3S16I

Rna polymerase ii initiation complex with an 8-nt rna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 13
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s16I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s16I02
4NOZA 5FLMI 4A3JI 4NBDA 1R9TI 3M4OI 2J6AA 3ESWA 2HF1A 1Y1VS 4NBHA 2NVQI 4NBFA 2JS4A 1DL6A 3VMGA 5CM2M 3S14I 3LUSA 1TWFI 2JA7I 2JA5I 3GTQI 3PO2I 4A3KI 3H0GI 2K5RA 1ML8A 3EERA 4Y7NI 3I4NI 4NBGA 2E2II 3S16I 4A3LI 3RZOI 4A3CI 5C4XI 3H3VJ 2DE5A 3GTOI 1ZB9A 3U50C 5IP7I 4MH4A 4QTTA 5IP9I 3S2DI 1I6HI 1NUIA 2P3YA 3GTMS 3D6WA 2JA6I 3HOXI 1TFIA 1PFTA 3Q87A 5C3EI 1K83I 1RO4A 1TWCI 3S2HI 2E2JI 1TWGI 3HOUI 2R93I 2BJOA 2F4MA 1VLAA 2NVTI 4BXXI 3RZDI 4BY1I 3S17I 2R7ZI 4A3GI 3PO3I 4NBCA 3VB9A 2NVXI 3HOVI 1QYPA 1N2FA 3M3YI 1USPB 2E2HI 4BY7I 1ZB8A 1X3ZA 2JR6A 1USPA 5C4JI 1Y1VI 4NBAA 1TWAI 3GTJI 1X3WA 3CQZI 4A3II 3S1MI 1YUAA 1RLYA 4Y52I 3VMIA 5C44I 4A3FI 1WW9A 4BBSI 3GTGI 3VMHA 4BBRI 1L1OC 4A93I 2KPIA 2B63I 2F4OA 2JA8I 3GTKI 3I4MI 3HOWI 1Y1WI 2YU9I 1WCMI 3S15I 4A3DI 3GCFA 2DE6A 4QTUA 4NBEA 2RBLA 3GTMI 1LQLA 2NVYI 4A3BI 3HOYI 2VUMI 3GTLI 2AKLA 3GKQA 1I50I 2R92I 3S1QI 1I3QI 3FKII 4XX2A 3S1NI 2JNYA 2DE7A 2PK7A 3S1RI 4A3EI 3PO3S 3I07A 4A3MI 1TWHI 1SFOI 4NB8A 4NBBA 4NB9A 3HOZI 4X6AI 3K7AI 3GTPI
chains in the Genus database with same CATH superfamily
3D2LA 4HGZA 4NBDA 1R9TI 1RO2A 3M4OI 2J6AA 1NP6A 1RNIA 1Y1VS 1N8R1 1X0TA 2JS4A 4RVDA 1Q822 3CCUZ 3S14I 3HKZA 1VQPZ 5A2Qf 1VQOZ 3G71Z 2OOXB 2GTHA 3EERA 3I4NI 4RV9A 4A3CI 3GTOI 1VQN1 1YJN1 4E2ZA 4MH4A 4QTTA 4E2WA 2W04A 1JJ2Z 3S2DI 1I6HI 1NUIA 2RIQA 2Q51A 5D1PA 5T6BA 3CXCZ 1FDOA 1KC82 2V45A 1YHQ1 2WB1A 2JA6I 3HOXI 1TFIA 4MD9A 3Q87A 5C3EI 1TWCI 1M901 5D1OB 2QKDA 3CMA1 1Q821 3BG0B 3CCQZ 3MZKB 2BJOA 2NVTI 2NAPA 4DGLA 2R7ZI 2K3RA 1KQSY 1VQ61 2NVXI 2QRDB 1Q7Y2 1ZB8A 3MONA 2JR6A 4NH1C 3G4SZ 3NDIA 4E2XA 3GTJI 1X3WA 2LEXA 1YUAA 1VQNZ 3VMHA 1YJNZ 2JA8I 1VQ41 2QA41 3HOWI 2E9HA 1Y1WI 4A3DI 2DE6A 1YHQZ 1YI21 2QR1B 4A3BI 3NFZA 1YUKA 3J81b 3S1NI 3CCU1 1Z02A 1ZH1A 2LFUA 3S1RI 3PO3S 3I07A 4A3MI 1RQFA 4NB8A 5T64A 3JAMb 3HOZI 1VQ6Z 4X6AI 1KQSZ 2JIQA 5FLMI 3J81f 4A3JI 1Z03A 2Y0SA 1N8R2 3J7A4 4HGYA 2HF1A 4NBFA 2VUGA 2OTL1 1DL6A 3VMGA 5CM2M 3JAMf 2JIPA 3CCL1 3CCV1 1SIWA 1ML8A 1KD11 4Y7NI 3S16I 4NBGA 2VF1A 4A3LI 3RZOI 1VQ4Z 3H3VJ 2QA4Z 3U50C 3I551 1YI2Z 4AYBA 2RPRA 3P5JB 1M902 4MD8A 1YIJ1 1VQ5Z 3G4S1 4RVFA 3HOUI 1TWGI 2P28A 5FLXb 2R93I 3D9XA 4BXXI 3RZDI 3NH5A 3FQQA 4RVHA 4RVGA 4DK1A 1VQ71 4NBCA 3VB9A 4E2YA 2V8IA 2VPYA 4E31A 2VPZA 2E2HI 2OTLZ 4BY7I 5FLXf 3G6EZ 1X3ZA 1USPA 5C4JI 4TNUA 2PMZA 4NBAA 1TWAI 3CCLZ 3CCVZ 1QVGY 3NH8A 3CQZI 4A3II 1K9M1 1Q812 1RLYA 3OW2Y 3TDHB 5C44I 3GTGI 2V3VA 4BBRI 1L1OC 1VQMZ 3I55Z 2F4OA 3CD61 2VPXA 4QTUA 1K8A1 2RBLA 3GTMI 1YIJZ 3GTLI 3GKQA 2JIOA 2R92I 1I3QI 3FKII 1S7MA 1VQL1 5IT9b 3IFUA 2PK7A 3CC41 1VQ7Z 1Q811 4MD7A 1P9NA 4NOZA 3I561 2JMOA 3CCR1 5IT9f 1KRLA 2NVQI 4MXUA 3LUSA 1YJ91 1TWFI 2OTJ1 1QVGZ 3GTQI 1VQ51 1KD12 2M6NA 2K5RA 1VQ81 3OW2Z 1Y8CA 2Q4ZA 2DE5A 3CD6Z 2QLVB 1WJ2A 3CPWY 5IP9I 2KI7B 1M1K1 2P3YA 3D6WA 3CC2Z 2I3CA 3F3PC 2WAQA 1PFTA 1K83I 1RO4A 3G6E1 3S2HI 1VQLZ 3NDJA 2IZ3A 3CC4Z 2RHBA 4E33A 4BY1I 3F3FC 2RT9A 3T4NB 3S17I 4A3GI 3CCM1 1WIIA 3HOVI 1VQM1 3I56Z 3CXCY 1N2FA 3CCRZ 1QVFY 2VPWA 1USPB 2OZKA 2V8KA 4E32A 5T67A 1Y1VI 1YJ9Z 3IX0A 2OTJZ 2O53A 1K9M2 3CC71 1VQ8Z 1Q16A 4Y52I 3VMIA 1AA6A 4A93I 1K731 3I4MI 2QRCB 4E30A 4EWCA 2M48A 1NJI1 3CPWZ 3S15I 2LIYA 4CL1A 2IZ4A 3KIFA 3GCFA 5AN9F 1K8A2 1LQLA 3HOYI 2VUMI 2JIMA 2AKLA 2EGTA 2V8JA 2QEX1 3S1QI 1S721 4XX2A 2DE7A 3MZLB 3FQMA 3CCMZ 3CCS1 1VQK1 4NB9A 3K7AI 3GTPI 3VTNA 3EEDA 2G2KA 5LL6f 1QVFZ 3ESWA 3J80b 4NBHA 3CME1 2E7ZA 4MONA 1QXFA 1W2BY 1FDIA 3CC21 3CCJ1 2R6MA 3CC7Z 2PM9A 2JA5I 2JA7I 3KIHA 3PO2I 4A3KI 3QWUA 4DQYB 3H0GI 4MRIA 2GU2A 2E2II 5C4XI 2OOYB 2AYDA 1ZB9A 5IP7I 3J80f 2JIRA 3BG1B 1Q862 1M1K2 1VQ91 3CCE1 3GTMS 2O4HA 2YADA 1RO0A 1KC81 2W03A 1YIT1 2QEXZ 1S72Z 3IF8A 2ZAEB 2E2JI 5D1OA 1Z01A 2F4MA 1VLAA 1WZNA 3CCSZ 1VQKZ 4HH4A 3PO3I 4NFRA 3IR7A 1QYPA 4RS4A 4S1TA 1YJW1 3M3YI 1Q861 3CMEZ 1JWHC 2H85A 3CCJZ 1Q7Y1 3CMAZ 1W2BZ 3S1MI 1VQP1 1VQO1 3G711 4A3FI 1WW9A 4BBSI 2IV2X 1K732 3TE5B 2KPIA 2B63I 3GTKI 1NJI2 1VQ9Z 1JJ2Y 3CCEZ 2HU9A 2YU9I 1WCMI 2GTIA 1YITZ 4NBEA 2QREB 1QF8A 2NVYI 3NH4A 1I50I 2JNYA 2JUBA 3CCQ1 4A3EI 1TWHI 1SFOI 4NBBA 5A2Qb 1YJWZ
chains in the Genus database with same CATH topology
4HGZA 4NBDA 1R9TI 1RO2A 3M4OI 2J6AA 1NP6A 1RNIA 1Y1VS 1N8R1 1X0TA 2JS4A 4RVDA 1Q822 3CCUZ 3S14I 3HKZA 1VQPZ 5A2Qf 1VQOZ 3G71Z 2OOXB 2GTHA 3EERA 3I4NI 4RV9A 4A3CI 3GTOI 1VQN1 1YJN1 4E2ZA 4MH4A 4QTTA 4E2WA 2W04A 1JJ2Z 3S2DI 1I6HI 1NUIA 2RIQA 2Q51A 5D1PA 5T6BA 3CXCZ 1KC82 1YHQ1 2WB1A 2JA6I 3HOXI 1TFIA 4MD9A 3Q87A 5C3EI 1TWCI 1M901 5D1OB 2QKDA 3CMA1 1Q821 3BG0B 3CCQZ 3MZKB 2BJOA 2NVTI 4DGLA 2R7ZI 2K3RA 1KQSY 1VQ61 2NVXI 2QRDB 1Q7Y2 1ZB8A 3MONA 2JR6A 4NH1C 3G4SZ 3NDIA 4E2XA 3GTJI 1X3WA 1YUAA 1VQNZ 3VMHA 1YJNZ 2JA8I 1VQ41 2QA41 3HOWI 2E9HA 1Y1WI 4A3DI 2DE6A 1YHQZ 1YI21 2QR1B 4A3BI 3NFZA 1YUKA 3J81b 3S1NI 3CCU1 1Z02A 1ZH1A 2LFUA 3S1RI 3PO3S 3I07A 4A3MI 1RQFA 4NB8A 5T64A 3JAMb 3HOZI 1VQ6Z 4X6AI 1KQSZ 5FLMI 3J81f 4A3JI 1Z03A 2Y0SA 1N8R2 3J7A4 4HGYA 2HF1A 4NBFA 2VUGA 2OTL1 1DL6A 3VMGA 5CM2M 3JAMf 3CCL1 3CCV1 1ML8A 1KD11 4Y7NI 3S16I 4NBGA 2VF1A 4A3LI 3RZOI 1VQ4Z 3H3VJ 2QA4Z 3U50C 3I551 1YI2Z 4AYBA 2RPRA 3P5JB 1M902 4MD8A 1YIJ1 1VQ5Z 3G4S1 4RVFA 3HOUI 1TWGI 2P28A 5FLXb 2R93I 3D9XA 4BXXI 3RZDI 3NH5A 3FQQA 4RVHA 4RVGA 4DK1A 1VQ71 4NBCA 3VB9A 4E2YA 2V8IA 4E31A 2E2HI 2OTLZ 4BY7I 5FLXf 3G6EZ 1X3ZA 1USPA 5C4JI 4TNUA 2PMZA 4NBAA 1TWAI 3CCLZ 3CCVZ 1QVGY 3NH8A 3CQZI 4A3II 1K9M1 1Q812 1RLYA 3OW2Y 3TDHB 5C44I 3GTGI 4BBRI 1L1OC 1VQMZ 3I55Z 2F4OA 3CD61 4QTUA 1K8A1 2RBLA 3GTMI 1YIJZ 3GTLI 3GKQA 2R92I 1I3QI 3FKII 1S7MA 1VQL1 5IT9b 3IFUA 2PK7A 3CC41 1VQ7Z 1Q811 4MD7A 1P9NA 4NOZA 3I561 2JMOA 3CCR1 5IT9f 1KRLA 2NVQI 4MXUA 3LUSA 1YJ91 1TWFI 2OTJ1 1QVGZ 3GTQI 1VQ51 1KD12 2M6NA 2K5RA 1VQ81 3OW2Z 2Q4ZA 2DE5A 3CD6Z 2QLVB 3CPWY 5IP9I 2KI7B 1M1K1 2P3YA 3D6WA 3CC2Z 2I3CA 3F3PC 2WAQA 1PFTA 1K83I 1RO4A 3G6E1 3S2HI 1VQLZ 3NDJA 2IZ3A 3CC4Z 2RHBA 4E33A 4BY1I 3F3FC 2RT9A 3T4NB 3S17I 4A3GI 3CCM1 1WIIA 3HOVI 1VQM1 3I56Z 3CXCY 1N2FA 3CCRZ 1QVFY 1USPB 2OZKA 2V8KA 4E32A 5T67A 1Y1VI 1YJ9Z 3IX0A 2OTJZ 2O53A 1K9M2 3CC71 1VQ8Z 4Y52I 3VMIA 4A93I 1K731 3I4MI 2QRCB 4E30A 4EWCA 2M48A 1NJI1 3CPWZ 3S15I 2LIYA 4CL1A 2IZ4A 3KIFA 3GCFA 5AN9F 1K8A2 1LQLA 3HOYI 2VUMI 2AKLA 2EGTA 2V8JA 2QEX1 3S1QI 1S721 4XX2A 2DE7A 3MZLB 3FQMA 3CCMZ 3CCS1 1VQK1 4NB9A 3K7AI 3GTPI 3VTNA 3EEDA 2G2KA 5LL6f 1QVFZ 3ESWA 3J80b 4NBHA 3CME1 4MONA 1W2BY 3CC21 3CCJ1 2R6MA 3CC7Z 2PM9A 2JA5I 2JA7I 3KIHA 3PO2I 4A3KI 3QWUA 4DQYB 3H0GI 4MRIA 2GU2A 2E2II 5C4XI 2OOYB 1ZB9A 5IP7I 3J80f 3BG1B 1Q862 1M1K2 1VQ91 3CCE1 3GTMS 2O4HA 2YADA 1RO0A 1KC81 2W03A 1YIT1 2QEXZ 1S72Z 3IF8A 2ZAEB 2E2JI 5D1OA 1Z01A 2F4MA 1VLAA 3CCSZ 1VQKZ 4HH4A 3PO3I 4NFRA 1QYPA 4RS4A 4S1TA 1YJW1 3M3YI 1Q861 3CMEZ 1JWHC 2H85A 3CCJZ 1Q7Y1 3CMAZ 1W2BZ 3S1MI 1VQP1 1VQO1 3G711 4A3FI 1WW9A 4BBSI 1K732 3TE5B 2KPIA 2B63I 3GTKI 1NJI2 1VQ9Z 1JJ2Y 3CCEZ 2HU9A 2YU9I 1WCMI 2GTIA 1YITZ 4NBEA 2QREB 1QF8A 2NVYI 3NH4A 1I50I 2JNYA 2JUBA 3CCQ1 4A3EI 1TWHI 1SFOI 4NBBA 5A2Qb 1YJWZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NOZ A;  5FLM I;  4A3J I;  4NBD A;  1R9T I;  3M4O I;  2J6A A;  3ESW A;  2HF1 A;  1Y1V S;  4NBH A;  2NVQ I;  4NBF A;  2JS4 A;  1DL6 A;  3VMG A;  5CM2 M;  3S14 I;  3LUS A;  1TWF I;  2JA7 I;  2JA5 I;  3GTQ I;  3PO2 I;  4A3K I;  3H0G I;  2K5R A;  1ML8 A;  3EER A;  4Y7N I;  3I4N I;  4NBG A;  2E2I I;  3S16 I;  4A3L I;  3RZO I;  4A3C I;  5C4X I;  3H3V J;  2DE5 A;  3GTO I;  1ZB9 A;  3U50 C;  5IP7 I;  4MH4 A;  4QTT A;  5IP9 I;  3S2D I;  1I6H I;  1NUI A;  2P3Y A;  3GTM S;  3D6W A;  2JA6 I;  3HOX I;  1TFI A;  1PFT A;  3Q87 A;  5C3E I;  1K83 I;  1RO4 A;  1TWC I;  3S2H I;  2E2J I;  1TWG I;  3HOU I;  2R93 I;  2BJO A;  2F4M A;  1VLA A;  2NVT I;  4BXX I;  3RZD I;  4BY1 I;  3S17 I;  2R7Z I;  4A3G I;  3PO3 I;  4NBC A;  3VB9 A;  2NVX I;  3HOV I;  1QYP A;  1N2F A;  3M3Y I;  1USP B;  2E2H I;  4BY7 I;  1ZB8 A;  1X3Z A;  2JR6 A;  1USP A;  5C4J I;  1Y1V I;  4NBA A;  1TWA I;  3GTJ I;  1X3W A;  3CQZ I;  4A3I I;  3S1M I;  1YUA A;  1RLY A;  4Y52 I;  3VMI A;  5C44 I;  4A3F I;  1WW9 A;  4BBS I;  3GTG I;  3VMH A;  4BBR I;  1L1O C;  4A93 I;  2KPI A;  2B63 I;  2F4O A;  2JA8 I;  3GTK I;  3I4M I;  3HOW I;  1Y1W I;  2YU9 I;  1WCM I;  3S15 I;  4A3D I;  3GCF A;  2DE6 A;  4QTU A;  4NBE A;  2RBL A;  3GTM I;  1LQL A;  2NVY I;  4A3B I;  3HOY I;  2VUM I;  3GTL I;  2AKL A;  3GKQ A;  1I50 I;  2R92 I;  3S1Q I;  1I3Q I;  3FKI I;  4XX2 A;  3S1N I;  2JNY A;  2DE7 A;  2PK7 A;  3S1R I;  4A3E I;  3PO3 S;  3I07 A;  4A3M I;  1TWH I;  1SFO I;  4NB8 A;  4NBB A;  4NB9 A;  3HOZ I;  4X6A I;  3K7A I;  3GTP I; 
#chains in the Genus database with same CATH topology
 3D2L A;  4HGZ A;  4NBD A;  1R9T I;  1RO2 A;  3M4O I;  2J6A A;  1NP6 A;  1RNI A;  1Y1V S;  1N8R 1;  1X0T A;  2JS4 A;  4RVD A;  1Q82 2;  3CCU Z;  3S14 I;  3HKZ A;  1VQP Z;  5A2Q f;  1VQO Z;  3G71 Z;  2OOX B;  2GTH A;  3EER A;  3I4N I;  4RV9 A;  4A3C I;  3GTO I;  1VQN 1;  1YJN 1;  4E2Z A;  4MH4 A;  4QTT A;  4E2W A;  2W04 A;  1JJ2 Z;  3S2D I;  1I6H I;  1NUI A;  2RIQ A;  2Q51 A;  5D1P A;  5T6B A;  3CXC Z;  1FDO A;  1KC8 2;  2V45 A;  1YHQ 1;  2WB1 A;  2JA6 I;  3HOX I;  1TFI A;  4MD9 A;  3Q87 A;  5C3E I;  1TWC I;  1M90 1;  5D1O B;  2QKD A;  3CMA 1;  1Q82 1;  3BG0 B;  3CCQ Z;  3MZK B;  2BJO A;  2NVT I;  2NAP A;  4DGL A;  2R7Z I;  2K3R A;  1KQS Y;  1VQ6 1;  2NVX I;  2QRD B;  1Q7Y 2;  1ZB8 A;  3MON A;  2JR6 A;  4NH1 C;  3G4S Z;  3NDI A;  4E2X A;  3GTJ I;  1X3W A;  2LEX A;  1YUA A;  1VQN Z;  3VMH A;  1YJN Z;  2JA8 I;  1VQ4 1;  2QA4 1;  3HOW I;  2E9H A;  1Y1W I;  4A3D I;  2DE6 A;  1YHQ Z;  1YI2 1;  2QR1 B;  4A3B I;  3NFZ A;  1YUK A;  3J81 b;  3S1N I;  3CCU 1;  1Z02 A;  1ZH1 A;  2LFU A;  3S1R I;  3PO3 S;  3I07 A;  4A3M I;  1RQF A;  4NB8 A;  5T64 A;  3JAM b;  3HOZ I;  1VQ6 Z;  4X6A I;  1KQS Z;  2JIQ A;  5FLM I;  3J81 f;  4A3J I;  1Z03 A;  2Y0S A;  1N8R 2;  3J7A 4;  4HGY A;  2HF1 A;  4NBF A;  2VUG A;  2OTL 1;  1DL6 A;  3VMG A;  5CM2 M;  3JAM f;  2JIP A;  3CCL 1;  3CCV 1;  1SIW A;  1ML8 A;  1KD1 1;  4Y7N I;  3S16 I;  4NBG A;  2VF1 A;  4A3L I;  3RZO I;  1VQ4 Z;  3H3V J;  2QA4 Z;  3U50 C;  3I55 1;  1YI2 Z;  4AYB A;  2RPR A;  3P5J B;  1M90 2;  4MD8 A;  1YIJ 1;  1VQ5 Z;  3G4S 1;  4RVF A;  3HOU I;  1TWG I;  2P28 A;  5FLX b;  2R93 I;  3D9X A;  4BXX I;  3RZD I;  3NH5 A;  3FQQ A;  4RVH A;  4RVG A;  4DK1 A;  1VQ7 1;  4NBC A;  3VB9 A;  4E2Y A;  2V8I A;  2VPY A;  4E31 A;  2VPZ A;  2E2H I;  2OTL Z;  4BY7 I;  5FLX f;  3G6E Z;  1X3Z A;  1USP A;  5C4J I;  4TNU A;  2PMZ A;  4NBA A;  1TWA I;  3CCL Z;  3CCV Z;  1QVG Y;  3NH8 A;  3CQZ I;  4A3I I;  1K9M 1;  1Q81 2;  1RLY A;  3OW2 Y;  3TDH B;  5C44 I;  3GTG I;  2V3V A;  4BBR I;  1L1O C;  1VQM Z;  3I55 Z;  2F4O A;  3CD6 1;  2VPX A;  4QTU A;  1K8A 1;  2RBL A;  3GTM I;  1YIJ Z;  3GTL I;  3GKQ A;  2JIO A;  2R92 I;  1I3Q I;  3FKI I;  1S7M A;  1VQL 1;  5IT9 b;  3IFU A;  2PK7 A;  3CC4 1;  1VQ7 Z;  1Q81 1;  4MD7 A;  1P9N A;  4NOZ A;  3I56 1;  2JMO A;  3CCR 1;  5IT9 f;  1KRL A;  2NVQ I;  4MXU A;  3LUS A;  1YJ9 1;  1TWF I;  2OTJ 1;  1QVG Z;  3GTQ I;  1VQ5 1;  1KD1 2;  2M6N A;  2K5R A;  1VQ8 1;  3OW2 Z;  1Y8C A;  2Q4Z A;  2DE5 A;  3CD6 Z;  2QLV B;  1WJ2 A;  3CPW Y;  5IP9 I;  2KI7 B;  1M1K 1;  2P3Y A;  3D6W A;  3CC2 Z;  2I3C A;  3F3P C;  2WAQ A;  1PFT A;  1K83 I;  1RO4 A;  3G6E 1;  3S2H I;  1VQL Z;  3NDJ A;  2IZ3 A;  3CC4 Z;  2RHB A;  4E33 A;  4BY1 I;  3F3F C;  2RT9 A;  3T4N B;  3S17 I;  4A3G I;  3CCM 1;  1WII A;  3HOV I;  1VQM 1;  3I56 Z;  3CXC Y;  1N2F A;  3CCR Z;  1QVF Y;  2VPW A;  1USP B;  2OZK A;  2V8K A;  4E32 A;  5T67 A;  1Y1V I;  1YJ9 Z;  3IX0 A;  2OTJ Z;  2O53 A;  1K9M 2;  3CC7 1;  1VQ8 Z;  1Q16 A;  4Y52 I;  3VMI A;  1AA6 A;  4A93 I;  1K73 1;  3I4M I;  2QRC B;  4E30 A;  4EWC A;  2M48 A;  1NJI 1;  3CPW Z;  3S15 I;  2LIY A;  4CL1 A;  2IZ4 A;  3KIF A;  3GCF A;  5AN9 F;  1K8A 2;  1LQL A;  3HOY I;  2VUM I;  2JIM A;  2AKL A;  2EGT A;  2V8J A;  2QEX 1;  3S1Q I;  1S72 1;  4XX2 A;  2DE7 A;  3MZL B;  3FQM A;  3CCM Z;  3CCS 1;  1VQK 1;  4NB9 A;  3K7A I;  3GTP I;  3VTN A;  3EED A;  2G2K A;  5LL6 f;  1QVF Z;  3ESW A;  3J80 b;  4NBH A;  3CME 1;  2E7Z A;  4MON A;  1QXF A;  1W2B Y;  1FDI A;  3CC2 1;  3CCJ 1;  2R6M A;  3CC7 Z;  2PM9 A;  2JA5 I;  2JA7 I;  3KIH A;  3PO2 I;  4A3K I;  3QWU A;  4DQY B;  3H0G I;  4MRI A;  2GU2 A;  2E2I I;  5C4X I;  2OOY B;  2AYD A;  1ZB9 A;  5IP7 I;  3J80 f;  2JIR A;  3BG1 B;  1Q86 2;  1M1K 2;  1VQ9 1;  3CCE 1;  3GTM S;  2O4H A;  2YAD A;  1RO0 A;  1KC8 1;  2W03 A;  1YIT 1;  2QEX Z;  1S72 Z;  3IF8 A;  2ZAE B;  2E2J I;  5D1O A;  1Z01 A;  2F4M A;  1VLA A;  1WZN A;  3CCS Z;  1VQK Z;  4HH4 A;  3PO3 I;  4NFR A;  3IR7 A;  1QYP A;  4RS4 A;  4S1T A;  1YJW 1;  3M3Y I;  1Q86 1;  3CME Z;  1JWH C;  2H85 A;  3CCJ Z;  1Q7Y 1;  3CMA Z;  1W2B Z;  3S1M I;  1VQP 1;  1VQO 1;  3G71 1;  4A3F I;  1WW9 A;  4BBS I;  2IV2 X;  1K73 2;  3TE5 B;  2KPI A;  2B63 I;  3GTK I;  1NJI 2;  1VQ9 Z;  1JJ2 Y;  3CCE Z;  2HU9 A;  2YU9 I;  1WCM I;  2GTI A;  1YIT Z;  4NBE A;  2QRE B;  1QF8 A;  2NVY I;  3NH4 A;  1I50 I;  2JNY A;  2JUB A;  3CCQ 1;  4A3E I;  1TWH I;  1SFO I;  4NBB A;  5A2Q b;  1YJW Z; 
#chains in the Genus database with same CATH homology
 4HGZ A;  4NBD A;  1R9T I;  1RO2 A;  3M4O I;  2J6A A;  1NP6 A;  1RNI A;  1Y1V S;  1N8R 1;  1X0T A;  2JS4 A;  4RVD A;  1Q82 2;  3CCU Z;  3S14 I;  3HKZ A;  1VQP Z;  5A2Q f;  1VQO Z;  3G71 Z;  2OOX B;  2GTH A;  3EER A;  3I4N I;  4RV9 A;  4A3C I;  3GTO I;  1VQN 1;  1YJN 1;  4E2Z A;  4MH4 A;  4QTT A;  4E2W A;  2W04 A;  1JJ2 Z;  3S2D I;  1I6H I;  1NUI A;  2RIQ A;  2Q51 A;  5D1P A;  5T6B A;  3CXC Z;  1KC8 2;  1YHQ 1;  2WB1 A;  2JA6 I;  3HOX I;  1TFI A;  4MD9 A;  3Q87 A;  5C3E I;  1TWC I;  1M90 1;  5D1O B;  2QKD A;  3CMA 1;  1Q82 1;  3BG0 B;  3CCQ Z;  3MZK B;  2BJO A;  2NVT I;  4DGL A;  2R7Z I;  2K3R A;  1KQS Y;  1VQ6 1;  2NVX I;  2QRD B;  1Q7Y 2;  1ZB8 A;  3MON A;  2JR6 A;  4NH1 C;  3G4S Z;  3NDI A;  4E2X A;  3GTJ I;  1X3W A;  1YUA A;  1VQN Z;  3VMH A;  1YJN Z;  2JA8 I;  1VQ4 1;  2QA4 1;  3HOW I;  2E9H A;  1Y1W I;  4A3D I;  2DE6 A;  1YHQ Z;  1YI2 1;  2QR1 B;  4A3B I;  3NFZ A;  1YUK A;  3J81 b;  3S1N I;  3CCU 1;  1Z02 A;  1ZH1 A;  2LFU A;  3S1R I;  3PO3 S;  3I07 A;  4A3M I;  1RQF A;  4NB8 A;  5T64 A;  3JAM b;  3HOZ I;  1VQ6 Z;  4X6A I;  1KQS Z;  5FLM I;  3J81 f;  4A3J I;  1Z03 A;  2Y0S A;  1N8R 2;  3J7A 4;  4HGY A;  2HF1 A;  4NBF A;  2VUG A;  2OTL 1;  1DL6 A;  3VMG A;  5CM2 M;  3JAM f;  3CCL 1;  3CCV 1;  1ML8 A;  1KD1 1;  4Y7N I;  3S16 I;  4NBG A;  2VF1 A;  4A3L I;  3RZO I;  1VQ4 Z;  3H3V J;  2QA4 Z;  3U50 C;  3I55 1;  1YI2 Z;  4AYB A;  2RPR A;  3P5J B;  1M90 2;  4MD8 A;  1YIJ 1;  1VQ5 Z;  3G4S 1;  4RVF A;  3HOU I;  1TWG I;  2P28 A;  5FLX b;  2R93 I;  3D9X A;  4BXX I;  3RZD I;  3NH5 A;  3FQQ A;  4RVH A;  4RVG A;  4DK1 A;  1VQ7 1;  4NBC A;  3VB9 A;  4E2Y A;  2V8I A;  4E31 A;  2E2H I;  2OTL Z;  4BY7 I;  5FLX f;  3G6E Z;  1X3Z A;  1USP A;  5C4J I;  4TNU A;  2PMZ A;  4NBA A;  1TWA I;  3CCL Z;  3CCV Z;  1QVG Y;  3NH8 A;  3CQZ I;  4A3I I;  1K9M 1;  1Q81 2;  1RLY A;  3OW2 Y;  3TDH B;  5C44 I;  3GTG I;  4BBR I;  1L1O C;  1VQM Z;  3I55 Z;  2F4O A;  3CD6 1;  4QTU A;  1K8A 1;  2RBL A;  3GTM I;  1YIJ Z;  3GTL I;  3GKQ A;  2R92 I;  1I3Q I;  3FKI I;  1S7M A;  1VQL 1;  5IT9 b;  3IFU A;  2PK7 A;  3CC4 1;  1VQ7 Z;  1Q81 1;  4MD7 A;  1P9N A;  4NOZ A;  3I56 1;  2JMO A;  3CCR 1;  5IT9 f;  1KRL A;  2NVQ I;  4MXU A;  3LUS A;  1YJ9 1;  1TWF I;  2OTJ 1;  1QVG Z;  3GTQ I;  1VQ5 1;  1KD1 2;  2M6N A;  2K5R A;  1VQ8 1;  3OW2 Z;  2Q4Z A;  2DE5 A;  3CD6 Z;  2QLV B;  3CPW Y;  5IP9 I;  2KI7 B;  1M1K 1;  2P3Y A;  3D6W A;  3CC2 Z;  2I3C A;  3F3P C;  2WAQ A;  1PFT A;  1K83 I;  1RO4 A;  3G6E 1;  3S2H I;  1VQL Z;  3NDJ A;  2IZ3 A;  3CC4 Z;  2RHB A;  4E33 A;  4BY1 I;  3F3F C;  2RT9 A;  3T4N B;  3S17 I;  4A3G I;  3CCM 1;  1WII A;  3HOV I;  1VQM 1;  3I56 Z;  3CXC Y;  1N2F A;  3CCR Z;  1QVF Y;  1USP B;  2OZK A;  2V8K A;  4E32 A;  5T67 A;  1Y1V I;  1YJ9 Z;  3IX0 A;  2OTJ Z;  2O53 A;  1K9M 2;  3CC7 1;  1VQ8 Z;  4Y52 I;  3VMI A;  4A93 I;  1K73 1;  3I4M I;  2QRC B;  4E30 A;  4EWC A;  2M48 A;  1NJI 1;  3CPW Z;  3S15 I;  2LIY A;  4CL1 A;  2IZ4 A;  3KIF A;  3GCF A;  5AN9 F;  1K8A 2;  1LQL A;  3HOY I;  2VUM I;  2AKL A;  2EGT A;  2V8J A;  2QEX 1;  3S1Q I;  1S72 1;  4XX2 A;  2DE7 A;  3MZL B;  3FQM A;  3CCM Z;  3CCS 1;  1VQK 1;  4NB9 A;  3K7A I;  3GTP I;  3VTN A;  3EED A;  2G2K A;  5LL6 f;  1QVF Z;  3ESW A;  3J80 b;  4NBH A;  3CME 1;  4MON A;  1W2B Y;  3CC2 1;  3CCJ 1;  2R6M A;  3CC7 Z;  2PM9 A;  2JA5 I;  2JA7 I;  3KIH A;  3PO2 I;  4A3K I;  3QWU A;  4DQY B;  3H0G I;  4MRI A;  2GU2 A;  2E2I I;  5C4X I;  2OOY B;  1ZB9 A;  5IP7 I;  3J80 f;  3BG1 B;  1Q86 2;  1M1K 2;  1VQ9 1;  3CCE 1;  3GTM S;  2O4H A;  2YAD A;  1RO0 A;  1KC8 1;  2W03 A;  1YIT 1;  2QEX Z;  1S72 Z;  3IF8 A;  2ZAE B;  2E2J I;  5D1O A;  1Z01 A;  2F4M A;  1VLA A;  3CCS Z;  1VQK Z;  4HH4 A;  3PO3 I;  4NFR A;  1QYP A;  4RS4 A;  4S1T A;  1YJW 1;  3M3Y I;  1Q86 1;  3CME Z;  1JWH C;  2H85 A;  3CCJ Z;  1Q7Y 1;  3CMA Z;  1W2B Z;  3S1M I;  1VQP 1;  1VQO 1;  3G71 1;  4A3F I;  1WW9 A;  4BBS I;  1K73 2;  3TE5 B;  2KPI A;  2B63 I;  3GTK I;  1NJI 2;  1VQ9 Z;  1JJ2 Y;  3CCE Z;  2HU9 A;  2YU9 I;  1WCM I;  2GTI A;  1YIT Z;  4NBE A;  2QRE B;  1QF8 A;  2NVY I;  3NH4 A;  1I50 I;  2JNY A;  2JUB A;  3CCQ 1;  4A3E I;  1TWH I;  1SFO I;  4NBB A;  5A2Q b;  1YJW Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...