3S16I

Rna polymerase ii initiation complex with an 8-nt rna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
total genus 13
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s16I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s16I02
1Y1VS 2HF1A 2K5RA 3I07A 1YUAA 4NBAA 3LUSA 4NBGA 2PK7A 3GTPI 3S15I 4NB9A 3VMIA 4A3EI 3GTKI 2AKLA 3RZOI 4A3GI 2J6AA 1TWGI 5FLMI 3M4OI 3HOXI 4A3BI 1K83I 5C44I 2JA5I 3CQZI 1R9TI 4Y7NI 1PFTA 4NBCA 3S17I 2DE7A 1Y1WI 4MH4A 1L1OC 1X3WA 3S16I 1ZB9A 3RZDI 1QYPA 1DL6A 5IP7I 4A3DI 3GTMS 4BBRI 3K7AI 5IP9I 1TWAI 1VLAA 4BY7I 3HOWI 3HOVI 1WW9A 3GTLI 1WCMI 2R92I 4NBBA 2YU9I 2RBLA 4NBHA 1ML8A 4NOZA 3S1NI 1X3ZA 5C4XI 3M3YI 2NVXI 3S14I 4A3LI 4NB8A 3H3VJ 1RO4A 2KPIA 3S2HI 2F4OA 3PO3I 2JA8I 3ESWA 4A3JI 4NBDA 3I4MI 2R93I 4X6AI 4BXXI 3HOYI 2VUMI 1TWCI 2JA6I 2NVQI 1ZB8A 3VB9A 3I4NI 1RLYA 4A93I 2BJOA 3HOZI 4A3KI 3GTJI 2R7ZI 1NUIA 2JR6A 2JA7I 3S1MI 2E2JI 3H0GI 5CM2M 5C3EI 4A3MI 3GTQI 3HOUI 1TFIA 3VMGA 3EERA 3Q87A 3S1QI 3FKII 2JNYA 3GCFA 2NVTI 2P3YA 3U50C 1TWHI 1SFOI 3GTMI 2DE6A 1Y1VI 2NVYI 1N2FA 4NBFA 4A3FI 3S1RI 4QTTA 4NBEA 1TWFI 2DE5A 3D6WA 1LQLA 2E2HI 3GTGI 2F4MA 2B63I 1I6HI 3S2DI 5C4JI 3VMHA 1I50I 1USPB 3PO3S 4Y52I 2E2II 2JS4A 4XX2A 4A3II 3PO2I 3GTOI 1I3QI 1USPA 4BBSI 3GKQA 4A3CI 4BY1I 4QTUA
chains in the Genus database with same CATH superfamily
1Y1VS 3I07A 1WZNA 2JIQA 2QEXZ 3LUSA 2PK7A 3S15I 3VMIA 3RZOI 2AKLA 2J6AA 3VTNA 1K731 1VQ61 1VQK1 2JA5I 3CQZI 1R9TI 4E2WA 4MH4A 1VQ81 1M1K1 1X3WA 3S16I 3RZDI 1Q821 1RNIA 3G4S1 2RPRA 3GTMS 2VF1A 3K7AI 1TWAI 3HOWI 3HOVI 2WB1A 3GTLI 1N8R2 3BG0B 3J81f 1KC82 4RV9A 4A3LI 4RVGA 1RO4A 3J81b 3PO3I 3CCVZ 4NBDA 2R93I 1WIIA 5T64A 2YADA 1VQ4Z 1TWCI 3KIFA 2Y0SA 3CCEZ 3CCR1 1S72Z 3I4NI 4A93I 2QREB 3HOZI 4E33A 2QLVB 4E32A 3GTJI 2JA7I 2GTHA 3NDJA 3G711 3H0GI 3CCV1 1TFIA 3Q87A 1QVFY 3CD61 1VQ71 1TWHI 1VQ41 2R6MA 1RO2A 4EWCA 1W2BZ 1QVGZ 1N2FA 2OOXB 1VQPZ 5T67A 1TWFI 2DE5A 4AYBA 4DQYB 3NH5A 1VQ5Z 3S2DI 5C4JI 4DGLA 3CC7Z 2I3CA 1KRLA 2QRDB 3CCJ1 3GTOI 4A3CI 4CL1A 1W2BY 4E2YA 3CMAZ 1VQ91 1KD11 1YUAA 4NBAA 3I561 3F3FC 4A3GI 3BG1B 1VQ51 3OW2Y 1TWGI 5FLMI 3M4OI 5C44I 1YI2Z 3J80f 2QRCB 1M902 1PFTA 3CC71 1Y1WI 2O53A 3J80b 2JIPA 1QYPA 3CC41 3CCQ1 2E9HA 2LIYA 2JIOA 1K8A2 1VQMZ 1WW9A 2VUGA 1VQLZ 2R92I 4NBBA 2JIRA 2RBLA 1YI21 1YUKA 4NOZA 1X3ZA 3CCM1 1QF8A 3S14I 2QKDA 4NB8A 1K732 4MONA 1Q861 2JA8I 3ESWA 4HGZA 1VQO1 4X6AI 4BXXI 2RT9A 2JA6I 1VQM1 2QEX1 1M1K2 1Q822 4RVDA 3CCLZ 2BJOA 4A3KI 2R7ZI 2JR6A 3S1MI 1Z01A 4MD8A 3EERA 3GCFA 2P3YA 1QVFZ 3GTMI 2DE6A 4MD9A 3KIHA 2NVYI 4A3FI 3CCL1 2QA4Z 2E2HI 3FQQA 3MZKB 2E7ZA 2Q51A 1I6HI 2V45A 3D9XA 2IZ3A 1I50I 2OTLZ 1YJNZ 4Y52I 2E2II 1YJ9Z 2JS4A 4RVHA 4A3II 4E2XA 3CC2Z 3GKQA 2JUBA 3I55Z 4BY1I 4QTUA 1Z02A 1ZH1A 4HGYA 1Q811 4NBGA 3CCE1 2QA41 4A3EI 1S721 3GTKI 1K83I 3OW2Z 4NH1C 3HKZA 1YITZ 2RIQA 4Y7NI 4NBCA 2VPXA 1YJN1 1Q7Y1 1L1OC 1YJ91 1NP6A 2OZKA 1ZB9A 3NDIA 1DL6A 3CC21 3IX0A 2WAQA 5IP7I 3IFUA 3IR7A 1NJI1 4S1TA 5IP9I 4BY7I 4MXUA 2VPWA 1VQP1 1K9M1 1KQSZ 2YU9I 1JWHC 2QR1B 1ML8A 3S1NI 2V3VA 2AYDA 2M48A 5C4XI 3M3YI 1KD12 2NVXI 3S2HI 2F4OA 4A3JI 3CXCZ 3P5JB 1X0TA 3I4MI 2K3RA 3JAMf 1M901 3CCSZ 2NVQI 3CMA1 2H85A 3NH8A 5D1PA 3JAMb 1KQSY 3VB9A 1RLYA 1VQ6Z 1VQKZ 2PMZA 1VQNZ 1NUIA 2P28A 2IZ4A 1RQFA 3IF8A 5CM2M 3GTQI 4A3MI 3CXCY 3VMGA 3S1QI 2VPZA 3FKII 3CPWY 3G4SZ 1YJWZ 4E30A 3CCS1 3U50C 5IT9f 3CCUZ 4E2ZA 1SFOI 4NFRA 2ZAEB 1Y1VI 3S1RI 1FDOA 2V8IA 2VPYA 5IT9b 2O4HA 4NBEA 1Q862 1VQL1 2NAPA 3GTGI 2F4MA 1VQN1 5D1OB 3PO3S 1YJW1 1N8R1 4XX2A 5D1OA 2PM9A 3G6EZ 1I3QI 3MZLB 3CCU1 4BBSI 3TE5B 2G2KA 2HF1A 2K5RA 3QWUA 1KC81 1YHQZ 5FLXf 4MRIA 4E31A 3GTPI 3NFZA 3CCRZ 4NB9A 2W04A 5FLXb 3HOXI 4A3BI 4HH4A 3S17I 4MD7A 4TNUA 2DE7A 3G71Z 1WJ2A 2OOYB 3CMEZ 2OTJZ 3G6E1 3CD6Z 1VQ7Z 4A3DI 4RS4A 4BBRI 1YHQ1 1VLAA 1P9NA 3EEDA 1Z03A 1QXFA 5T6BA 1WCMI 2RHBA 4NBHA 3TDHB 5AN9F 2EGTA 1Q812 2IV2X 1FDIA 2OTL1 2V8JA 3CME1 3H3VJ 2KPIA 2OTJ1 3CCJZ 1Y8CA 1RO0A 3I551 1YIJZ 3HOYI 2V8KA 3MONA 1JJ2Z 2VUMI 2LEXA 1Q16A 2HU9A 2M6NA 3D2LA 1Q7Y2 1VQ9Z 1ZB8A 3I56Z 3T4NB 5LL6f 1NJI2 1YIT1 2JMOA 2E2JI 2JIMA 2GU2A 3F3PC 5C3EI 1K9M2 3HOUI 1AA6A 3NH4A 2LFUA 4DK1A 3CC4Z 2JNYA 2GTIA 2NVTI 1YIJ1 1JJ2Y 1QVGY 3CCQZ 3J7A4 2KI7B 3CPWZ 4NBFA 1S7MA 4QTTA 2Q4ZA 3D6WA 1LQLA 3FQMA 2B63I 5A2Qf 3CCMZ 3VMHA 1K8A1 1USPB 1VQ8Z 5A2Qb 2W03A 3PO2I 1SIWA 1VQOZ 1USPA 4RVFA
chains in the Genus database with same CATH topology
1Y1VS 3I07A 2QEXZ 3LUSA 2PK7A 3S15I 3VMIA 3RZOI 2AKLA 2J6AA 3VTNA 1K731 1VQ61 1VQK1 2JA5I 3CQZI 1R9TI 4E2WA 4MH4A 1VQ81 1M1K1 1X3WA 3S16I 3RZDI 1Q821 1RNIA 3G4S1 2RPRA 3GTMS 2VF1A 3K7AI 1TWAI 3HOWI 3HOVI 2WB1A 3GTLI 1N8R2 3BG0B 3J81f 1KC82 4RV9A 4A3LI 4RVGA 1RO4A 3J81b 3PO3I 3CCVZ 4NBDA 2R93I 1WIIA 5T64A 2YADA 1VQ4Z 1TWCI 3KIFA 2Y0SA 3CCEZ 3CCR1 1S72Z 3I4NI 4A93I 2QREB 3HOZI 4E33A 2QLVB 4E32A 3GTJI 2JA7I 2GTHA 3NDJA 3G711 3H0GI 3CCV1 1TFIA 3Q87A 1QVFY 3CD61 1VQ71 1TWHI 1VQ41 2R6MA 1RO2A 4EWCA 1W2BZ 1QVGZ 1N2FA 2OOXB 1VQPZ 5T67A 1TWFI 2DE5A 4AYBA 4DQYB 3NH5A 1VQ5Z 3S2DI 5C4JI 4DGLA 3CC7Z 2I3CA 1KRLA 2QRDB 3CCJ1 3GTOI 4A3CI 4CL1A 1W2BY 4E2YA 3CMAZ 1VQ91 1KD11 1YUAA 4NBAA 3I561 3F3FC 4A3GI 3BG1B 1VQ51 3OW2Y 1TWGI 5FLMI 3M4OI 5C44I 1YI2Z 3J80f 2QRCB 1M902 1PFTA 3CC71 1Y1WI 2O53A 3J80b 1QYPA 3CC41 3CCQ1 2E9HA 2LIYA 1K8A2 1VQMZ 1WW9A 2VUGA 1VQLZ 2R92I 4NBBA 2RBLA 1YI21 1YUKA 4NOZA 1X3ZA 3CCM1 1QF8A 3S14I 2QKDA 4NB8A 1K732 4MONA 1Q861 2JA8I 3ESWA 4HGZA 1VQO1 4X6AI 4BXXI 2RT9A 2JA6I 1VQM1 2QEX1 1M1K2 1Q822 4RVDA 3CCLZ 2BJOA 4A3KI 2R7ZI 2JR6A 3S1MI 1Z01A 4MD8A 3EERA 3GCFA 2P3YA 1QVFZ 3GTMI 2DE6A 4MD9A 3KIHA 2NVYI 4A3FI 3CCL1 2QA4Z 2E2HI 3FQQA 3MZKB 2Q51A 1I6HI 3D9XA 2IZ3A 1I50I 2OTLZ 1YJNZ 4Y52I 2E2II 1YJ9Z 2JS4A 4RVHA 4A3II 4E2XA 3CC2Z 3GKQA 2JUBA 3I55Z 4BY1I 4QTUA 1Z02A 1ZH1A 4HGYA 1Q811 4NBGA 3CCE1 2QA41 4A3EI 1S721 3GTKI 1K83I 3OW2Z 4NH1C 3HKZA 1YITZ 2RIQA 4Y7NI 4NBCA 1YJN1 1Q7Y1 1L1OC 1YJ91 1NP6A 2OZKA 1ZB9A 3NDIA 1DL6A 3CC21 3IX0A 2WAQA 5IP7I 3IFUA 1NJI1 4S1TA 5IP9I 4BY7I 4MXUA 1VQP1 1K9M1 1KQSZ 2YU9I 1JWHC 2QR1B 1ML8A 3S1NI 2M48A 5C4XI 3M3YI 1KD12 2NVXI 3S2HI 2F4OA 4A3JI 3CXCZ 3P5JB 1X0TA 3I4MI 2K3RA 3JAMf 1M901 3CCSZ 2NVQI 3CMA1 2H85A 3NH8A 5D1PA 3JAMb 1KQSY 3VB9A 1RLYA 1VQ6Z 1VQKZ 2PMZA 1VQNZ 1NUIA 2P28A 2IZ4A 1RQFA 3IF8A 5CM2M 3GTQI 4A3MI 3CXCY 3VMGA 3S1QI 3FKII 3CPWY 3G4SZ 1YJWZ 4E30A 3CCS1 3U50C 5IT9f 3CCUZ 4E2ZA 1SFOI 4NFRA 2ZAEB 1Y1VI 3S1RI 2V8IA 5IT9b 2O4HA 4NBEA 1Q862 1VQL1 3GTGI 2F4MA 1VQN1 5D1OB 3PO3S 1YJW1 1N8R1 4XX2A 5D1OA 2PM9A 3G6EZ 1I3QI 3MZLB 3CCU1 4BBSI 3TE5B 2G2KA 2HF1A 2K5RA 3QWUA 1KC81 1YHQZ 5FLXf 4MRIA 4E31A 3GTPI 3NFZA 3CCRZ 4NB9A 2W04A 5FLXb 3HOXI 4A3BI 4HH4A 3S17I 4MD7A 4TNUA 2DE7A 3G71Z 2OOYB 3CMEZ 2OTJZ 3G6E1 3CD6Z 1VQ7Z 4A3DI 4RS4A 4BBRI 1YHQ1 1VLAA 1P9NA 3EEDA 1Z03A 5T6BA 1WCMI 2RHBA 4NBHA 3TDHB 5AN9F 2EGTA 1Q812 2OTL1 2V8JA 3CME1 3H3VJ 2KPIA 2OTJ1 3CCJZ 1RO0A 3I551 1YIJZ 3HOYI 2V8KA 3MONA 1JJ2Z 2VUMI 2HU9A 2M6NA 1Q7Y2 1VQ9Z 1ZB8A 3I56Z 3T4NB 5LL6f 1NJI2 1YIT1 2JMOA 2E2JI 2GU2A 3F3PC 5C3EI 1K9M2 3HOUI 3NH4A 2LFUA 4DK1A 3CC4Z 2JNYA 2GTIA 2NVTI 1YIJ1 1JJ2Y 1QVGY 3CCQZ 3J7A4 2KI7B 3CPWZ 4NBFA 1S7MA 4QTTA 2Q4ZA 3D6WA 1LQLA 3FQMA 2B63I 5A2Qf 3CCMZ 3VMHA 1K8A1 1USPB 1VQ8Z 5A2Qb 2W03A 3PO2I 1VQOZ 1USPA 4RVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1V S;  2HF1 A;  2K5R A;  3I07 A;  1YUA A;  4NBA A;  3LUS A;  4NBG A;  2PK7 A;  3GTP I;  3S15 I;  4NB9 A;  3VMI A;  4A3E I;  3GTK I;  2AKL A;  3RZO I;  4A3G I;  2J6A A;  1TWG I;  5FLM I;  3M4O I;  3HOX I;  4A3B I;  1K83 I;  5C44 I;  2JA5 I;  3CQZ I;  1R9T I;  4Y7N I;  1PFT A;  4NBC A;  3S17 I;  2DE7 A;  1Y1W I;  4MH4 A;  1L1O C;  1X3W A;  3S16 I;  1ZB9 A;  3RZD I;  1QYP A;  1DL6 A;  5IP7 I;  4A3D I;  3GTM S;  4BBR I;  3K7A I;  5IP9 I;  1TWA I;  1VLA A;  4BY7 I;  3HOW I;  3HOV I;  1WW9 A;  3GTL I;  1WCM I;  2R92 I;  4NBB A;  2YU9 I;  2RBL A;  4NBH A;  1ML8 A;  4NOZ A;  3S1N I;  1X3Z A;  5C4X I;  3M3Y I;  2NVX I;  3S14 I;  4A3L I;  4NB8 A;  3H3V J;  1RO4 A;  2KPI A;  3S2H I;  2F4O A;  3PO3 I;  2JA8 I;  3ESW A;  4A3J I;  4NBD A;  3I4M I;  2R93 I;  4X6A I;  4BXX I;  3HOY I;  2VUM I;  1TWC I;  2JA6 I;  2NVQ I;  1ZB8 A;  3VB9 A;  3I4N I;  1RLY A;  4A93 I;  2BJO A;  3HOZ I;  4A3K I;  3GTJ I;  2R7Z I;  1NUI A;  2JR6 A;  2JA7 I;  3S1M I;  2E2J I;  3H0G I;  5CM2 M;  5C3E I;  4A3M I;  3GTQ I;  3HOU I;  1TFI A;  3VMG A;  3EER A;  3Q87 A;  3S1Q I;  3FKI I;  2JNY A;  3GCF A;  2NVT I;  2P3Y A;  3U50 C;  1TWH I;  1SFO I;  3GTM I;  2DE6 A;  1Y1V I;  2NVY I;  1N2F A;  4NBF A;  4A3F I;  3S1R I;  4QTT A;  4NBE A;  1TWF I;  2DE5 A;  3D6W A;  1LQL A;  2E2H I;  3GTG I;  2F4M A;  2B63 I;  1I6H I;  3S2D I;  5C4J I;  3VMH A;  1I50 I;  1USP B;  3PO3 S;  4Y52 I;  2E2I I;  2JS4 A;  4XX2 A;  4A3I I;  3PO2 I;  3GTO I;  1I3Q I;  1USP A;  4BBS I;  3GKQ A;  4A3C I;  4BY1 I;  4QTU A; 
#chains in the Genus database with same CATH topology
 1Y1V S;  3I07 A;  1WZN A;  2JIQ A;  2QEX Z;  3LUS A;  2PK7 A;  3S15 I;  3VMI A;  3RZO I;  2AKL A;  2J6A A;  3VTN A;  1K73 1;  1VQ6 1;  1VQK 1;  2JA5 I;  3CQZ I;  1R9T I;  4E2W A;  4MH4 A;  1VQ8 1;  1M1K 1;  1X3W A;  3S16 I;  3RZD I;  1Q82 1;  1RNI A;  3G4S 1;  2RPR A;  3GTM S;  2VF1 A;  3K7A I;  1TWA I;  3HOW I;  3HOV I;  2WB1 A;  3GTL I;  1N8R 2;  3BG0 B;  3J81 f;  1KC8 2;  4RV9 A;  4A3L I;  4RVG A;  1RO4 A;  3J81 b;  3PO3 I;  3CCV Z;  4NBD A;  2R93 I;  1WII A;  5T64 A;  2YAD A;  1VQ4 Z;  1TWC I;  3KIF A;  2Y0S A;  3CCE Z;  3CCR 1;  1S72 Z;  3I4N I;  4A93 I;  2QRE B;  3HOZ I;  4E33 A;  2QLV B;  4E32 A;  3GTJ I;  2JA7 I;  2GTH A;  3NDJ A;  3G71 1;  3H0G I;  3CCV 1;  1TFI A;  3Q87 A;  1QVF Y;  3CD6 1;  1VQ7 1;  1TWH I;  1VQ4 1;  2R6M A;  1RO2 A;  4EWC A;  1W2B Z;  1QVG Z;  1N2F A;  2OOX B;  1VQP Z;  5T67 A;  1TWF I;  2DE5 A;  4AYB A;  4DQY B;  3NH5 A;  1VQ5 Z;  3S2D I;  5C4J I;  4DGL A;  3CC7 Z;  2I3C A;  1KRL A;  2QRD B;  3CCJ 1;  3GTO I;  4A3C I;  4CL1 A;  1W2B Y;  4E2Y A;  3CMA Z;  1VQ9 1;  1KD1 1;  1YUA A;  4NBA A;  3I56 1;  3F3F C;  4A3G I;  3BG1 B;  1VQ5 1;  3OW2 Y;  1TWG I;  5FLM I;  3M4O I;  5C44 I;  1YI2 Z;  3J80 f;  2QRC B;  1M90 2;  1PFT A;  3CC7 1;  1Y1W I;  2O53 A;  3J80 b;  2JIP A;  1QYP A;  3CC4 1;  3CCQ 1;  2E9H A;  2LIY A;  2JIO A;  1K8A 2;  1VQM Z;  1WW9 A;  2VUG A;  1VQL Z;  2R92 I;  4NBB A;  2JIR A;  2RBL A;  1YI2 1;  1YUK A;  4NOZ A;  1X3Z A;  3CCM 1;  1QF8 A;  3S14 I;  2QKD A;  4NB8 A;  1K73 2;  4MON A;  1Q86 1;  2JA8 I;  3ESW A;  4HGZ A;  1VQO 1;  4X6A I;  4BXX I;  2RT9 A;  2JA6 I;  1VQM 1;  2QEX 1;  1M1K 2;  1Q82 2;  4RVD A;  3CCL Z;  2BJO A;  4A3K I;  2R7Z I;  2JR6 A;  3S1M I;  1Z01 A;  4MD8 A;  3EER A;  3GCF A;  2P3Y A;  1QVF Z;  3GTM I;  2DE6 A;  4MD9 A;  3KIH A;  2NVY I;  4A3F I;  3CCL 1;  2QA4 Z;  2E2H I;  3FQQ A;  3MZK B;  2E7Z A;  2Q51 A;  1I6H I;  2V45 A;  3D9X A;  2IZ3 A;  1I50 I;  2OTL Z;  1YJN Z;  4Y52 I;  2E2I I;  1YJ9 Z;  2JS4 A;  4RVH A;  4A3I I;  4E2X A;  3CC2 Z;  3GKQ A;  2JUB A;  3I55 Z;  4BY1 I;  4QTU A;  1Z02 A;  1ZH1 A;  4HGY A;  1Q81 1;  4NBG A;  3CCE 1;  2QA4 1;  4A3E I;  1S72 1;  3GTK I;  1K83 I;  3OW2 Z;  4NH1 C;  3HKZ A;  1YIT Z;  2RIQ A;  4Y7N I;  4NBC A;  2VPX A;  1YJN 1;  1Q7Y 1;  1L1O C;  1YJ9 1;  1NP6 A;  2OZK A;  1ZB9 A;  3NDI A;  1DL6 A;  3CC2 1;  3IX0 A;  2WAQ A;  5IP7 I;  3IFU A;  3IR7 A;  1NJI 1;  4S1T A;  5IP9 I;  4BY7 I;  4MXU A;  2VPW A;  1VQP 1;  1K9M 1;  1KQS Z;  2YU9 I;  1JWH C;  2QR1 B;  1ML8 A;  3S1N I;  2V3V A;  2AYD A;  2M48 A;  5C4X I;  3M3Y I;  1KD1 2;  2NVX I;  3S2H I;  2F4O A;  4A3J I;  3CXC Z;  3P5J B;  1X0T A;  3I4M I;  2K3R A;  3JAM f;  1M90 1;  3CCS Z;  2NVQ I;  3CMA 1;  2H85 A;  3NH8 A;  5D1P A;  3JAM b;  1KQS Y;  3VB9 A;  1RLY A;  1VQ6 Z;  1VQK Z;  2PMZ A;  1VQN Z;  1NUI A;  2P28 A;  2IZ4 A;  1RQF A;  3IF8 A;  5CM2 M;  3GTQ I;  4A3M I;  3CXC Y;  3VMG A;  3S1Q I;  2VPZ A;  3FKI I;  3CPW Y;  3G4S Z;  1YJW Z;  4E30 A;  3CCS 1;  3U50 C;  5IT9 f;  3CCU Z;  4E2Z A;  1SFO I;  4NFR A;  2ZAE B;  1Y1V I;  3S1R I;  1FDO A;  2V8I A;  2VPY A;  5IT9 b;  2O4H A;  4NBE A;  1Q86 2;  1VQL 1;  2NAP A;  3GTG I;  2F4M A;  1VQN 1;  5D1O B;  3PO3 S;  1YJW 1;  1N8R 1;  4XX2 A;  5D1O A;  2PM9 A;  3G6E Z;  1I3Q I;  3MZL B;  3CCU 1;  4BBS I;  3TE5 B;  2G2K A;  2HF1 A;  2K5R A;  3QWU A;  1KC8 1;  1YHQ Z;  5FLX f;  4MRI A;  4E31 A;  3GTP I;  3NFZ A;  3CCR Z;  4NB9 A;  2W04 A;  5FLX b;  3HOX I;  4A3B I;  4HH4 A;  3S17 I;  4MD7 A;  4TNU A;  2DE7 A;  3G71 Z;  1WJ2 A;  2OOY B;  3CME Z;  2OTJ Z;  3G6E 1;  3CD6 Z;  1VQ7 Z;  4A3D I;  4RS4 A;  4BBR I;  1YHQ 1;  1VLA A;  1P9N A;  3EED A;  1Z03 A;  1QXF A;  5T6B A;  1WCM I;  2RHB A;  4NBH A;  3TDH B;  5AN9 F;  2EGT A;  1Q81 2;  2IV2 X;  1FDI A;  2OTL 1;  2V8J A;  3CME 1;  3H3V J;  2KPI A;  2OTJ 1;  3CCJ Z;  1Y8C A;  1RO0 A;  3I55 1;  1YIJ Z;  3HOY I;  2V8K A;  3MON A;  1JJ2 Z;  2VUM I;  2LEX A;  1Q16 A;  2HU9 A;  2M6N A;  3D2L A;  1Q7Y 2;  1VQ9 Z;  1ZB8 A;  3I56 Z;  3T4N B;  5LL6 f;  1NJI 2;  1YIT 1;  2JMO A;  2E2J I;  2JIM A;  2GU2 A;  3F3P C;  5C3E I;  1K9M 2;  3HOU I;  1AA6 A;  3NH4 A;  2LFU A;  4DK1 A;  3CC4 Z;  2JNY A;  2GTI A;  2NVT I;  1YIJ 1;  1JJ2 Y;  1QVG Y;  3CCQ Z;  3J7A 4;  2KI7 B;  3CPW Z;  4NBF A;  1S7M A;  4QTT A;  2Q4Z A;  3D6W A;  1LQL A;  3FQM A;  2B63 I;  5A2Q f;  3CCM Z;  3VMH A;  1K8A 1;  1USP B;  1VQ8 Z;  5A2Q b;  2W03 A;  3PO2 I;  1SIW A;  1VQO Z;  1USP A;  4RVF A; 
#chains in the Genus database with same CATH homology
 1Y1V S;  3I07 A;  2QEX Z;  3LUS A;  2PK7 A;  3S15 I;  3VMI A;  3RZO I;  2AKL A;  2J6A A;  3VTN A;  1K73 1;  1VQ6 1;  1VQK 1;  2JA5 I;  3CQZ I;  1R9T I;  4E2W A;  4MH4 A;  1VQ8 1;  1M1K 1;  1X3W A;  3S16 I;  3RZD I;  1Q82 1;  1RNI A;  3G4S 1;  2RPR A;  3GTM S;  2VF1 A;  3K7A I;  1TWA I;  3HOW I;  3HOV I;  2WB1 A;  3GTL I;  1N8R 2;  3BG0 B;  3J81 f;  1KC8 2;  4RV9 A;  4A3L I;  4RVG A;  1RO4 A;  3J81 b;  3PO3 I;  3CCV Z;  4NBD A;  2R93 I;  1WII A;  5T64 A;  2YAD A;  1VQ4 Z;  1TWC I;  3KIF A;  2Y0S A;  3CCE Z;  3CCR 1;  1S72 Z;  3I4N I;  4A93 I;  2QRE B;  3HOZ I;  4E33 A;  2QLV B;  4E32 A;  3GTJ I;  2JA7 I;  2GTH A;  3NDJ A;  3G71 1;  3H0G I;  3CCV 1;  1TFI A;  3Q87 A;  1QVF Y;  3CD6 1;  1VQ7 1;  1TWH I;  1VQ4 1;  2R6M A;  1RO2 A;  4EWC A;  1W2B Z;  1QVG Z;  1N2F A;  2OOX B;  1VQP Z;  5T67 A;  1TWF I;  2DE5 A;  4AYB A;  4DQY B;  3NH5 A;  1VQ5 Z;  3S2D I;  5C4J I;  4DGL A;  3CC7 Z;  2I3C A;  1KRL A;  2QRD B;  3CCJ 1;  3GTO I;  4A3C I;  4CL1 A;  1W2B Y;  4E2Y A;  3CMA Z;  1VQ9 1;  1KD1 1;  1YUA A;  4NBA A;  3I56 1;  3F3F C;  4A3G I;  3BG1 B;  1VQ5 1;  3OW2 Y;  1TWG I;  5FLM I;  3M4O I;  5C44 I;  1YI2 Z;  3J80 f;  2QRC B;  1M90 2;  1PFT A;  3CC7 1;  1Y1W I;  2O53 A;  3J80 b;  1QYP A;  3CC4 1;  3CCQ 1;  2E9H A;  2LIY A;  1K8A 2;  1VQM Z;  1WW9 A;  2VUG A;  1VQL Z;  2R92 I;  4NBB A;  2RBL A;  1YI2 1;  1YUK A;  4NOZ A;  1X3Z A;  3CCM 1;  1QF8 A;  3S14 I;  2QKD A;  4NB8 A;  1K73 2;  4MON A;  1Q86 1;  2JA8 I;  3ESW A;  4HGZ A;  1VQO 1;  4X6A I;  4BXX I;  2RT9 A;  2JA6 I;  1VQM 1;  2QEX 1;  1M1K 2;  1Q82 2;  4RVD A;  3CCL Z;  2BJO A;  4A3K I;  2R7Z I;  2JR6 A;  3S1M I;  1Z01 A;  4MD8 A;  3EER A;  3GCF A;  2P3Y A;  1QVF Z;  3GTM I;  2DE6 A;  4MD9 A;  3KIH A;  2NVY I;  4A3F I;  3CCL 1;  2QA4 Z;  2E2H I;  3FQQ A;  3MZK B;  2Q51 A;  1I6H I;  3D9X A;  2IZ3 A;  1I50 I;  2OTL Z;  1YJN Z;  4Y52 I;  2E2I I;  1YJ9 Z;  2JS4 A;  4RVH A;  4A3I I;  4E2X A;  3CC2 Z;  3GKQ A;  2JUB A;  3I55 Z;  4BY1 I;  4QTU A;  1Z02 A;  1ZH1 A;  4HGY A;  1Q81 1;  4NBG A;  3CCE 1;  2QA4 1;  4A3E I;  1S72 1;  3GTK I;  1K83 I;  3OW2 Z;  4NH1 C;  3HKZ A;  1YIT Z;  2RIQ A;  4Y7N I;  4NBC A;  1YJN 1;  1Q7Y 1;  1L1O C;  1YJ9 1;  1NP6 A;  2OZK A;  1ZB9 A;  3NDI A;  1DL6 A;  3CC2 1;  3IX0 A;  2WAQ A;  5IP7 I;  3IFU A;  1NJI 1;  4S1T A;  5IP9 I;  4BY7 I;  4MXU A;  1VQP 1;  1K9M 1;  1KQS Z;  2YU9 I;  1JWH C;  2QR1 B;  1ML8 A;  3S1N I;  2M48 A;  5C4X I;  3M3Y I;  1KD1 2;  2NVX I;  3S2H I;  2F4O A;  4A3J I;  3CXC Z;  3P5J B;  1X0T A;  3I4M I;  2K3R A;  3JAM f;  1M90 1;  3CCS Z;  2NVQ I;  3CMA 1;  2H85 A;  3NH8 A;  5D1P A;  3JAM b;  1KQS Y;  3VB9 A;  1RLY A;  1VQ6 Z;  1VQK Z;  2PMZ A;  1VQN Z;  1NUI A;  2P28 A;  2IZ4 A;  1RQF A;  3IF8 A;  5CM2 M;  3GTQ I;  4A3M I;  3CXC Y;  3VMG A;  3S1Q I;  3FKI I;  3CPW Y;  3G4S Z;  1YJW Z;  4E30 A;  3CCS 1;  3U50 C;  5IT9 f;  3CCU Z;  4E2Z A;  1SFO I;  4NFR A;  2ZAE B;  1Y1V I;  3S1R I;  2V8I A;  5IT9 b;  2O4H A;  4NBE A;  1Q86 2;  1VQL 1;  3GTG I;  2F4M A;  1VQN 1;  5D1O B;  3PO3 S;  1YJW 1;  1N8R 1;  4XX2 A;  5D1O A;  2PM9 A;  3G6E Z;  1I3Q I;  3MZL B;  3CCU 1;  4BBS I;  3TE5 B;  2G2K A;  2HF1 A;  2K5R A;  3QWU A;  1KC8 1;  1YHQ Z;  5FLX f;  4MRI A;  4E31 A;  3GTP I;  3NFZ A;  3CCR Z;  4NB9 A;  2W04 A;  5FLX b;  3HOX I;  4A3B I;  4HH4 A;  3S17 I;  4MD7 A;  4TNU A;  2DE7 A;  3G71 Z;  2OOY B;  3CME Z;  2OTJ Z;  3G6E 1;  3CD6 Z;  1VQ7 Z;  4A3D I;  4RS4 A;  4BBR I;  1YHQ 1;  1VLA A;  1P9N A;  3EED A;  1Z03 A;  5T6B A;  1WCM I;  2RHB A;  4NBH A;  3TDH B;  5AN9 F;  2EGT A;  1Q81 2;  2OTL 1;  2V8J A;  3CME 1;  3H3V J;  2KPI A;  2OTJ 1;  3CCJ Z;  1RO0 A;  3I55 1;  1YIJ Z;  3HOY I;  2V8K A;  3MON A;  1JJ2 Z;  2VUM I;  2HU9 A;  2M6N A;  1Q7Y 2;  1VQ9 Z;  1ZB8 A;  3I56 Z;  3T4N B;  5LL6 f;  1NJI 2;  1YIT 1;  2JMO A;  2E2J I;  2GU2 A;  3F3P C;  5C3E I;  1K9M 2;  3HOU I;  3NH4 A;  2LFU A;  4DK1 A;  3CC4 Z;  2JNY A;  2GTI A;  2NVT I;  1YIJ 1;  1JJ2 Y;  1QVG Y;  3CCQ Z;  3J7A 4;  2KI7 B;  3CPW Z;  4NBF A;  1S7M A;  4QTT A;  2Q4Z A;  3D6W A;  1LQL A;  3FQM A;  2B63 I;  5A2Q f;  3CCM Z;  3VMH A;  1K8A 1;  1USP B;  1VQ8 Z;  5A2Q b;  2W03 A;  3PO2 I;  1VQO Z;  1USP A;  4RVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...