1VQ8 1;  1USP B;  5A2Q b;  3CCV 1;  1QF8 A;  3NFZ A;  3I55 1;  2LFU A;  2GU2 A;  3CCU Z;  1Q86 1;  1JWH C;  1X3Z A;  1YI2 1;  4NB9 A;  1RO4 A;  2J6A A;  4Y52 I;  2W03 A;  3VMH A;  4EWC A;  1VQ9 1;  3OW2 Y;  3VMG A;  3LUS A;  3CCL Z;  1VQP 1;  1Y1V S;  2NVX I;  1VQ6 Z;  3G6E Z;  1SFO I;  1VQK 1;  4RV9 A;  4BY1 I;  1K8A 1;  2I3C A;  4S1T A;  3H0G I;  1VQN 1;  1M1K 1;  3QWU A;  3T4N B;  1S7M A;  3NDJ A;  1USP A;  2E2I I;  4BXX I;  3CXC Z;  4E2W A;  1VQ7 1;  1I50 I;  1Z02 A;  1R9T I;  3VB9 A;  3CCR Z;  4NBA A;  3RZO I;  2DE6 A;  3CPW Z;  1Q82 1;  3CQZ I;  2JS4 A;  3CCS Z;  2YU9 I;  3CCE Z;  2R6M A;  2QA4 1;  3CCJ Z;  4NOZ A;  3G71 Z;  2ZAE B;  2RPR A;  1KRL A;  1VQ6 1;  3HOX I;  1QVG Z;  3CMA Z;  1YIT 1;  2KI7 B;  2HU9 A;  3CCQ 1;  3CCM 1;  3CD6 1;  3HOW I;  1PFT A;  1VLA A;  3GCF A;  4A3D I;  4MXU A;  3BG0 B;  1VQ4 Z;  3CC4 Z;  1L1O C;  2IZ3 A;  1X0T A;  1Z01 A;  1VQM 1;  1QVF Y;  1TWA I;  1P9N A;  2RBL A;  4NBE A;  5D1O B;  1DL6 A;  2H85 A;  2K3R A;  3KIF A;  2BJO A;  2P3Y A;  1YIJ Z;  1S72 1;  1KD1 1;  2K5R A;  1QYP A;  2VUG A;  3HOU I;  3HOZ I;  1K8A 2;  3FQQ A;  4BY7 I;  2PM9 A;  1M1K 2;  2GTH A;  2V8J A;  1Y1W I;  4A93 I;  2M48 A;  4E31 A;  3I56 Z;  2OTJ 1;  3CC4 1;  5C3E I;  1ZB9 A;  3GTJ I;  3S14 I;  1VQO 1;  1WW9 A;  1K9M 1;  3GTM I;  1Q7Y 1;  2PK7 A;  2JA6 I;  1YJW 1;  3NH5 A;  1N8R 1;  1Q82 2;  2AKL A;  4RVH A;  3JAM f;  5D1O A;  3G4S 1;  2YAD A;  3GTL I;  3CC2 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...