3MONA

Crystal structures of two intensely sweet proteins
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
44
structure length
44
Chain Sequence
REIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONELLIN
publication title Crystal structures of two intensely sweet proteins.
pubmed doi rcsb
source organism Dioscoreophyllum cumminsii
molecule tags Sweet-tasting protein
total genus 6
structure length 44
sequence length 44
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 1992-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09200 Monellin Monellin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.610 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3monA00
4MONA 3MONA 1KRLA
chains in the Genus database with same CATH superfamily
2VPWA 2R6MA 3CC71 1LQLA 2V3VA 3G6EZ 3IF8A 1ZB9A 2R92I 3PO3I 3NH5A 2PK7A 1ZH1A 2G2KA 3IX0A 1WCMI 3KIHA 1Q821 3MZKB 5IP7I 3GTPI 3RZOI 3J7A4 2RHBA 3K7AI 3NFZA 2AKLA 3S1RI 4E30A 4QTUA 3CCQZ 3HOZI 3HOWI 1K8A1 3MONA 2RPRA 4NBGA 3RZDI 2RIQA 4NOZA 4Y7NI 4MXUA 2E7ZA 2F4OA 1SFOI 1Y8CA 1YJNZ 1L1OC 4E2ZA 2AYDA 1VQ71 4A3GI 4A3EI 1WIIA 1M1K1 1VQPZ 3OW2Y 1RQFA 1W2BZ 1KD12 1Z02A 1USPB 5C4XI 1FDOA 2JIQA 2B63I 2Q51A 2OOXB 1RO4A 1VQ91 4MD9A 3CC4Z 3CCE1 1R9TI 2E2JI 1Q16A 2BJOA 4HGYA 3CCU1 2JNYA 2R7ZI 1Q7Y2 3I56Z 4NFRA 4X6AI 2IZ3A 1YJWZ 4NH1C 1YUAA 3VMHA 5C4JI 1RNIA 4QTTA 3CMA1 4E32A 4NBEA 1VQNZ 1QYPA 3CCVZ 1I50I 1VQ61 2VPZA 3NDJA 3GTOI 3HKZA 3G71Z 3NH4A 3CD61 2M6NA 2WB1A 2V8IA 1VQKZ 2YU9I 2QA4Z 1VQM1 2JIPA 5FLXb 3CCJZ 1RO2A 1ZB8A 4HGZA 2QRDB 2VUGA 2W04A 2OTLZ 3VB9A 2DE7A 2QKDA 3PO3S 3H0GI 1KQSY 1YHQ1 1K8A2 3CMEZ 2OTJZ 3G4S1 2LEXA 4S1TA 3M3YI 1QVFZ 5LL6f 3KIFA 1X3ZA 4MD8A 2E9HA 1W2BY 1YJ9Z 3I4NI 1Z01A 5D1OB 1NJI1 3CCLZ 1VQL1 2QEX1 4TNUA 1M1K2 3F3PC 2JA6I 1VQ4Z 4A3JI 3HOVI 3TE5B 4A3FI 3FQMA 3CCR1 2RBLA 4MONA 2ZAEB 1NUIA 4BY1I 4BBRI 2LIYA 3J81f 1TWHI 3GCFA 1Y1WI 5CM2M 3HOUI 2YADA 3JAMb 2GU2A 1KC81 2E2HI 1JJ2Z 1K9M1 3S1MI 3CC7Z 1ML8A 1YI21 1TWFI 3VMGA 2GTHA 2V8KA 2HF1A 4RS4A 5D1PA 1X3WA 4NBHA 3JAMf 4NBBA 5AN9F 2P3YA 1Y1VI 1TWGI 5D1OA 1KQSZ 1WZNA 1S72Z 3TDHB 2O4HA 2KPIA 2NVTI 3I4MI 4E2WA 2PM9A 2KI7B 3S17I 2DE5A 3NDIA 2QRCB 1QVFY 1VQP1 1RLYA 4A3CI 2VPYA 2H85A 2E2II 4NBAA 1SIWA 1TWAI 3EERA 5T6BA 3S2DI 2V45A 1YIT1 3GKQA 1K731 4MRIA 4XX2A 2VF1A 3CC21 1M902 3HOXI 1Q862 2JR6A 1N8R1 2Y0SA 1VQ9Z 1NJI2 1N2FA 4CL1A 1VQ51 1VQ81 3CCEZ 1YJW1 2JIOA 3HOYI 3CCUZ 2J6AA 3EEDA 2IV2X 3GTJI 1JJ2Y 3S2HI 5C44I 4RVHA 3IFUA 3S15I 2NVQI 4A3LI 1P9NA 2OOYB 3CMAZ 5IT9f 1Q822 1KC82 4RVDA 1VQ6Z 1USPA 2OZKA 3CCSZ 2VUMI 4DK1A 1WW9A 3BG0B 3CCM1 3I55Z 2VPXA 4BXXI 3NH8A 3IR7A 5T64A 2Q4ZA 4BBSI 2EGTA 2OTJ1 2HU9A 1Q811 5T67A 3GTMI 3J81b 1YJ91 3J80b 2V8JA 1KRLA 3G4SZ 3F3FC 1YIJ1 2NVYI 3CCL1 1VQ41 3GTKI 1VQO1 2IZ4A 3CPWZ 1Q7Y1 4A3KI 3G6E1 3J80f 1K83I 1WJ2A 4NBCA 1VQLZ 2QEXZ 5A2Qb 3S16I 4DQYB 3CCRZ 2JUBA 1K732 2P28A 2QLVB 3VTNA 5C3EI 1N8R2 2GTIA 3U50C 2PMZA 4EWCA 5FLMI 3T4NB 5A2Qf 1QF8A 4A93I 4E2XA 3CCQ1 4E2YA 3MZLB 2JS4A 3S1QI 1YI2Z 4DGLA 4E31A 2JA7I 3D2LA 4A3MI 2M48A 2O53A 1YJN1 1S721 1X0TA 3S1NI 4A3BI 2JMOA 3LUSA 3H3VJ 4NBFA 1VQ7Z 3D6WA 1YUKA 2WAQA 1QVGY 2W03A 1FDIA 1JWHC 3CQZI 3GTQI 1PFTA 3ESWA 3CC41 2LFUA 1Q812 1RO0A 1I6HI 3CXCZ 3I561 3FKII 3CPWY 2JA5I 1TFIA 5IT9b 1YITZ 3FQQA 3GTLI 3CC2Z 3PO2I 1VQN1 3GTMS 3CCV1 4MH4A 1VQ5Z 2I3CA 1VQ8Z 4Y52I 2QR1B 3G711 2R93I 4MD7A 1K9M2 2K3RA 1VQK1 2QA41 4NBDA 4RVGA 3D9XA 2DE6A 4A3II 3CCJ1 1NP6A 3CD6Z 2NVXI 4NB9A 3CCS1 2OTL1 4E33A 3Q87A 3P5JB 4NB8A 2NAPA 1VQMZ 2JIMA 3VMIA 1S7MA 3QWUA 3I551 3S14I 3CME1 1TWCI 1KD11 3M4OI 1QVGZ 2RT9A 2K5RA 3CCMZ 5IP9I 4RV9A 1YHQZ 3GTGI 1VLAA 1DL6A 3I07A 3OW2Z 4AYBA 1QXFA 5FLXf 1Z03A 1I3QI 1Y1VS 2JA8I 4A3DI 1AA6A 4RVFA 1M901 4HH4A 1Q861 4BY7I 3BG1B 1YIJZ 3CXCY 2QREB 2F4MA 1VQOZ 2JIRA
chains in the Genus database with same CATH topology
2R6MA 3CC71 1LQLA 3G6EZ 3IF8A 1ZB9A 2R92I 3PO3I 3NH5A 2PK7A 1ZH1A 2G2KA 3IX0A 1WCMI 3KIHA 1Q821 3MZKB 5IP7I 3GTPI 3RZOI 3J7A4 2RHBA 3K7AI 3NFZA 2AKLA 3S1RI 4E30A 4QTUA 3CCQZ 3HOZI 3HOWI 1K8A1 3MONA 2RPRA 4NBGA 3RZDI 2RIQA 4NOZA 4Y7NI 4MXUA 2F4OA 1SFOI 1YJNZ 1L1OC 4E2ZA 1VQ71 4A3GI 4A3EI 1WIIA 1M1K1 1VQPZ 3OW2Y 1RQFA 1W2BZ 1KD12 1Z02A 1USPB 5C4XI 2B63I 2Q51A 2OOXB 1RO4A 1VQ91 4MD9A 3CC4Z 3CCE1 1R9TI 2E2JI 2BJOA 4HGYA 3CCU1 2JNYA 2R7ZI 1Q7Y2 3I56Z 4NFRA 4X6AI 2IZ3A 1YJWZ 4NH1C 1YUAA 3VMHA 5C4JI 1RNIA 4QTTA 3CMA1 4E32A 4NBEA 1VQNZ 1QYPA 3CCVZ 1I50I 1VQ61 3NDJA 3GTOI 3HKZA 3G71Z 3NH4A 3CD61 2M6NA 2WB1A 2V8IA 1VQKZ 2YU9I 2QA4Z 1VQM1 5FLXb 3CCJZ 1RO2A 1ZB8A 4HGZA 2QRDB 2VUGA 2W04A 2OTLZ 3VB9A 2DE7A 2QKDA 3PO3S 3H0GI 1KQSY 1YHQ1 1K8A2 3CMEZ 2OTJZ 3G4S1 4S1TA 3M3YI 1QVFZ 5LL6f 3KIFA 1X3ZA 4MD8A 2E9HA 1W2BY 1YJ9Z 3I4NI 1Z01A 5D1OB 1NJI1 3CCLZ 1VQL1 2QEX1 4TNUA 1M1K2 3F3PC 2JA6I 1VQ4Z 4A3JI 3HOVI 3TE5B 4A3FI 3FQMA 3CCR1 2RBLA 4MONA 2ZAEB 1NUIA 4BY1I 4BBRI 2LIYA 3J81f 1TWHI 3GCFA 1Y1WI 5CM2M 3HOUI 2YADA 3JAMb 2GU2A 1KC81 2E2HI 1JJ2Z 1K9M1 3S1MI 3CC7Z 1ML8A 1YI21 1TWFI 3VMGA 2GTHA 2V8KA 2HF1A 4RS4A 5D1PA 1X3WA 4NBHA 3JAMf 4NBBA 5AN9F 2P3YA 1Y1VI 1TWGI 5D1OA 1KQSZ 1S72Z 3TDHB 2O4HA 2KPIA 2NVTI 3I4MI 4E2WA 2PM9A 2KI7B 3S17I 2DE5A 3NDIA 2QRCB 1QVFY 1VQP1 1RLYA 4A3CI 2H85A 2E2II 4NBAA 1TWAI 3EERA 5T6BA 3S2DI 1YIT1 3GKQA 1K731 4MRIA 4XX2A 2VF1A 3CC21 1M902 3HOXI 1Q862 2JR6A 1N8R1 2Y0SA 1VQ9Z 1NJI2 1N2FA 4CL1A 1VQ51 1VQ81 3CCEZ 1YJW1 3HOYI 3CCUZ 2J6AA 3EEDA 3GTJI 1JJ2Y 3S2HI 5C44I 4RVHA 3IFUA 3S15I 2NVQI 4A3LI 1P9NA 2OOYB 3CMAZ 5IT9f 1Q822 1KC82 4RVDA 1VQ6Z 1USPA 2OZKA 3CCSZ 2VUMI 4DK1A 1WW9A 3BG0B 3CCM1 3I55Z 4BXXI 3NH8A 5T64A 2Q4ZA 4BBSI 2EGTA 2OTJ1 2HU9A 1Q811 5T67A 3GTMI 3J81b 1YJ91 3J80b 2V8JA 1KRLA 3G4SZ 3F3FC 1YIJ1 2NVYI 3CCL1 1VQ41 3GTKI 1VQO1 2IZ4A 3CPWZ 1Q7Y1 4A3KI 3J80f 3G6E1 1K83I 4NBCA 1VQLZ 2QEXZ 5A2Qb 3S16I 4DQYB 3CCRZ 2JUBA 1K732 2P28A 2QLVB 3VTNA 5C3EI 1N8R2 2GTIA 3U50C 2PMZA 4EWCA 5FLMI 3T4NB 5A2Qf 1QF8A 4A93I 4E2XA 3CCQ1 4E2YA 3MZLB 2JS4A 3S1QI 1YI2Z 4DGLA 4E31A 2JA7I 4A3MI 2M48A 2O53A 1YJN1 1S721 1X0TA 3S1NI 4A3BI 2JMOA 3LUSA 3H3VJ 4NBFA 1VQ7Z 3D6WA 1YUKA 2WAQA 1QVGY 2W03A 1JWHC 3CQZI 3GTQI 1PFTA 3ESWA 3CC41 2LFUA 1Q812 1RO0A 1I6HI 3CXCZ 3I561 3FKII 3CPWY 2JA5I 1TFIA 5IT9b 1YITZ 3FQQA 3GTLI 3CC2Z 3PO2I 1VQN1 3GTMS 3CCV1 4MH4A 1VQ5Z 2I3CA 1VQ8Z 4Y52I 2QR1B 3G711 2R93I 4MD7A 1K9M2 2K3RA 1VQK1 2QA41 4NBDA 4RVGA 3D9XA 2DE6A 4A3II 3CCJ1 1NP6A 3CD6Z 2NVXI 4NB9A 3CCS1 2OTL1 4E33A 3Q87A 3P5JB 4NB8A 1VQMZ 3VMIA 1S7MA 3QWUA 3I551 3S14I 3CME1 1TWCI 1KD11 3M4OI 1QVGZ 2RT9A 2K5RA 3CCMZ 5IP9I 4RV9A 1YHQZ 3GTGI 1VLAA 1DL6A 3I07A 3OW2Z 4AYBA 5FLXf 1Z03A 1I3QI 1Y1VS 2JA8I 4A3DI 4RVFA 1M901 4HH4A 1Q861 4BY7I 3BG1B 1YIJZ 3CXCY 2QREB 2F4MA 1VQOZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MON A;  3MON A;  1KRL A; 
#chains in the Genus database with same CATH topology
 2VPW A;  2R6M A;  3CC7 1;  1LQL A;  2V3V A;  3G6E Z;  3IF8 A;  1ZB9 A;  2R92 I;  3PO3 I;  3NH5 A;  2PK7 A;  1ZH1 A;  2G2K A;  3IX0 A;  1WCM I;  3KIH A;  1Q82 1;  3MZK B;  5IP7 I;  3GTP I;  3RZO I;  3J7A 4;  2RHB A;  3K7A I;  3NFZ A;  2AKL A;  3S1R I;  4E30 A;  4QTU A;  3CCQ Z;  3HOZ I;  3HOW I;  1K8A 1;  3MON A;  2RPR A;  4NBG A;  3RZD I;  2RIQ A;  4NOZ A;  4Y7N I;  4MXU A;  2E7Z A;  2F4O A;  1SFO I;  1Y8C A;  1YJN Z;  1L1O C;  4E2Z A;  2AYD A;  1VQ7 1;  4A3G I;  4A3E I;  1WII A;  1M1K 1;  1VQP Z;  3OW2 Y;  1RQF A;  1W2B Z;  1KD1 2;  1Z02 A;  1USP B;  5C4X I;  1FDO A;  2JIQ A;  2B63 I;  2Q51 A;  2OOX B;  1RO4 A;  1VQ9 1;  4MD9 A;  3CC4 Z;  3CCE 1;  1R9T I;  2E2J I;  1Q16 A;  2BJO A;  4HGY A;  3CCU 1;  2JNY A;  2R7Z I;  1Q7Y 2;  3I56 Z;  4NFR A;  4X6A I;  2IZ3 A;  1YJW Z;  4NH1 C;  1YUA A;  3VMH A;  5C4J I;  1RNI A;  4QTT A;  3CMA 1;  4E32 A;  4NBE A;  1VQN Z;  1QYP A;  3CCV Z;  1I50 I;  1VQ6 1;  2VPZ A;  3NDJ A;  3GTO I;  3HKZ A;  3G71 Z;  3NH4 A;  3CD6 1;  2M6N A;  2WB1 A;  2V8I A;  1VQK Z;  2YU9 I;  2QA4 Z;  1VQM 1;  2JIP A;  5FLX b;  3CCJ Z;  1RO2 A;  1ZB8 A;  4HGZ A;  2QRD B;  2VUG A;  2W04 A;  2OTL Z;  3VB9 A;  2DE7 A;  2QKD A;  3PO3 S;  3H0G I;  1KQS Y;  1YHQ 1;  1K8A 2;  3CME Z;  2OTJ Z;  3G4S 1;  2LEX A;  4S1T A;  3M3Y I;  1QVF Z;  5LL6 f;  3KIF A;  1X3Z A;  4MD8 A;  2E9H A;  1W2B Y;  1YJ9 Z;  3I4N I;  1Z01 A;  5D1O B;  1NJI 1;  3CCL Z;  1VQL 1;  2QEX 1;  4TNU A;  1M1K 2;  3F3P C;  2JA6 I;  1VQ4 Z;  4A3J I;  3HOV I;  3TE5 B;  4A3F I;  3FQM A;  3CCR 1;  2RBL A;  4MON A;  2ZAE B;  1NUI A;  4BY1 I;  4BBR I;  2LIY A;  3J81 f;  1TWH I;  3GCF A;  1Y1W I;  5CM2 M;  3HOU I;  2YAD A;  3JAM b;  2GU2 A;  1KC8 1;  2E2H I;  1JJ2 Z;  1K9M 1;  3S1M I;  3CC7 Z;  1ML8 A;  1YI2 1;  1TWF I;  3VMG A;  2GTH A;  2V8K A;  2HF1 A;  4RS4 A;  5D1P A;  1X3W A;  4NBH A;  3JAM f;  4NBB A;  5AN9 F;  2P3Y A;  1Y1V I;  1TWG I;  5D1O A;  1KQS Z;  1WZN A;  1S72 Z;  3TDH B;  2O4H A;  2KPI A;  2NVT I;  3I4M I;  4E2W A;  2PM9 A;  2KI7 B;  3S17 I;  2DE5 A;  3NDI A;  2QRC B;  1QVF Y;  1VQP 1;  1RLY A;  4A3C I;  2VPY A;  2H85 A;  2E2I I;  4NBA A;  1SIW A;  1TWA I;  3EER A;  5T6B A;  3S2D I;  2V45 A;  1YIT 1;  3GKQ A;  1K73 1;  4MRI A;  4XX2 A;  2VF1 A;  3CC2 1;  1M90 2;  3HOX I;  1Q86 2;  2JR6 A;  1N8R 1;  2Y0S A;  1VQ9 Z;  1NJI 2;  1N2F A;  4CL1 A;  1VQ5 1;  1VQ8 1;  3CCE Z;  1YJW 1;  2JIO A;  3HOY I;  3CCU Z;  2J6A A;  3EED A;  2IV2 X;  3GTJ I;  1JJ2 Y;  3S2H I;  5C44 I;  4RVH A;  3IFU A;  3S15 I;  2NVQ I;  4A3L I;  1P9N A;  2OOY B;  3CMA Z;  5IT9 f;  1Q82 2;  1KC8 2;  4RVD A;  1VQ6 Z;  1USP A;  2OZK A;  3CCS Z;  2VUM I;  4DK1 A;  1WW9 A;  3BG0 B;  3CCM 1;  3I55 Z;  2VPX A;  4BXX I;  3NH8 A;  3IR7 A;  5T64 A;  2Q4Z A;  4BBS I;  2EGT A;  2OTJ 1;  2HU9 A;  1Q81 1;  5T67 A;  3GTM I;  3J81 b;  1YJ9 1;  3J80 b;  2V8J A;  1KRL A;  3G4S Z;  3F3F C;  1YIJ 1;  2NVY I;  3CCL 1;  1VQ4 1;  3GTK I;  1VQO 1;  2IZ4 A;  3CPW Z;  1Q7Y 1;  4A3K I;  3G6E 1;  3J80 f;  1K83 I;  1WJ2 A;  4NBC A;  1VQL Z;  2QEX Z;  5A2Q b;  3S16 I;  4DQY B;  3CCR Z;  2JUB A;  1K73 2;  2P28 A;  2QLV B;  3VTN A;  5C3E I;  1N8R 2;  2GTI A;  3U50 C;  2PMZ A;  4EWC A;  5FLM I;  3T4N B;  5A2Q f;  1QF8 A;  4A93 I;  4E2X A;  3CCQ 1;  4E2Y A;  3MZL B;  2JS4 A;  3S1Q I;  1YI2 Z;  4DGL A;  4E31 A;  2JA7 I;  3D2L A;  4A3M I;  2M48 A;  2O53 A;  1YJN 1;  1S72 1;  1X0T A;  3S1N I;  4A3B I;  2JMO A;  3LUS A;  3H3V J;  4NBF A;  1VQ7 Z;  3D6W A;  1YUK A;  2WAQ A;  1QVG Y;  2W03 A;  1FDI A;  1JWH C;  3CQZ I;  3GTQ I;  1PFT A;  3ESW A;  3CC4 1;  2LFU A;  1Q81 2;  1RO0 A;  1I6H I;  3CXC Z;  3I56 1;  3FKI I;  3CPW Y;  2JA5 I;  1TFI A;  5IT9 b;  1YIT Z;  3FQQ A;  3GTL I;  3CC2 Z;  3PO2 I;  1VQN 1;  3GTM S;  3CCV 1;  4MH4 A;  1VQ5 Z;  2I3C A;  1VQ8 Z;  4Y52 I;  2QR1 B;  3G71 1;  2R93 I;  4MD7 A;  1K9M 2;  2K3R A;  1VQK 1;  2QA4 1;  4NBD A;  4RVG A;  3D9X A;  2DE6 A;  4A3I I;  3CCJ 1;  1NP6 A;  3CD6 Z;  2NVX I;  4NB9 A;  3CCS 1;  2OTL 1;  4E33 A;  3Q87 A;  3P5J B;  4NB8 A;  2NAP A;  1VQM Z;  2JIM A;  3VMI A;  1S7M A;  3QWU A;  3I55 1;  3S14 I;  3CME 1;  1TWC I;  1KD1 1;  3M4O I;  1QVG Z;  2RT9 A;  2K5R A;  3CCM Z;  5IP9 I;  4RV9 A;  1YHQ Z;  3GTG I;  1VLA A;  1DL6 A;  3I07 A;  3OW2 Z;  4AYB A;  1QXF A;  5FLX f;  1Z03 A;  1I3Q I;  1Y1V S;  2JA8 I;  4A3D I;  1AA6 A;  4RVF A;  1M90 1;  4HH4 A;  1Q86 1;  4BY7 I;  3BG1 B;  1YIJ Z;  3CXC Y;  2QRE B;  2F4M A;  1VQO Z;  2JIR A; 
#chains in the Genus database with same CATH homology
 2R6M A;  3CC7 1;  1LQL A;  3G6E Z;  3IF8 A;  1ZB9 A;  2R92 I;  3PO3 I;  3NH5 A;  2PK7 A;  1ZH1 A;  2G2K A;  3IX0 A;  1WCM I;  3KIH A;  1Q82 1;  3MZK B;  5IP7 I;  3GTP I;  3RZO I;  3J7A 4;  2RHB A;  3K7A I;  3NFZ A;  2AKL A;  3S1R I;  4E30 A;  4QTU A;  3CCQ Z;  3HOZ I;  3HOW I;  1K8A 1;  3MON A;  2RPR A;  4NBG A;  3RZD I;  2RIQ A;  4NOZ A;  4Y7N I;  4MXU A;  2F4O A;  1SFO I;  1YJN Z;  1L1O C;  4E2Z A;  1VQ7 1;  4A3G I;  4A3E I;  1WII A;  1M1K 1;  1VQP Z;  3OW2 Y;  1RQF A;  1W2B Z;  1KD1 2;  1Z02 A;  1USP B;  5C4X I;  2B63 I;  2Q51 A;  2OOX B;  1RO4 A;  1VQ9 1;  4MD9 A;  3CC4 Z;  3CCE 1;  1R9T I;  2E2J I;  2BJO A;  4HGY A;  3CCU 1;  2JNY A;  2R7Z I;  1Q7Y 2;  3I56 Z;  4NFR A;  4X6A I;  2IZ3 A;  1YJW Z;  4NH1 C;  1YUA A;  3VMH A;  5C4J I;  1RNI A;  4QTT A;  3CMA 1;  4E32 A;  4NBE A;  1VQN Z;  1QYP A;  3CCV Z;  1I50 I;  1VQ6 1;  3NDJ A;  3GTO I;  3HKZ A;  3G71 Z;  3NH4 A;  3CD6 1;  2M6N A;  2WB1 A;  2V8I A;  1VQK Z;  2YU9 I;  2QA4 Z;  1VQM 1;  5FLX b;  3CCJ Z;  1RO2 A;  1ZB8 A;  4HGZ A;  2QRD B;  2VUG A;  2W04 A;  2OTL Z;  3VB9 A;  2DE7 A;  2QKD A;  3PO3 S;  3H0G I;  1KQS Y;  1YHQ 1;  1K8A 2;  3CME Z;  2OTJ Z;  3G4S 1;  4S1T A;  3M3Y I;  1QVF Z;  5LL6 f;  3KIF A;  1X3Z A;  4MD8 A;  2E9H A;  1W2B Y;  1YJ9 Z;  3I4N I;  1Z01 A;  5D1O B;  1NJI 1;  3CCL Z;  1VQL 1;  2QEX 1;  4TNU A;  1M1K 2;  3F3P C;  2JA6 I;  1VQ4 Z;  4A3J I;  3HOV I;  3TE5 B;  4A3F I;  3FQM A;  3CCR 1;  2RBL A;  4MON A;  2ZAE B;  1NUI A;  4BY1 I;  4BBR I;  2LIY A;  3J81 f;  1TWH I;  3GCF A;  1Y1W I;  5CM2 M;  3HOU I;  2YAD A;  3JAM b;  2GU2 A;  1KC8 1;  2E2H I;  1JJ2 Z;  1K9M 1;  3S1M I;  3CC7 Z;  1ML8 A;  1YI2 1;  1TWF I;  3VMG A;  2GTH A;  2V8K A;  2HF1 A;  4RS4 A;  5D1P A;  1X3W A;  4NBH A;  3JAM f;  4NBB A;  5AN9 F;  2P3Y A;  1Y1V I;  1TWG I;  5D1O A;  1KQS Z;  1S72 Z;  3TDH B;  2O4H A;  2KPI A;  2NVT I;  3I4M I;  4E2W A;  2PM9 A;  2KI7 B;  3S17 I;  2DE5 A;  3NDI A;  2QRC B;  1QVF Y;  1VQP 1;  1RLY A;  4A3C I;  2H85 A;  2E2I I;  4NBA A;  1TWA I;  3EER A;  5T6B A;  3S2D I;  1YIT 1;  3GKQ A;  1K73 1;  4MRI A;  4XX2 A;  2VF1 A;  3CC2 1;  1M90 2;  3HOX I;  1Q86 2;  2JR6 A;  1N8R 1;  2Y0S A;  1VQ9 Z;  1NJI 2;  1N2F A;  4CL1 A;  1VQ5 1;  1VQ8 1;  3CCE Z;  1YJW 1;  3HOY I;  3CCU Z;  2J6A A;  3EED A;  3GTJ I;  1JJ2 Y;  3S2H I;  5C44 I;  4RVH A;  3IFU A;  3S15 I;  2NVQ I;  4A3L I;  1P9N A;  2OOY B;  3CMA Z;  5IT9 f;  1Q82 2;  1KC8 2;  4RVD A;  1VQ6 Z;  1USP A;  2OZK A;  3CCS Z;  2VUM I;  4DK1 A;  1WW9 A;  3BG0 B;  3CCM 1;  3I55 Z;  4BXX I;  3NH8 A;  5T64 A;  2Q4Z A;  4BBS I;  2EGT A;  2OTJ 1;  2HU9 A;  1Q81 1;  5T67 A;  3GTM I;  3J81 b;  1YJ9 1;  3J80 b;  2V8J A;  1KRL A;  3G4S Z;  3F3F C;  1YIJ 1;  2NVY I;  3CCL 1;  1VQ4 1;  3GTK I;  1VQO 1;  2IZ4 A;  3CPW Z;  1Q7Y 1;  4A3K I;  3J80 f;  3G6E 1;  1K83 I;  4NBC A;  1VQL Z;  2QEX Z;  5A2Q b;  3S16 I;  4DQY B;  3CCR Z;  2JUB A;  1K73 2;  2P28 A;  2QLV B;  3VTN A;  5C3E I;  1N8R 2;  2GTI A;  3U50 C;  2PMZ A;  4EWC A;  5FLM I;  3T4N B;  5A2Q f;  1QF8 A;  4A93 I;  4E2X A;  3CCQ 1;  4E2Y A;  3MZL B;  2JS4 A;  3S1Q I;  1YI2 Z;  4DGL A;  4E31 A;  2JA7 I;  4A3M I;  2M48 A;  2O53 A;  1YJN 1;  1S72 1;  1X0T A;  3S1N I;  4A3B I;  2JMO A;  3LUS A;  3H3V J;  4NBF A;  1VQ7 Z;  3D6W A;  1YUK A;  2WAQ A;  1QVG Y;  2W03 A;  1JWH C;  3CQZ I;  3GTQ I;  1PFT A;  3ESW A;  3CC4 1;  2LFU A;  1Q81 2;  1RO0 A;  1I6H I;  3CXC Z;  3I56 1;  3FKI I;  3CPW Y;  2JA5 I;  1TFI A;  5IT9 b;  1YIT Z;  3FQQ A;  3GTL I;  3CC2 Z;  3PO2 I;  1VQN 1;  3GTM S;  3CCV 1;  4MH4 A;  1VQ5 Z;  2I3C A;  1VQ8 Z;  4Y52 I;  2QR1 B;  3G71 1;  2R93 I;  4MD7 A;  1K9M 2;  2K3R A;  1VQK 1;  2QA4 1;  4NBD A;  4RVG A;  3D9X A;  2DE6 A;  4A3I I;  3CCJ 1;  1NP6 A;  3CD6 Z;  2NVX I;  4NB9 A;  3CCS 1;  2OTL 1;  4E33 A;  3Q87 A;  3P5J B;  4NB8 A;  1VQM Z;  3VMI A;  1S7M A;  3QWU A;  3I55 1;  3S14 I;  3CME 1;  1TWC I;  1KD1 1;  3M4O I;  1QVG Z;  2RT9 A;  2K5R A;  3CCM Z;  5IP9 I;  4RV9 A;  1YHQ Z;  3GTG I;  1VLA A;  1DL6 A;  3I07 A;  3OW2 Z;  4AYB A;  5FLX f;  1Z03 A;  1I3Q I;  1Y1V S;  2JA8 I;  4A3D I;  4RVF A;  1M90 1;  4HH4 A;  1Q86 1;  4BY7 I;  3BG1 B;  1YIJ Z;  3CXC Y;  2QRE B;  2F4M A;  1VQO Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...